MUSCLE (3.8) multiple sequence alignment

CAGL0E01419g       ------------------MKLKNVALVAGCVNAVAAE-----------------------
TPHA0C00840        --------------------MVAPILFALLFTQLTNVSAELIQ----------------F
TBLA0A03910        MKFTN-------------SIAISALALLQQFQSASALIWNREQVEAKEAKNIQ------P
ZYRO0F10230g       ------------------MKWNQILKCTLLANVARSAAFSQEVE---------------E
AGL192W            -------------------MIAQIAALGAVLATNVACASLVER----------------E
Ecym_4251          ------------------MKLSGCIAATVLAFVPSSFALLAQR----------------A
KLLA0E04049g       ------------------MKLSDVCLGALLASLGSAGYITKRDVSQVG-----------E
KLTH0G12386g       -----------------MKLLSTSTFLAACGLASAAVVSSRDEGA--------------Q
Kwal_56.23902      ------------------MRISSSTAILGLAGLVSSTAISAEAKYS-------------Q
NDAI0J01030        MKIPSIL------RDTILTTTSSLLLLSTIKNVIATTSIPSQQEQ--------------N
NCAS0B03560        MRLSTIK-----------YIFSSSLLFTNILASTIPEHETT------------------D
KNAG0I00910        ------------------------------------------------------------
TDEL0F04450        ------------------MQLLPAALISGFLLGSQAVALSDVD----------------E
KAFR0H02300        ------------------MILLAYLVESLFFIPNYSLSLPQIGGGD-------------S
SAKL0H15664g       ------------------MRFDIIAISLLLSQLVTASVLK-------------------K
Suva_2.305         ------------------MKFSAITLATNAFLFYSSMANADSLASPSL-----------A
Skud_4.403         ------------------MKFSAATFVANAFLLYSSTVSADSIASASI-----------A
Smik_4.388         ------------------MKLSTIKFVVNALLLHSSMVFADSIISQSS-----------E
YDR144C            ------------------MKLSVLTFVVDALLVCSSIVDAGVTDFPSL-----------P
TBLA0H01290        --------------MKDHAILLALLALINVSISDPIPPVENSNNDGKVN----------S
KNAG0G02410        ------------------MLLAPSVLFPLVAVCAAAK-----------------------
KAFR0B05710        ------------------MKLLNSKLILSTSLITALTDASIVAKD--------------S
CAGL0M04191g       ------------------MKFSSLCMLASVAAHSKAAKNVADL-----------------
Suva_10.211        MRLATIR-----------SALLSSLFASQTLAKLIPVATDGDGG---------------D
YLR120C            MKLKTVR-----------SAVLSSLFASQVLGKIIPAANKRDD----------------D
Skud_12.192        MKLTTVR-----------SAVLSSLFALQTLAKIIPAASKRDD----------------D
Smik_12.186        MRLATVR-----------SAVLSSLFALQVLAKIIPVASKRDNDDD-------------D
Kpol_543.61        MKLFTSKESAIAMALAFSACIDQAASFALPFGLGKKRVVSELEIP-HGKHAKAQQPGASN
TPHA0A01580        MKVLNSN------SVVYAAVLLSDLSNGLSLFGNKKPQLTKRDG---------------S
NDAI0G02620        ----------------MTSRIISHILLSLPYFISQASASSKDN----------------T
NCAS0C03300        ------------------MVFAKQLLSTSLLLSSSLWDFAQALDN--------------E
                                                                               

CAGL0E01419g       ---------------KYLKLDFEKHRADID-EE---------------------LPLTHS
TPHA0C00840        YDK------------KAAVIPFRKYYADSLEEL---------------------DYNTST
TBLA0A03910        IKP------------KFLELKFDRHYGESY-ED---------------------STLGKD
ZYRO0F10230g       QTP------------KIVKLSFDKRHGENY-EE---------------------SLLGKR
AGL192W            EAA------------QFVRMDFDKKRGPSF-SE---------------------AWSGRA
Ecym_4251          ESA------------AYVRFDLDKTRGNDF-RS---------------------SEKGVM
KLLA0E04049g       ANK------------KHVFMSFDKLRGNDA-SE---------------------ASLSKR
KLTH0G12386g       SAS------------KFVKVSFDKLRGDTA-ED---------------------ATAGAV
Kwal_56.23902      DES------------KFVKLSFDKLRGDLV-EN---------------------ARAGQI
NDAI0J01030        KKQGEASENQPAPTLKYVKLPFEKYTGDSF-ES---------------------ATRNNK
NCAS0B03560        QSS------------KYVILPFNKLVGDSY-ED---------------------ATPDKK
KNAG0I00910        ------------------------------------------------------------
TDEL0F04450        KPG------------KYVHLSFDKLRGNSY-EE---------------------AGKGNK
KAFR0H02300        KQP------------DYVNLKFKKTYGDSF--------------------------EGST
SAKL0H15664g       RSP------------KYVSLPFDKSRGSTY-EE---------------------SSKHNK
Suva_2.305         AGD------------NYVRIQFQKKYGDSF-EN---------------------ASSNKK
Skud_4.403         TSE------------SYVIMNFEKKYGDSF-EN---------------------ASNDRN
Smik_4.388         IND------------GYVKMNFQRKYGDSF-ES---------------------ATNDTK
YDR144C            SNE------------VYVKMNFQKKYGSSF-EN---------------------ALDDTK
TBLA0H01290        VNS------------NFLKLGFEKFYADSI-NDIVIEYDNDTDDYRLQKRDSIIDLKESK
KNAG0G02410        ---------------DYVGMRFEKKFGDNY-AG---------------------ATKWQR
KAFR0B05710        KQPSDFNKN------KYLKLGFDKYVGESF---------------------------DKS
CAGL0M04191g       ---------------SYVKLDFDKYYGETFETA---------------------KRGRSQ
Suva_10.211        TGS------------KFVKLSFDKLYGDSL-DT---------------------AGRDKK
YLR120C            SNS------------KFVKLPFHKLYGDSL-EN---------------------VGSDKK
Skud_12.192        SNS------------KFVKLPFHKLYGDTR-DD---------------------VGTDKK
Smik_12.186        SNS------------KFVKLPFHKLYGDSL-DN---------------------VGRDKK
Kpol_543.61        ESQ------------GFVRYHFDKLVGDSF-EN---------------------ASNKNK
TPHA0A01580        EID------------NFIKFKFDKSYGDSY-KN---------------------SSKRNK
NDAI0G02620        SPP------------KYLALNFEKRYGDSF-LN---------------------SSSSNG
NCAS0C03300        LPN------------KFVNLRFNKKYGDHYDTA---------------------STDSRK
                                                                               

CAGL0E01419g       AARQLRKRA-----SDDSVAFPLVAQENYYSINLEVGTPPQNVSLLLDTGSSDMWVIGSN
TPHA0C00840        SETKLVKRD--------GEDIVLTNRNTFYSAEIEVGTPAQTMNVIVDTGSSDLWVIGHD
TBLA0A03910        GAVHLEKRTFDSAYNGSYEDVILTNQLTFYSVELDIGTPAQKVTVVVDTGSSDLWITETS
ZYRO0F10230g       DALPFVKRD-----DGEYE-LSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSD
AGL192W            AVPRLAKRN-----D--WVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAG
Ecym_4251          PFGELKKRD-----DE-YVDVKIHNEQTFYSVNLSIGTPAQEVTVLVDTGSSDLWIIGAD
KLLA0E04049g       RVGHLKKRA-----DG-YVDVEIDNQNTFYSVDLEIGTPAQKVGVLIDTGSSDLWVPGSG
KLTH0G12386g       AHGVLAKRA-----DG-SETVVIKNQQTFYSVELGVGSPAQNVTLLIDTGSSDMWVMGSN
Kwal_56.23902      PRVKRVKRD-----DG-TASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSN
NDAI0J01030        PLNQLLKRDNEDG-AG-YEDVKITNQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSM
NCAS0B03560        PHFALVKR------DGSYENVAIKNEQSFYSVELLIGTPSQKITVLVDTGSSDLWIMGSD
KNAG0I00910        MREWLAKRDNT---DG-YSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTD
TDEL0F04450        PSAELRKRD-----DG-YEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPE
KAFR0H02300        TWSALAKRT-----RG-YELVDLVNRQNFYSVDLDIGTPSQTITVLVDTGSSDLWVTGSD
SAKL0H15664g       PYAVLSKRD-----DG-FQEIELKNQVSFFSVELEIGTPRQNVTVLVDTGSSDLWVTGSN
Suva_2.305         TEARLVKRG-----DD-YEVVDLSNQNSFYSVDLDIGTPSQKVTVLVDTGSSDLWVTGSN
Skud_4.403         AGAHLVRRE-----DD-YELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSN
Smik_4.388         ARARLVTRG-----DD-YELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSD
YDR144C            GRTRLMTRD-----DD-YELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSD
TBLA0H01290        PYVNLIKRN-----DG-YEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSD
KNAG0G02410        PQMRLAKRN-----TG-YEEITLTNQQSFFSVELDVGTPAQNVTVLVDTGSSDLWITGAD
KAFR0B05710        SKDSLQKRA-----E--YAIFNLTNQASFYSVELAIGTPSQNVTVLVDTGSSDLWVTGSD
CAGL0M04191g       ADIRVNKRA-----NG-YEEVQITNQNSFYSVTLEVGTPPQSVVVLVDTGSSDLWITGSD
Suva_10.211        PEVRLSKRA-----DG-YEEIIITNQQSFYSVDLEVGTPAQNITVLVDTGSSDLWIMGSS
YLR120C            PEVRLLKRA-----DG-YEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSD
Skud_12.192        PEVRLLKRA-----DG-YEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSN
Smik_12.186        PEAHLFKRA-----DG-YEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSN
Kpol_543.61        RYANIVKRD-----NG-VEEVEIMNQSNFYSVSLSIGSNAQNVTVLLDTGSSDLWVTGSN
TPHA0A01580        PKLDIVKR------DG-YEEIELKNESSFYSIKLSIGTPAQNVTVLIDTGSSDLWVTGSD
NDAI0G02620        PSAQLIKRD-----DG-YEQVTLTNQQSFYSVEVEMGTPSQKLTVLLDTGSSDFWVTSSD
NCAS0C03300        PKLELVKRD-----GSDYEEVELTNQQSFYSVEVDVGTPSQRVTVLLDTGSSDFWVMGSD
                          *            . :     ::*  : :*:  * : :::****:*:*:    

CAGL0E01419g       NGYCKN--------SDNKSRNLDAL-----------------------------------
TPHA0C00840        NLTCPL--------A---------------------------------------------
TBLA0A03910        NPFCST--------GDDD----------------------TEDSVWSPFLLKD-------
ZYRO0F10230g       NPYCKS--------NSHSSKKRDIGDNSL----DDIFSDITAGGSGAIYKTLT-------
AGL192W            VR-CGP--------NNYP------------------------------------------
Ecym_4251          VD-CGP--------DNSD------------------------------------------
KLLA0E04049g       NPFCSA--------SRSSSKKKRQDYTAL-----------LSSLLSVFGTDVA-------
KLTH0G12386g       NPYCEG--------GSSGNSKHVL----------------LGDHVDSRDEEVN-------
Kwal_56.23902      NPYCEG--------SSGKSKHVLLHED-------------SGFEDDTNGKDF--------
NDAI0J01030        NPFCQSSLNSRNVVIKRDDDDDDDDDDDDTQQAAGMFTEILVTNLSDLGNLSD-------
NCAS0B03560        NPYCAS--------TSNGKNVMRKDDSNLPDGILF-----TEITVTNLSDLTG-------
KNAG0I00910        NPLCASGRRGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWN-------
TDEL0F04450        NPYCID--------SD--------------------------------------------
KAFR0H02300        NPYCVS--------V---------------------------------------------
SAKL0H15664g       NPYCRA--------GSVGNRRNDASSGSG-----------SGSGSSNNKKRVN-------
Suva_2.305         NPYCST--------K-------------------------SGHTSSSSKERKD-------
Skud_4.403         NPYCST--------K-------------------------GKDTSDFSFKQIH-------
Smik_4.388         NPYCFT--------E-------------------------GEDTSGSSFKHVN-------
YDR144C            NPYCST--------K-------------------------KKDTTGSSFKQVN-------
TBLA0H01290        NPYCKS--------NSGKSTNLLTPTDSDSDSDSDSQPDLESGSSSGNNDGDDGSILSWF
KNAG0G02410        NPYCLT--------Y---------------------------------------------
KAFR0B05710        NPLCST--------DSSDDDDDSYAF---KKKRAETIVVTEEATITENGNNLD-------
CAGL0M04191g       NPYCRG--------STGTSGKNMLLEAELKRALEDARDIAKERTTLAPRDDEH-------
Suva_10.211        NPYCSS--------DDSSKYVLR-----------------KRDTSSSSGDLVN-------
YLR120C            NPYCSS--------NSMGSSRRRVID--------------KRDDSSSGGSLIN-------
Skud_12.192        NPYCSS--------GSMSSSRRRVIN--------------KRDDSSSSGALVN-------
Smik_12.186        NPYCSS--------DTRSNSRRRVID--------------KRDDSSSSGALVN-------
Kpol_543.61        NPLCSR--------GDS-------------------------------------------
TPHA0A01580        NPLCSS--------D---------------------------------------------
NDAI0G02620        NPYCGT------------------------------------------------------
NCAS0C03300        NPYCSD--------DT--------------------------------------------
                      *                                                        

CAGL0E01419g       ---------------------------------------GSNRFAKRASSVASASPSSAT
TPHA0C00840        ------------------------------------------------------------
TBLA0A03910        ---------------------------------------KIDPRVLKHKGKRTTSIDVTA
ZYRO0F10230g       -------------------------------------LTGGSMPSSFGSFGSIDVSTGGI
AGL192W            ------------------------------------------------------------
Ecym_4251          ------------------------------------------------------------
KLLA0E04049g       -----------------------------------------TDYTYTGIASATGSAGTQT
KLTH0G12386g       -------------------------------------------RDWFSTLRSFLTATATA
Kwal_56.23902      ---------------------------------------YSDLLSYLTATGTAEYSGSYW
NDAI0J01030        ---------------------------------------LLGSFTIISTGIPGGIIPTGV
NCAS0B03560        ---------------------------------------FFSDFSFIP--MSETDIPTGV
KNAG0I00910        ------------------------------------SVAGDLESGWTM--MTGAENTMMM
TDEL0F04450        ---------------------------------------DTKPVT---------------
KAFR0H02300        ------------------------------------------------------------
SAKL0H15664g       ----------------------------------IKRDEISSVRSWLT--ASG-------
Suva_2.305         ---------------------------------------EDNILSLVQ--SVVQSVASEI
Skud_4.403         ---------------------------------------KDNPASVVE--SVI----TEI
Smik_4.388         ---------------------------------------KDNLVSVVE--SVF----TEI
YDR144C            ---------------------------------------KDALASVVE--SVF----TEI
TBLA0H01290        EKFKFWKNNNKQEEVAKKNIVIIDDVLQIKNAQADSEKPDWNPFGW-------------G
KNAG0G02410        ------------------------------------------------------------
KAFR0B05710        ---------------------------------------GLDPFGWLG--GS--------
CAGL0M04191g       ---------------------------------------NDGLLSWLT--GSDGLLGGQG
Suva_10.211        ---------------------------------------DINPFGWLTETGSVT------
YLR120C            ---------------------------------------DINPFGWLT--GTGSAI----
Skud_12.192        ---------------------------------------DINPFGWLT--GTGSAI----
Smik_12.186        ---------------------------------------DINPFGWLT--GTGGLI----
Kpol_543.61        ------------------------------------------------------------
TPHA0A01580        ------------------------------------------------------------
NDAI0G02620        ------------------------------------------------------------
NCAS0C03300        ------------------------------------------------------------
                                                                               

CAGL0E01419g       DSDGGDDGDDSGDAEQFYPTAASEIPA-AAKTLDCQSLSLFDLEKSSSFKSNSTP--FFT
TPHA0C00840        ----------------------------SDGSFNCERFGSFSISKSSTFTKNSTE--FAI
TBLA0A03910        TATTGSIN-------ISIDLGSNFTLP-PEFLINCTEFGTFNTKKSSTFKNNHTD--FFI
ZYRO0F10230g       EPTETISGGGG----GSGGSPTGSSSS-GGQSIDCSRYGTFDKNQSSTYKSNNTA--FEI
AGL192W            ----------------------------NPNQLNCYEHGSFDTSRSSTWKDNNTQ--FHI
Ecym_4251          ----------------------------STEPLDCFEYGAFDKSKSSSWKNNHTE--FYI
KLLA0E04049g       VPTALTSG-------TVAATSIRSVPS-SLATLDCSEFGTFDTSKSSSWQSNDTR--FYI
KLTH0G12386g       TATATATATGSADSGGNAPSRTSVNS--QYATLTCSSYGTFATDSSSSFQSNNTA--FYI
Kwal_56.23902      ATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQ--FLI
NDAI0J01030        TTATTTGGGGGAGGAGGLPTATNDIPR-SERTLDCQEYGTFNSSRSSTFKNNYTS--FSI
NCAS0B03560        TSTNTVGG-------PVFPTQTNNIAL-SERTIDCSQYGTFDKNQSSTFQTNFTS--FLT
KNAG0I00910        TGTGTETA-------VATGVPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTA--FAI
TDEL0F04450        QLSTSTLA-------TSSGTATSSGNS-GIATVDCSEYGTFDPSKSTSFRSNNTA--FSI
KAFR0H02300        ---------------------KSNLVS-STNKFDCNTYGTFDKNQSSTWSSNDTL--FSI
SAKL0H15664g       TNTRTQSG-------SASATRANSLSS-ALATIDCSQYGTFNTSASSTFSSNDTL--FVI
Suva_2.305         SYDTTITD-------TDATATQDSTSS-ALQTIDCTTYGVFDSSKSSTFQSNKTD--FSI
Skud_4.403         SYDTTISV-------IEATATLDNTPL-ASQKINCGTYGTFDSSKSSTFESNKTK--FSI
Smik_4.388         SYDTTMVT-------SVATATIGNTAS-TSQAMNCTTYGTFDTSKSSTFESNKTE--FSI
YDR144C            SYDTTIVT-------SEATATFDSTAS-TSQLIDCATYGTFNTSKSSTFNSNNTE--FSI
TBLA0H01290        STATATTG-------GNSGYQTMSLDP-SQATINCDTYGTFDIEDSSTFQSNKTS--FAI
KNAG0G02410        -----------------SGSGADSIP--RRDRVDCSEYGTFSLEDSSTWSQNSSAPPFYI
KAFR0B05710        ----TATS-------GSFETSFPSSSS-SSGDFDCSEYGTFNTNDSSTWSSNHTS--FFI
CAGL0M04191g       GTTITLTD-------SAQPTAAGTSNG-ARATINCAKYGTFDTSKSSTWHSNDTA--FMI
Suva_10.211        GATATATG---------SGTATQSVPA-SEATMDCEEYGTFTSSDSSTFKSNNTA--FEI
YLR120C            GPTATGLG-------GGSGTATQSVPA-SEATMDCQQYGTFSTSGSSTFRSNNTY--FSI
Skud_12.192        GPTATGSG-------GGSGTATQSVPA-SEATMNCQEFGTFTTSDSSTFRSNNTY--FSI
Smik_12.186        GPTATGSG-------GSSETATQSVPA-SEATMDCKEYGTFTTSDSSTFRSNNTY--FSI
Kpol_543.61        ----------------------------NSDAVDCAKFGTFNPSTSDTWSSNETS--FSI
TPHA0A01580        -----------------DATFTGSDGS-SQSSIDCSLYGTFDIDDSSSFTSNDTS--FAI
NDAI0G02620        -----------------TSTEGSLYGGETQDTIDCSTYGTFDSSKSSTFQSNDTD--FLI
NCAS0C03300        ----------------------------STTGIDCSEFGTFDSSSSSTFHNNGTA--FNI
                                                   . *   . *  . * ::  * :   *  

CAGL0E01419g       SYGDNSYASGLWGTDDVRLGN-LSIADVFFAVANFSNSSTGVLGVGLPALESYNPALSDN
TPHA0C00840        TYVSGNNCIGVWGQDNLIIGG-VNATGLSFGVVHTTTSSAGILGIGLPDTETTAVGQYGH
TBLA0A03910        SYGDNTFASGYWGRDVLSFQD-INVTGLSFGVANVTNSTVGVLGIGLPELESTYFGTVNS
ZYRO0F10230g       SYGDGSFASGEWGRDHIELGS-LNISDVSMAVANDTNSTVGVLGIGLPGLETTYSSDQSM
AGL192W            RYGDSTYAHGTWGTDRLDLGQ-ANVDGLTFAVAHASNSSVAVLGIGLPAMETTMSSQQFG
Ecym_4251          SYGDTSFASGEWGTDKLDLGD-LNADGLTFAVATASNSSVAVLGIGLTGIEVTRASGDNG
KLLA0E04049g       SYADGTFADGDWGVDEIHLDD-VNVTGLSFAVSNYTDSQFGVLGIGLTGSESTYSGQLST
KLTH0G12386g       EYGDSTYALGTWGRDNVTLQD-ITLSGISMAVANESNSTFGVLGIGLAALEVTNVGTLAT
Kwal_56.23902      QYGDLSYALGVWGRDDVTLQD-VKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESP
NDAI0J01030        SYGDSTFASGTWAQDVLNLSD-LNVTGLSFAVANMTNSTVGVLGIGLPALESTYSGASGA
NCAS0B03560        SYGDSTFASGTWAHDVLNLGG-LNITGLSFAVANMSNSTVGVLGIGLPGLETTYSGSTSK
KNAG0I00910        SYGDTSYASGSWGIDTMSINK-LNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTA
TDEL0F04450        SYGDTTFASGTWGTDNFDLGD-LNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSA
KAFR0H02300        TYGDTSFARGTWGQDKLHLDD-LDVSGLSFAVANVTNSTVGVLGIGLPGLEVTYINAPRN
SAKL0H15664g       FYGDSSYAYGTWGQDELYLHD-IDIGGLSFAVANQTNSTVGVLGIGLPGLEVTYSGYASS
Suva_2.305         TYGDLTFASGTWGHDQLNLNN-LNVTGLSFAVANETNSTVGVLGIGLAGLESTYSGATLS
Skud_4.403         TYGDSTFASGTWGHDQLNLNN-LNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLS
Smik_4.388         TYGDSTFASGTWGHDRLSLNN-LNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLS
YDR144C            AYGDTTFASGTWGHDQLSLND-LNITGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLS
TBLA0H01290        RYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQS
KNAG0G02410        TYGDTTFASGVWGQDHLHLQD-VNVTGVSFAVANRTNSTVGVMGIGLPGLETTNSGSRP-
KAFR0B05710        SYGDSSVAEGVWGQDVLSISD-VDVSGVSFAVANYTNSTVGVLGIGLSGLETTYSGTSSS
CAGL0M04191g       QYGDSTFASGTWGMDNLHLSD-LNVTGLSFAVANRTNSTVGVLGIGLPALEVTYSGRTAV
Suva_10.211        SYGDGTFAAGTFGTDVLNLSD-LNVTGLSFAVANETNSTMGVLGIGLPSLEVTYSGSSAS
YLR120C            SYGDGTFASGTFGTDVLDLSD-LNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTAS
Skud_12.192        SYGDGTFASGTFGTDILDLSD-LNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTAS
Smik_12.186        SYGDGTFASGTFGTDVLDLSD-LNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTAS
Kpol_543.61        SYADSSYASGTWGQDTLKLQD-LDVTGLSFAVANYTNSTVGVLGIGLPSLEVTYSGSNNV
TPHA0A01580        TYGDGSYALGNWGQDVLSLQD-IDVTGLSFAVANYTNSTVGVLGIGLPSLEATYSGSLAG
NDAI0G02620        SYGDGSFAEGTWGTDVIKLDDSLSLNDVSVAVASSTNSSMGVLGIGLRPLETTYSSTKSV
NCAS0C03300        HYGDGSFALGTWGTDTVSIDD-ITLDALSLAVANSSNSSMGVIGLGLAGLETTYSSSHAV
                    * . . . * :. * . :        : ..*   : *  .::*:**   :         

CAGL0E01419g       FNVSD--------YLPVNASDADIDNISKPTYANFPQILKQKNVIEKVAYSLFLNDTNAT
TPHA0C00840        -------------Y----------------KYDNFPMVLKNKGIISHQGYSIYLDSSSST
TBLA0A03910        VNESS--------Y----------------IYNNFPQVLKNSGIINKTAYSLFLNKSDST
ZYRO0F10230g       VSGDR--------H----------------MYSNFPMVLKERGITKKNVYSLYLNSPDAH
AGL192W            -------------Y----------------QYDNLPMVLKRNNVIKKTVYSMFINELNAK
Ecym_4251          -------------Y----------------EYDNLPIVLKRNGVIDKTAYSLYLNDLDAT
KLLA0E04049g       YNR----------Y----------------QYDNFPIVLQRNGVIEKNAYSVFLNDLDAD
KLTH0G12386g       RGNS---------Y----------------TYENLPAKMVSEGIIHKNAYSLFLDSLDAK
Kwal_56.23902      SDA----------Y----------------TYKNFPAMLVDQGKIRKSAYSLFVNDLNAT
NDAI0J01030        TQRQM--------Y----------------QYMNFPMVLKQSGAIHTTTYSLFLDDLDES
NCAS0B03560        L------------Y----------------QYNNFPMLLKQSGAIDSTSYSLFLDDLDAK
KNAG0I00910        SGKKDIAAASSSLY----------------QYANFPMVLKNDGIIHKVAYSLFLNDPQEQ
TDEL0F04450        SSGA---------Y----------------QYENFPMALKSQGIIDRNAYSLFLNEPDAD
KAFR0H02300        R------------Y----------------QYDNFPMILKNSGATHSNLYSLHLDHPEAE
SAKL0H15664g       ARNR---------Y----------------QYDNFPLILKRNNVIKANAYSLFLNSTNSS
Suva_2.305         SAQES--------Y----------------TYNNFPMVLKNSGAIKSAAYSLFLNETNAK
Skud_4.403         SVQKS--------Y----------------TYNNFPMVLKNSGAIKSSAYSLFSNKSNSE
Smik_4.388         SAQKS--------Y----------------TYNNFPMILKNSGAIKSTAYSLFTNHSDSK
YDR144C            SVQKS--------Y----------------TYNNFPMVLKNSGVIKSTAYSLFANDSDSK
TBLA0H01290        TKP----------Y----------------IYDNFPLVLKNSGAIHKSVYSLYLNKQNAK
KNAG0G02410        -------------Y----------------TYANFPQVLKNSGATQSALYSLYLNDLEEE
KAFR0B05710        ES-----------Y----------------IYENLPMLLKSSGVIDTIAYSLFLNEKSDT
CAGL0M04191g       SGQRP--------Y----------------QYDNFPLVLLRNGAIKSNSYSLFLNNASAE
Suva_10.211        NGGKS--------Y----------------KYDNFPIVLKNSGAIKSNAYSLYLNDSDAK
YLR120C            HSGKA--------Y----------------KYDNFPIVLKNSGAIKSNTYSLYLNDSDAM
Skud_12.192        SSRRP--------Y----------------TYDNFPMVLKNSGAIKTNAYSLYLNDSDAK
Smik_12.186        RGRRP--------F----------------KYDNFPIVLKNSGAIKTNAYSLYLNDSDAE
Kpol_543.61        AGTR---------Y----------------QYENFPLLLKNSGATKANAYSLYLNDLDSR
TPHA0A01580        SNP----------Y----------------QYDNLPLVLRNSGAVKSYAYSLFLNDEDSS
NDAI0G02620        NEKTS--------Y----------------MYDNFPISLKKSGLIESTAYSLYLNDPSSK
NCAS0C03300        KSGQT--------Y----------------QYANFPLALKNAGIVAANAYSLYLNDPEET
                                .                 * *:*  :   .      **:. :  .  

CAGL0E01419g       NGQILFGAVDHSKYTG-SLSTLPLVNSLYVEGINDTTQLEITLDGMGL---KNSQGQFTI
TPHA0C00840        YGEFLLGGVDTSKYTG-TLYKLPLVNWYNTY-FSSPGDFHVTLQGLGL--ITNSGSAVTL
TBLA0A03910        QGSLLLGAVDTSKFAD-KLYTVPMLNINPSKGYTDPSAFLVLMQKMTR---YKYGQGHLV
ZYRO0F10230g       NGSILFGAVDKSKFDG-SLYTIPILNVYKSRGVSQPIQFDVTLQGLGL---SNQTSTTTL
AGL192W            TGSVLFGAVDHSKYKG-TLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTL
Ecym_4251          SGSVLFGAVDHSKYTG-TLATVPLVNVNARYGFPKPIELHITLNGLGF---SSGKKRGTI
KLLA0E04049g       SGSILFGAVDHSKYTG-TLYTVPMVNALRSIGYTEQIRLSITLQGIGV---TSSYGNETV
KLTH0G12386g       EGSVLFGAVDHSKYTG-SLYTLPLSNSYKSMGYSDPIQLEVTLQGFGM---TANNTNSTF
Kwal_56.23902      HGSVLFGAVDHSKYTG-TLQTIPLVNSIKSAQVPKPIQFDVTLHGLGI---TLNDTNTTI
NDAI0J01030        HGSVLFGAIDHSKYTG-QLYTVPMINIMRNSGYSNPIQFDVTLFGIGL---QNGERNLTL
NCAS0B03560        QGSVLFGAVDHTKYVG-NLYTVPMVNILASKGYPNPIQFDVTLAGIGI---QNDSKNYTV
KNAG0I00910        EGSVLFGAVDHSKYTG-TLYTVPLVDIYHDSASSKPVEFDITLYGLGV---DKDGSQSTI
TDEL0F04450        KGSVLFGAVDHSKYSG-QLYTVPMLNMYRNRGIQNPIEFDVTVQGVSV---TSGSTIRNL
KAFR0H02300        HGTVLFGAVDHSKYTG-SLYTIPLVNTLKTHGFSDPAKFEVTLQGVGI---VANNTQTTL
SAKL0H15664g       SGSLLFGAVDHSKYSG-QLYTVPLLNTLESSGYTDPIQFEVAVQGIGV---RTSGSNTTL
Suva_2.305         HGSILFGAVDHGKYSG-DLYTIPIINTLQDHGYKDPIQFQVTLQGLGL--AKGDSESTTI
Skud_4.403         HGTILFGAVDHGKYTG-DLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTL
Smik_4.388         HGTILFGAVDHGKYAG-DLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTL
YDR144C            HGTILFGAVDHGKYAG-DLYTIPIINTLQHRGYKDPIQFQVTLQGLGTSKGDKEDNLTTL
TBLA0H01290        NGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGV---TDNTNNYTV
KNAG0G02410        RGSILFGAVDHSKYTG-SMYTLPIINRLQSYGYTTPIQFDITLQGIGLSSSESNGDEVTI
KAFR0B05710        TGNLLFGAVDHSKYSG-SLYTLPIVNVYASEGYKNPLEFDVTMYGLGI---STSDSNTTI
CAGL0M04191g       TGSVLFGAVDHSKYLG-DLYTIPMVNTYASQGYKNPIQFEVTLNGLGI---SSSSDNTTI
Suva_10.211        HGTILFGGVDHNKYSG-TLYTVALVNTL--SGFTSPIQFDITLNGLGI--IDDNGDEKTL
YLR120C            HGTILFGAVDHSKYTG-TLYTIPIVNTLSASGFSSPIQFDVTINGIGI--SDSGSSNKTL
Skud_12.192        HGTILFGAVDHSKYAG-TLYTVPIVNTLSASGFSSPIQFDVTINGIGI--SYPDNSQKTL
Smik_12.186        HGTILFGAVDHSKYTG-TLYTIPIVNTLSASGFSSPIQFDVTINGIGV--SDSKNGEKTL
Kpol_543.61        TGSVLFGGVDHNKYSG-TLYTIPLVNTLRAAGFSQPVEFDVTLQGMGI--SDDEHGNVTL
TPHA0A01580        EGSILFGGVDHSKYEG-TLNTLPLVNYQKSSGFQSPYEFDITLQGLGI---STSSKNTTV
NDAI0G02620        SGNILFGGVDHSKYTG-QLYTVPMLS--STTSYKTPVEFDVTLNGIGI--IDSSGNKKTL
NCAS0C03300        TGNILFGAVDHSLYSG-QLYTIPLVNIYSGSGFKNAVEFDVTLNGIGI--VDSSGSATTV
                    * .*:*.:*   : .  : .:.: .            : : :  .             .

CAGL0E01419g       YNQKMPALLDSGTTVSYLPIDLHSLVAKQLKGIVDPQTGFIELKNCPA--KNDNTQLVFN
TPHA0C00840        TETKMAVILDTGSTVTGIPATLYNALLSSLGGYYSSTHGAYVF-TCPT----ETSKLVFN
TBLA0A03910        PSSRIPVLLDSGTTMVYLPRSIVEQIMRHEEAQYVEELDLYQI-KCPSPNKKNQTSFSFD
ZYRO0F10230g       STTKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLM-DCPS--KHDETKIVFN
AGL192W            LGSKVPALLDSGTTLTYFPMQLADRLARAAGARWHSEEVGYIV-DCNS-RRLHQTAYIYD
Ecym_4251          SATKVPALLDSGTTLSYFPTELAAAIASNVGAVWNARLRKFLI-PCSQ-AKRNNIDLIYN
KLLA0E04049g       TQTKYPALLDTGATFCYFPSSLAAAIASSVSATYSSSSGYYFV-DCDS---GSDYDLVFD
KLTH0G12386g       TTTPLTALLDSGTTLTYLPTTLVRQVAAKYGARYDSSYGYYLL-SCSD--VKDTDELVFD
Kwal_56.23902      TTTPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRY-QCDE--ISDSDELVFD
NDAI0J01030        TTTKLAALLDSGTTISYFPTSVVELVARQINAQYSARLGFYTV-PCRS--VSSNTNLVFD
NCAS0B03560        TTNKFPALLDSGTTISYFPQEVVQTIARQLGARYSSALGFYAM-SCNG--VSSSTNFVFD
KNAG0I00910        ATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTM-SCSY--DTSNTNLVFD
TDEL0F04450        TNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSM-RCPS--ENNDTRLNFD
KAFR0H02300        TNTKIAALLDSGTTLTYLPQALVQVIADSIGARWSSRYGYYIV-SCRA-VENSDTTLVFD
SAKL0H15664g       TTTVIPALLDSGATLSYFPVQVAEMIADALDATYSSSYGYYIV-DCPS--SDDDTEIIYD
Suva_2.305         TTTKIPALLDSGTTISYMPVELMEMLADKLGASYSSKVGYYLM-DCIT-DTDDDINVVFD
Skud_4.403         TTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVM-NCIH-EVKKDITVVFD
Smik_4.388         TTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIM-DCIN-EMEEESSLIFD
YDR144C            TTTKIPVLLDSGTTISYMPTELVKMLADQVGATYSSAYGYYIM-DCIK-EMEEESSIIFD
TBLA0H01290        TTTQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVM-NCPD--SDDNTQIVFD
KNAG0G02410        TSTKMPALLDSGTTMTYLPSNIVSQIAQQLGASMSARFGQYVL-PCSN--VPENMHLVYD
KAFR0B05710        ATMKIPALLDSGTTIVYFPETLLELVADQLGASYSDELGFYAM-SCVS--SSDDTEFVFD
CAGL0M04191g       TTTKIPALLDSGTTLTYLPQALVTRIVQKLQATYSNRAGYYVF-SCPS--QSDDTEVVFD
Suva_10.211        TTTKIPVLLDSGTTLTYLPVEMVELIAENVGAQYSSRIGYYVM-ECPS--SDNSTEIVFD
YLR120C            TTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVL-DCPS---DDSMEIVFD
Skud_12.192        TTTQIPALLDSGTTLTYLPQAVVAMIADELDAQYSSRLGYYVL-DCPS--NSNSTQIVFD
Smik_12.186        TTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVL-DCPS---DDSTQIVFD
Kpol_543.61        TTTKIPALLDSGTTLVYLPSALVSLIADEYDAVYNSRTGYYVM-NCPD--SDEDSQIVFD
TPHA0A01580        SDTQIVALLDSGTTLTYLPVTLTSLLAAELNASYSARLGYYTM-SCPS--SSDSTEIVFD
NDAI0G02620        TATQFYGLLDSGTTFSYLPSALVAMIGEELGASYDSNIGYYTI-DCSA-EDSDDTKIVFD
NCAS0C03300        STTPIIALLDSGTTLTYFPTQYVSLLAAQLGAQYSSSNGYYTI-SCDA-MQDTTTKLVFD
                          :**:*:*.  :*      :     .             *            ::

CAGL0E01419g       FGGAFISIKYTEFIEKS------DDDNCYVTFMPQGEPG-ILLGDNFLRNAYIVYDLEDM
TPHA0C00840        FGGINYKLPMSSFINTL------GDNVCSLKVSSRSDSN-FILGDDFLRNVYAAFDLENK
TBLA0A03910        FGGFQIKASLSDFIVPT------DNGQCIFGMIPQDMNV-GILGDSFLTHAYVVYDLEDY
ZYRO0F10230g       FGGFNIETNLTTYTTPI------SSDTCVLRILPSGDSS-AILGDAFLVHAYVVYDLEDF
AGL192W            FGGFQIRSPLSDYSMMT-----NVRGTCRFGIMPHSSDY-VILGDVFLTRAYVVFDLEAL
Ecym_4251          FGGVEITSPLVNYLSET-----NVEDVCLLGIVPTSSND-IILGDVFLTSVYTVYDLEAL
KLLA0E04049g       FGGFHIISPLSDYIVTT-----SSSSQCVLGILPQSDNE-ITLGDAFLTSAYVVYDLEEL
KLTH0G12386g       FGGFHINSKVENFLIRA------TSNICALGLIPQSSSS-LILGDNFLTAAYVVYDLDNL
Kwal_56.23902      FGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE-IILGDNFLTAAYVVYDLENL
NDAI0J01030        FGGFHISGPLQDFLIQT------SQQTCILAMAPQESQH-VILGDIFLTHAYVVYDLDNY
NCAS0B03560        FGGFHITGPVSDFLLPT------SGNTCVLAMAPQESQH-ILLGDIFLTHAYVVYDLDNY
KNAG0I00910        FGGFHITAPLDDFVVQQ------SSQTCVLAIGPQQENW-VVLGDVFLSNAYVVYDLENL
TDEL0F04450        FGGFQISANLSSYLLSS----RSSSSTCYLGMIPLTSNA-AIFGDNFLVHAYVVYDLENY
KAFR0H02300        FGGFHINGKLTDFIVET------FGNVCLLTIIEETGSNSAILGDNFLINAYVVFDLENN
SAKL0H15664g       FGGFHIASKLTDYILTT-----NRPSICVLGIVPQNSNR-FILGDVFLTSAYVVYDLDNF
Suva_2.305         FGGFYISGNLSSYQLSA----DSSSDVCILGFAPQSDST-VILGDNFLSNAYVVYDLDNM
Skud_4.403         FGGFHISSWLSNFQLFT----DSSSDVCILGFAPQSDPT-VILGDNFLVSTYIVYDLDNM
Smik_4.388         FGGFYIANWLSNFQLLT----DSRSNVCILGIAPQSDPA-IILGDNFLVSTYVVYDLDNM
YDR144C            FGGFYLSNWLSDFQLVT----DSRSNICILGIAPQSDPT-IILGDNFLANTYVVYDLDNM
TBLA0H01290        FGGFHINANLTNFVLSS------ASGKCVLGLLPYNGNS-AILGDMFLTHAYVVYNLDDL
KNAG0G02410        FGGFHINSNLTNYIVQA------SQTLCILGLFPRDSNT-AILGDTFLTDAYVVYDLENL
KAFR0B05710        FGGFHITVPLSDFLIRV------SGSECILAMAAQDDES-IILGDYFLTNAYVVYDLENY
CAGL0M04191g       FGGFHINAPITNFIIGS------SGDSCILGIMPQSGGG-IILGDSFLNSAYVVYDLENY
Suva_10.211        FGGFHINASLSSFILST------SGNTCLLGIIPTSDSTGSILGDSFLTNAYVVYDLENL
YLR120C            FGGFHINAPLSSFILST-------GTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENL
Skud_12.192        FGGFHINASLSSFILNA-------GNICLLGIIATDDTT--ILGDSFLTNAYVVYDLDNL
Smik_12.186        FGGFHINASLSSFILST-------GSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNL
Kpol_543.61        FGGFHISTNLTTYIIQA------VGGICVLGILPQSSGT-AILGDSFLQHAYVVYDLDNL
TPHA0A01580        FGGFHINVPLTSFIVTS------SMNVCILGIIPRSGDQ-AILGDSFLQHAYVVYDLENL
NDAI0G02620        MGGFHINTTLSDFVIQI------STSTCILSIVPQDGK--VVLGDSFLNNAYIVYDLDNY
NCAS0C03300        FGGFHINATLADFVVQS------GTSTCFLSIIPQNSSS-AILGDTFLNNAYVVYDLDNL
                   :**         :              * . .          :** **  .* .::*:  

CAGL0E01419g       EISIAQANFNGGAE----NIEAIVKN--VPSAVKAPGYSASFTEFPSSYAT-TGNIF---
TPHA0C00840        EIGLAMADFD-SSSNNKREDTVIAMESGIPDAVQAPEYSATWVT-YEAVVT-GGSMFETL
TBLA0A03910        EISMAQAVYD-GGE--PNYIPIVST---VPSAVRAKYYS------ATDLPS-G---FA--
ZYRO0F10230g       EISMAQANFDVNHE----DIEVVSSS--IPQATAAAGYSSTYSS-SKSITS-GGNIFS--
AGL192W            EVSMAQANYEGGKE----QIEVIAGA--VPRAVRAPGYNDPWKA-YTPLVF-NGELGN--
Ecym_4251          EVSIAQAAYGASAE--KENIEVIKST--VPGATKAPGYSNTWST-YAPIST-GGNMFN--
KLLA0E04049g       EISLAQASYT-SGD--E-KIEVIRDS--VPSAVAAPGYSSTWST-AASLST-GGNIFT--
KLTH0G12386g       EISLAQANYD-GGS--S-NIEVISSS--VPSAVKGPSYSSTWST-SVPIST-GGNIFT--
Kwal_56.23902      EISMAQANLD-GGS--E-DIEEIVST--VPSAVKAPGYSSTWTS-AIPIST-GGNIFT--
NDAI0J01030        VIALAQADTSTSNQSSSSDIELITNST-IPRAIRAPLYSETWTA-NRPVQS-GGNIFA--
NCAS0B03560        EISLAQANTGTQNL--DSNIQIISDS--VPSAIKAPLYSETWSK-AMPIST-GGNIFT--
KNAG0I00910        EVSMAQANFD-SSL--PESVEVISST--VPSAVKAASYSNPWSS-AVMMST-GGNIFT--
TDEL0F04450        EISMAQAAFN-NSD--S-QIEVISDS--IPSAVRAQGYSSTWST-NQAIST-SGS-----
KAFR0H02300        EISMAQALHNVDDD--Q-DIEIVTSNAGVASAVTALGYSSTWTAEPSTIETFAGDIFT--
SAKL0H15664g       EISLAQANYE-GGD--E-QIEVISES--VPSAIKAPSYSSTRFS-SASAST-GGDIFT--
Suva_2.305         EISMAQVDLS-GRS--E-DIDVIEDS--VPSAVKAPSYSSTWST-DGSIVS-GGDIFT--
Skud_4.403         EISMANADFS-DND--E-YIDVIESA--VPSALKAPNYSNTWST-YESIVP-GGNIFS--
Smik_4.388         EISMAHADFS-DGG--E-YIDTIKDS--VPSALKAPGYSSTWST-YESIVP-GGNMFP--
YDR144C            EISMAQANFS-DDG--E-YIEIIESA--VPSALKAPGYSSTWST-YESIVS-GGNMFS--
TBLA0H01290        EISMAQANYD-NSN--E-DIEVITST--VPNAVKAPGYSYTYST-SKSIVS-GGNIFG--
KNAG0G02410        QIGLAQAKFGVSDS--DAKIDIVTGSAGIPSAQRAPDYSSTWSTSVGTVTT-GGNIFT--
KAFR0B05710        EISMAQANYD-SED--E-DIEVISST--VPSAVKAASYSNSWSS-TGSITS-GGDIFT--
CAGL0M04191g       EISMAQANYA-GGQ--E-DIEVISSS--VPGAVRAPGFSSTWSTLATSFNT-QGDIFT--
Suva_10.211        EISMAQAKYN-VTS--E-DIEVISTS--VPNAVKAPGYTNTWST-TASIAT-GGNIFT--
YLR120C            EISMAQARYN-TTS--E-NIEIITSS--VPSAVKAPGYTNTWST-SASIVT-GGNIFT--
Skud_12.192        EISMAQAQYN-ITN--E-NIEVITSS--IPSAIKAPGYTSTWST-SASIVT-GGNIFT--
Smik_12.186        EISMAQAQYN-TTT--E-NIEVISSS--IPSAVKAPGYTNTWST-SATIVT-GGNIFT--
Kpol_543.61        EISMAQASFE-TDD--E-NVEVISSS--IPSAVKAPGYSSTWST-FSSISS-GGNIFTVD
TPHA0A01580        EISLAQAKYG-SSS--E-DIEAIVSS--VPSAVRAASYSNTWST-AATINS-GGDIFT--
NDAI0G02620        EIAMAQAAWD-STR--EANIDVISTT--IPSAIRAPGYSSTWST-SRSISS-GGDIFTTT
NCAS0C03300        EISMAQAKWDQSSD--E-DIEVISSS--VPSAVKAPGYSNTWST-TMSITS-GGNIFT--
                    :.:* .               :     :. *  .  :.                     

CAGL0E01419g       -------SGYNSTNSTGSAGSKTTMTSSRTSRNTNTA-----------------------
TPHA0C00840        AENASSSEATSSSTSSEATSSSTSTEATSTSTSTEATSSSTSTSTEATSTSTEATSSSTS
TBLA0A03910        -------IDSYNNTSKRPKDKTTFSVQADLRNTISGDITT--------------------
ZYRO0F10230g       --------------SGTLSGSA--------------------------------------
AGL192W            -------LTA--------------------------------------------------
Ecym_4251          -------AAANHS-----------------------------------------------
KLLA0E04049g       -------VTNNANGTVSTGTGSSGSGSSTSG-----------------------------
KLTH0G12386g       -------VSGSNSTTTAGNSASGTT-----------------------------------
Kwal_56.23902      -------ISGSNSSSSKTASGSKSSSASKSSSASNSSSAAASTSGSG-------------
NDAI0J01030        --------GNGTVIYNQGSGSMTTLSGTAGAQQFTS------------------------
NCAS0B03560        -------VPANGSATSTHSGSRVTS-----------------------------------
KNAG0I00910        -------VEGASNTTGSSSTRSGSRITSRVGSSSSTR-----------------------
TDEL0F04450        ---------------GSGSGTAR-------------------------------------
KAFR0H02300        -------VSAGATANYTTAKTRQSSS----------------------------------
SAKL0H15664g       ------------------------------------------------------------
Suva_2.305         -------VSSGSSNQRSGSGSYSTTSTSSSKGQKDQGSTTYAKSGAG-------------
Skud_4.403         -------TSSNVSMSGSGSRSHSATSSSSLKGQKLQTSTT--------------------
Smik_4.388         -------TSYNFSSSNSVSLSHSATGTSSNKGQKSQTSTTAFSNSRS-------------
YDR144C            -------TAANSSISYFASTSHSATSSSSSKGQKTQTSTTALSISKS-------------
TBLA0H01290        -------STTYSINPSSSNSGDSHDSTSTVQGTGSTSS----------------------
KNAG0G02410        -------LNPHETAVLISSVSGSGVVTQTVTRRTSTATSTS-------------------
KAFR0B05710        -------VASNSTATNSVTTTKSSSSKT--------------------------------
CAGL0M04191g       -------VQAAATVSGSATNTGTGRATATGNSNSTRSTTSRS------------------
Suva_10.211        -------VDSSST--ASYSGNVT-------------------------------------
YLR120C            -------VNSSQTASFSGNL----------------------------------------
Skud_12.192        -------VDSSQT--ASFSGNVT-------------------------------------
Smik_12.186        -------VDSSQTASFSGNV----------------------------------------
Kpol_543.61        VNTASASSSGSSATSSASSGSGAASGSTSSGTARSSSSANSGQTTSR-------------
TPHA0A01580        -------VSTTASNGTTSSGSSTRSSTSSRRTGTATSSSTGSAKDSSASSLRPSSSTIDS
NDAI0G02620        EVTLSTSATSSPESSASSVTSASTLSSDSSAASSYSRSTSTLRSSSRSSSFVSSNNRATA
NCAS0C03300        -------VNADASATVSNSGSSASASSSSASSGSNSRTTSTLSTSSRKST----------
                                                                               

CAGL0E01419g       --------------------------------------SAAGNSSSSTRAKKNAGFA---
TPHA0C00840        TSTEATSSSTSSEATSTSTSTEATSSSTSTSTEATSTSTSTEATSSSTSTSSEATSSSTS
TBLA0A03910        --------------------------------------TIEEDSAKTETKHSNAGVA---
ZYRO0F10230g       --------------------------------------SNTASGNNKSKNMAAAPVQ---
AGL192W            --------------------------------------TASDSSSGSVGSRSNSALT---
Ecym_4251          --------------------------------------EESQGQSLENRSTQNAAVG---
KLLA0E04049g       --------------------------------------NSGSTSTGSSSKKEGAASS---
KLTH0G12386g       --------------------------------------SSSRSSSTSSAGKKNAAVG---
Kwal_56.23902      ------------------------STASSSSSSSSGSSSSSGSSSTSTGSKSSAVAG---
NDAI0J01030        --------------------------------------SSTGSASSGTRRENEANAK---
NCAS0B03560        --------------------------------------GSSTSATGSQKKNGAPALM---
KNAG0I00910        --------------------------------------RSEASSSMGTNQRKNAGAI---
TDEL0F04450        --------------------------------------TTTTSSNGASGARNAVGDT---
KAFR0H02300        --------------------------------------DTESNTASTSMNRKNLANM---
SAKL0H15664g       --------------------------------------VTGSNTTSSSAPRTSIGSQ---
Suva_2.305         --------------------------------STASSTMASSSTSASSTKKENVGHT---
Skud_4.403         ------------------------------NSRSSAATSVSSPTLSSSTRKENGGDN---
Smik_4.388         -------------------------------SSTISSTAMSSSTSSSSTRKENGGHN---
YDR144C            -------------------------------TSSTSSTGMLSPTSSSSTRKENGGHN---
TBLA0H01290        --------------------------------------RISTRTTSKTKQANDASNL---
KNAG0G02410        --------------------------------------TQTTGTTGTTTVRRNDAIA---
KAFR0B05710        --------------------------------------SSGHSTTDSSSRKSNAGSG---
CAGL0M04191g       --------------------------------------RTSATSTRSDSQKKNDASR---
Suva_10.211        --------------------------------------SSTASATSTTSSKKNGGDR---
YLR120C            --------------------------------------TTSTASATSTSSKRNVGDH---
Skud_12.192        --------------------------------------SATASATSTTSKSRNVGDR---
Smik_12.186        --------------------------------------TSSTASATSTSSKRNAADC---
Kpol_543.61        ------------------------AASTTTRSSSSSRSSSSTSRSGSGTSNDAMHIA---
TPHA0A01580        VSGSSGSSSSTSSTSISNSATTLASTTRSSSTSSSLSTSTSSSRTSSSNSNSNGSNI---
NDAI0G02620        STSSSIRS----------------SSSSSSSSSSSSSSSSSSTGITSSTNRTNSGIQ---
NCAS0C03300        ------------------------QTSTRTSSGTSSRRSSTSTSTSSSNNKEENGSTTV-
                                                                               

CAGL0E01419g       ------------------------------------------------------------
TPHA0C00840        TEATSSSTSTSSSTSTSTSTEATSTSTEATSSSTSTSTEATSSSTSSEATSTSTSTEATS
TBLA0A03910        ------------------------------------------------------------
ZYRO0F10230g       ------------------------------------------------------------
AGL192W            ------------------------------------------------------------
Ecym_4251          ------------------------------------------------------------
KLLA0E04049g       ------------------------------------------------------------
KLTH0G12386g       ------------------------------------------------------------
Kwal_56.23902      ------------------------------------------------------------
NDAI0J01030        ------------------------------------------------------------
NCAS0B03560        ------------------------------------------------------------
KNAG0I00910        ------------------------------------------------------------
TDEL0F04450        ------------------------------------------------------------
KAFR0H02300        ------------------------------------------------------------
SAKL0H15664g       ------------------------------------------------------------
Suva_2.305         ------------------------------------------------------------
Skud_4.403         ------------------------------------------------------------
Smik_4.388         ------------------------------------------------------------
YDR144C            ------------------------------------------------------------
TBLA0H01290        ------------------------------------------------------------
KNAG0G02410        ------------------------------------------------------------
KAFR0B05710        ------------------------------------------------------------
CAGL0M04191g       ------------------------------------------------------------
Suva_10.211        ------------------------------------------------------------
YLR120C            ------------------------------------------------------------
Skud_12.192        ------------------------------------------------------------
Smik_12.186        ------------------------------------------------------------
Kpol_543.61        ------------------------------------------------------------
TPHA0A01580        ------------------------------------------------------------
NDAI0G02620        ------------------------------------------------------------
NCAS0C03300        ------------------------------------------------------------
                                                                               

CAGL0E01419g       ------------------------------------------------------------
TPHA0C00840        SSTSTSTEATSSSTSTEATSSSTSTSTEATSSSTSSEATSTSTSTEATSSSTSTEATSSS
TBLA0A03910        ------------------------------------------------------------
ZYRO0F10230g       ------------------------------------------------------------
AGL192W            ------------------------------------------------------------
Ecym_4251          ------------------------------------------------------------
KLLA0E04049g       ------------------------------------------------------------
KLTH0G12386g       ------------------------------------------------------------
Kwal_56.23902      ------------------------------------------------------------
NDAI0J01030        ------------------------------------------------------------
NCAS0B03560        ------------------------------------------------------------
KNAG0I00910        ------------------------------------------------------------
TDEL0F04450        ------------------------------------------------------------
KAFR0H02300        ------------------------------------------------------------
SAKL0H15664g       ------------------------------------------------------------
Suva_2.305         ------------------------------------------------------------
Skud_4.403         ------------------------------------------------------------
Smik_4.388         ------------------------------------------------------------
YDR144C            ------------------------------------------------------------
TBLA0H01290        ------------------------------------------------------------
KNAG0G02410        ------------------------------------------------------------
KAFR0B05710        ------------------------------------------------------------
CAGL0M04191g       ------------------------------------------------------------
Suva_10.211        ------------------------------------------------------------
YLR120C            ------------------------------------------------------------
Skud_12.192        ------------------------------------------------------------
Smik_12.186        ------------------------------------------------------------
Kpol_543.61        ------------------------------------------------------------
TPHA0A01580        ------------------------------------------------------------
NDAI0G02620        ------------------------------------------------------------
NCAS0C03300        ------------------------------------------------------------
                                                                               

CAGL0E01419g       ------------------------------------------------------------
TPHA0C00840        TSTSTEATSTSTEATSTSTEATSSSTSTSSEATSSSTSTEATSSSTSTSTSTEATSTSTE
TBLA0A03910        ------------------------------------------------------------
ZYRO0F10230g       ------------------------------------------------------------
AGL192W            ------------------------------------------------------------
Ecym_4251          ------------------------------------------------------------
KLLA0E04049g       ------------------------------------------------------------
KLTH0G12386g       ------------------------------------------------------------
Kwal_56.23902      ------------------------------------------------------------
NDAI0J01030        ------------------------------------------------------------
NCAS0B03560        ------------------------------------------------------------
KNAG0I00910        ------------------------------------------------------------
TDEL0F04450        ------------------------------------------------------------
KAFR0H02300        ------------------------------------------------------------
SAKL0H15664g       ------------------------------------------------------------
Suva_2.305         ------------------------------------------------------------
Skud_4.403         ------------------------------------------------------------
Smik_4.388         ------------------------------------------------------------
YDR144C            ------------------------------------------------------------
TBLA0H01290        ------------------------------------------------------------
KNAG0G02410        ------------------------------------------------------------
KAFR0B05710        ------------------------------------------------------------
CAGL0M04191g       ------------------------------------------------------------
Suva_10.211        ------------------------------------------------------------
YLR120C            ------------------------------------------------------------
Skud_12.192        ------------------------------------------------------------
Smik_12.186        ------------------------------------------------------------
Kpol_543.61        ------------------------------------------------------------
TPHA0A01580        ------------------------------------------------------------
NDAI0G02620        ------------------------------------------------------------
NCAS0C03300        ------------------------------------------------------------
                                                                               

CAGL0E01419g       ------------------------------------------------------------
TPHA0C00840        ATSSSTSTSTEATSSSTSSEATSTSTEATSSSTSIEATSSSTSTEATSPSTSIEATSSST
TBLA0A03910        ------------------------------------------------------------
ZYRO0F10230g       ------------------------------------------------------------
AGL192W            ------------------------------------------------------------
Ecym_4251          ------------------------------------------------------------
KLLA0E04049g       ------------------------------------------------------------
KLTH0G12386g       ------------------------------------------------------------
Kwal_56.23902      ------------------------------------------------------------
NDAI0J01030        ------------------------------------------------------------
NCAS0B03560        ------------------------------------------------------------
KNAG0I00910        ------------------------------------------------------------
TDEL0F04450        ------------------------------------------------------------
KAFR0H02300        ------------------------------------------------------------
SAKL0H15664g       ------------------------------------------------------------
Suva_2.305         ------------------------------------------------------------
Skud_4.403         ------------------------------------------------------------
Smik_4.388         ------------------------------------------------------------
YDR144C            ------------------------------------------------------------
TBLA0H01290        ------------------------------------------------------------
KNAG0G02410        ------------------------------------------------------------
KAFR0B05710        ------------------------------------------------------------
CAGL0M04191g       ------------------------------------------------------------
Suva_10.211        ------------------------------------------------------------
YLR120C            ------------------------------------------------------------
Skud_12.192        ------------------------------------------------------------
Smik_12.186        ------------------------------------------------------------
Kpol_543.61        ------------------------------------------------------------
TPHA0A01580        ------------------------------------------------------------
NDAI0G02620        ------------------------------------------------------------
NCAS0C03300        ------------------------------------------------------------
                                                                               

CAGL0E01419g       ------------------------------------------------------------
TPHA0C00840        STSAEASSSSEVNQSASLLPAEEIASISTVSSVSATSTAVISIEASSSEISSSKVTSTST
TBLA0A03910        ------------------------------------------------------------
ZYRO0F10230g       ------------------------------------------------------------
AGL192W            ------------------------------------------------------------
Ecym_4251          ------------------------------------------------------------
KLLA0E04049g       ------------------------------------------------------------
KLTH0G12386g       ------------------------------------------------------------
Kwal_56.23902      ------------------------------------------------------------
NDAI0J01030        ------------------------------------------------------------
NCAS0B03560        ------------------------------------------------------------
KNAG0I00910        ------------------------------------------------------------
TDEL0F04450        ------------------------------------------------------------
KAFR0H02300        ------------------------------------------------------------
SAKL0H15664g       ------------------------------------------------------------
Suva_2.305         ------------------------------------------------------------
Skud_4.403         ------------------------------------------------------------
Smik_4.388         ------------------------------------------------------------
YDR144C            ------------------------------------------------------------
TBLA0H01290        ------------------------------------------------------------
KNAG0G02410        ------------------------------------------------------------
KAFR0B05710        ------------------------------------------------------------
CAGL0M04191g       ------------------------------------------------------------
Suva_10.211        ------------------------------------------------------------
YLR120C            ------------------------------------------------------------
Skud_12.192        ------------------------------------------------------------
Smik_12.186        ------------------------------------------------------------
Kpol_543.61        ------------------------------------------------------------
TPHA0A01580        ------------------------------------------------------------
NDAI0G02620        ------------------------------------------------------------
NCAS0C03300        ------------------------------------------------------------
                                                                               

CAGL0E01419g       -------HEV--PVSA------IS------------------------------------
TPHA0C00840        PASSTTPIASEVALFSNSTSTSTVTESNTLVTLTTTNAAASTDAATTTAAATFVASESYY
TBLA0A03910        -------TVP--TYSS------II------------------------------------
ZYRO0F10230g       -------IAPT-SLLA------TI------------------------------------
AGL192W            -------LTP--PSLSETLFAASL------------------------------------
Ecym_4251          -------LSP--SVIF-AFPSAVL------------------------------------
KLLA0E04049g       -------LPV--PHLA------AL------------------------------------
KLTH0G12386g       -------AAS--PGVS------GL------------------------------------
Kwal_56.23902      -------VML--PESY------SV------------------------------------
NDAI0J01030        -------VAK--SYVG------ST------------------------------------
NCAS0B03560        -------VGSSSSIFG------SL------------------------------------
KNAG0I00910        -------VLP--SFST------AI------------------------------------
TDEL0F04450        -------LAPS-PLFL------LF------------------------------------
KAFR0H02300        -------NVP--FTFL------YS------------------------------------
SAKL0H15664g       -------VSP--STYI------II------------------------------------
Suva_2.305         -------LNP--PFFA------KF------------------------------------
Skud_4.403         -------LSP--PFFA------RL------------------------------------
Smik_4.388         -------LNP--PFFA------TF------------------------------------
YDR144C            -------LNP--PFFA------RF------------------------------------
TBLA0H01290        -------FSPTNSLFT------LL------------------------------------
KNAG0G02410        -------LSGNHGWIM------AA------------------------------------
KAFR0B05710        -------ISYASYLLM------AS------------------------------------
CAGL0M04191g       -------TSFTSTLLF-------V------------------------------------
Suva_10.211        -------IVP--SLPF------TL------------------------------------
YLR120C            -------IVP--SLPL------TL------------------------------------
Skud_12.192        -------MAP--SLPF------TL------------------------------------
Smik_12.186        -------IAP--SLPL------TL------------------------------------
Kpol_543.61        -------AAP--SLFV------FI------------------------------------
TPHA0A01580        -------IVP--SFI-------TI------------------------------------
NDAI0G02620        -------LAIS-PLLL------AA------------------------------------
NCAS0C03300        -------MVPSISFFV--------------------------------------------
                                                                               

CAGL0E01419g       -------------------------------------------------------VIMVF
TPHA0C00840        SEDAANASVASASSASRRHSIDALARTSTSAASGSSSTLSIVEQHNGAMNMKTTSFFTVS
TBLA0A03910        -------------------------------------------------------FTFLL
ZYRO0F10230g       -------------------------------------------------------FFAIS
AGL192W            -------------------------------------------------------LGAAT
Ecym_4251          -------------------------------------------------------IGMLS
KLLA0E04049g       -------------------------------------------------------ICLLL
KLTH0G12386g       -------------------------------------------------------LGALV
Kwal_56.23902      -------------------------------------------------------LSGLF
NDAI0J01030        -------------------------------------------------------FALLV
NCAS0B03560        -------------------------------------------------------LSLIM
KNAG0I00910        -------------------------------------------------------FTFIA
TDEL0F04450        -------------------------------------------------------ATIIS
KAFR0H02300        -------------------------------------------------------FPLLG
SAKL0H15664g       -------------------------------------------------------AGFLL
Suva_2.305         -------------------------------------------------------ITIVL
Skud_4.403         -------------------------------------------------------ITTIL
Smik_4.388         -------------------------------------------------------VMAIL
YDR144C            -------------------------------------------------------ITAIF
TBLA0H01290        -------------------------------------------------------FTFIC
KNAG0G02410        -------------------------------------------------------AAFCC
KAFR0B05710        -------------------------------------------------------ITFVL
CAGL0M04191g       -------------------------------------------------------AGLLV
Suva_10.211        -------------------------------------------------------ISLLF
YLR120C            -------------------------------------------------------ISLLF
Skud_12.192        -------------------------------------------------------ITLLF
Smik_12.186        -------------------------------------------------------FSLLF
Kpol_543.61        -------------------------------------------------------ASLLT
TPHA0A01580        -------------------------------------------------------LASLF
NDAI0G02620        -------------------------------------------------------VSMLS
NCAS0C03300        -------------------------------------------------------LAFLS
                                                                               

CAGL0E01419g       NILLSMLL-
TPHA0C00840        FFFVAQLLF
TBLA0A03910        SILI-----
ZYRO0F10230g       MFF------
AGL192W            RII------
Ecym_4251          LFF------
KLLA0E04049g       SAVSIPSLF
KLTH0G12386g       LFIAAGLA-
Kwal_56.23902      FLVAAILT-
NDAI0J01030        TIFMVSLV-
NCAS0B03560        AYLL-----
KNAG0I00910        SFLL-----
TDEL0F04450        FFI------
KAFR0H02300        SIIACIL--
SAKL0H15664g       ASLSAFLL-
Suva_2.305         SYI------
Skud_4.403         YYI------
Smik_4.388         YHIR-----
YDR144C            HHI------
TBLA0H01290        TLLV-----
KNAG0G02410        SFLY-----
KAFR0B05710        SYLL-----
CAGL0M04191g       SFI------
Suva_10.211        AFI------
YLR120C            AFI------
Skud_12.192        AFI------
Smik_12.186        AFI------
Kpol_543.61        MVF------
TPHA0A01580        YFI------
NDAI0G02620        IFLFV----
NCAS0C03300        IFVAF----
                     .      

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0E01419g
------------------MKLKNVALVAGCVNAVAAE-----------------------
---------------KYLKLDFEKHRADID-EE---------------------LPLTHS
AARQLRKRA-----SDDSVAFPLVAQENYYSINLEVGTPPQNVSLLLDTGSSDMWVIGSN
NGYCKN--------SDNKSRNLDAL-----------------------------------
---------------------------------------GSNRFAKRASSVASASPSSAT
DSDGGDDGDDSGDAEQFYPTAASEIPA-AAKTLDCQSLSLFDLEKSSSFKSNSTP--FFT
SYGDNSYASGLWGTDDVRLGN-LSIADVFFAVANFSNSSTGVLGVGLPALESYNPALSDN
FNVSD--------YLPVNASDADIDNISKPTYANFPQILKQKNVIEKVAYSLFLNDTNAT
NGQILFGAVDHSKYTG-SLSTLPLVNSLYVEGINDTTQLEITLDGMGL---KNSQGQFTI
YNQKMPALLDSGTTVSYLPIDLHSLVAKQLKGIVDPQTGFIELKNCPA--KNDNTQLVFN
FGGAFISIKYTEFIEKS------DDDNCYVTFMPQGEPG-ILLGDNFLRNAYIVYDLEDM
EISIAQANFNGGAE----NIEAIVKN--VPSAVKAPGYSASFTEFPSSYAT-TGNIF---
-------SGYNSTNSTGSAGSKTTMTSSRTSRNTNTA-----------------------
--------------------------------------SAAGNSSSSTRAKKNAGFA---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------HEV--PVSA------IS------------------------------------
-------------------------------------------------------VIMVF
NILLSMLL-
>TPHA0C00840
--------------------MVAPILFALLFTQLTNVSAELIQ----------------F
YDK------------KAAVIPFRKYYADSLEEL---------------------DYNTST
SETKLVKRD--------GEDIVLTNRNTFYSAEIEVGTPAQTMNVIVDTGSSDLWVIGHD
NLTCPL--------A---------------------------------------------
------------------------------------------------------------
----------------------------SDGSFNCERFGSFSISKSSTFTKNSTE--FAI
TYVSGNNCIGVWGQDNLIIGG-VNATGLSFGVVHTTTSSAGILGIGLPDTETTAVGQYGH
-------------Y----------------KYDNFPMVLKNKGIISHQGYSIYLDSSSST
YGEFLLGGVDTSKYTG-TLYKLPLVNWYNTY-FSSPGDFHVTLQGLGL--ITNSGSAVTL
TETKMAVILDTGSTVTGIPATLYNALLSSLGGYYSSTHGAYVF-TCPT----ETSKLVFN
FGGINYKLPMSSFINTL------GDNVCSLKVSSRSDSN-FILGDDFLRNVYAAFDLENK
EIGLAMADFD-SSSNNKREDTVIAMESGIPDAVQAPEYSATWVT-YEAVVT-GGSMFETL
AENASSSEATSSSTSSEATSSSTSTEATSTSTSTEATSSSTSTSTEATSTSTEATSSSTS
TSTEATSSSTSSEATSTSTSTEATSSSTSTSTEATSTSTSTEATSSSTSTSSEATSSSTS
TEATSSSTSTSSSTSTSTSTEATSTSTEATSSSTSTSTEATSSSTSSEATSTSTSTEATS
SSTSTSTEATSSSTSTEATSSSTSTSTEATSSSTSSEATSTSTSTEATSSSTSTEATSSS
TSTSTEATSTSTEATSTSTEATSSSTSTSSEATSSSTSTEATSSSTSTSTSTEATSTSTE
ATSSSTSTSTEATSSSTSSEATSTSTEATSSSTSIEATSSSTSTEATSPSTSIEATSSST
STSAEASSSSEVNQSASLLPAEEIASISTVSSVSATSTAVISIEASSSEISSSKVTSTST
PASSTTPIASEVALFSNSTSTSTVTESNTLVTLTTTNAAASTDAATTTAAATFVASESYY
SEDAANASVASASSASRRHSIDALARTSTSAASGSSSTLSIVEQHNGAMNMKTTSFFTVS
FFFVAQLLF
>TBLA0A03910
MKFTN-------------SIAISALALLQQFQSASALIWNREQVEAKEAKNIQ------P
IKP------------KFLELKFDRHYGESY-ED---------------------STLGKD
GAVHLEKRTFDSAYNGSYEDVILTNQLTFYSVELDIGTPAQKVTVVVDTGSSDLWITETS
NPFCST--------GDDD----------------------TEDSVWSPFLLKD-------
---------------------------------------KIDPRVLKHKGKRTTSIDVTA
TATTGSIN-------ISIDLGSNFTLP-PEFLINCTEFGTFNTKKSSTFKNNHTD--FFI
SYGDNTFASGYWGRDVLSFQD-INVTGLSFGVANVTNSTVGVLGIGLPELESTYFGTVNS
VNESS--------Y----------------IYNNFPQVLKNSGIINKTAYSLFLNKSDST
QGSLLLGAVDTSKFAD-KLYTVPMLNINPSKGYTDPSAFLVLMQKMTR---YKYGQGHLV
PSSRIPVLLDSGTTMVYLPRSIVEQIMRHEEAQYVEELDLYQI-KCPSPNKKNQTSFSFD
FGGFQIKASLSDFIVPT------DNGQCIFGMIPQDMNV-GILGDSFLTHAYVVYDLEDY
EISMAQAVYD-GGE--PNYIPIVST---VPSAVRAKYYS------ATDLPS-G---FA--
-------IDSYNNTSKRPKDKTTFSVQADLRNTISGDITT--------------------
--------------------------------------TIEEDSAKTETKHSNAGVA---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------TVP--TYSS------II------------------------------------
-------------------------------------------------------FTFLL
SILI-----
>ZYRO0F10230g
------------------MKWNQILKCTLLANVARSAAFSQEVE---------------E
QTP------------KIVKLSFDKRHGENY-EE---------------------SLLGKR
DALPFVKRD-----DGEYE-LSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSD
NPYCKS--------NSHSSKKRDIGDNSL----DDIFSDITAGGSGAIYKTLT-------
-------------------------------------LTGGSMPSSFGSFGSIDVSTGGI
EPTETISGGGG----GSGGSPTGSSSS-GGQSIDCSRYGTFDKNQSSTYKSNNTA--FEI
SYGDGSFASGEWGRDHIELGS-LNISDVSMAVANDTNSTVGVLGIGLPGLETTYSSDQSM
VSGDR--------H----------------MYSNFPMVLKERGITKKNVYSLYLNSPDAH
NGSILFGAVDKSKFDG-SLYTIPILNVYKSRGVSQPIQFDVTLQGLGL---SNQTSTTTL
STTKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLM-DCPS--KHDETKIVFN
FGGFNIETNLTTYTTPI------SSDTCVLRILPSGDSS-AILGDAFLVHAYVVYDLEDF
EISMAQANFDVNHE----DIEVVSSS--IPQATAAAGYSSTYSS-SKSITS-GGNIFS--
--------------SGTLSGSA--------------------------------------
--------------------------------------SNTASGNNKSKNMAAAPVQ---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------IAPT-SLLA------TI------------------------------------
-------------------------------------------------------FFAIS
MFF------
>AGL192W
-------------------MIAQIAALGAVLATNVACASLVER----------------E
EAA------------QFVRMDFDKKRGPSF-SE---------------------AWSGRA
AVPRLAKRN-----D--WVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGAG
VR-CGP--------NNYP------------------------------------------
------------------------------------------------------------
----------------------------NPNQLNCYEHGSFDTSRSSTWKDNNTQ--FHI
RYGDSTYAHGTWGTDRLDLGQ-ANVDGLTFAVAHASNSSVAVLGIGLPAMETTMSSQQFG
-------------Y----------------QYDNLPMVLKRNNVIKKTVYSMFINELNAK
TGSVLFGAVDHSKYKG-TLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTL
LGSKVPALLDSGTTLTYFPMQLADRLARAAGARWHSEEVGYIV-DCNS-RRLHQTAYIYD
FGGFQIRSPLSDYSMMT-----NVRGTCRFGIMPHSSDY-VILGDVFLTRAYVVFDLEAL
EVSMAQANYEGGKE----QIEVIAGA--VPRAVRAPGYNDPWKA-YTPLVF-NGELGN--
-------LTA--------------------------------------------------
--------------------------------------TASDSSSGSVGSRSNSALT---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------LTP--PSLSETLFAASL------------------------------------
-------------------------------------------------------LGAAT
RII------
>Ecym_4251
------------------MKLSGCIAATVLAFVPSSFALLAQR----------------A
ESA------------AYVRFDLDKTRGNDF-RS---------------------SEKGVM
PFGELKKRD-----DE-YVDVKIHNEQTFYSVNLSIGTPAQEVTVLVDTGSSDLWIIGAD
VD-CGP--------DNSD------------------------------------------
------------------------------------------------------------
----------------------------STEPLDCFEYGAFDKSKSSSWKNNHTE--FYI
SYGDTSFASGEWGTDKLDLGD-LNADGLTFAVATASNSSVAVLGIGLTGIEVTRASGDNG
-------------Y----------------EYDNLPIVLKRNGVIDKTAYSLYLNDLDAT
SGSVLFGAVDHSKYTG-TLATVPLVNVNARYGFPKPIELHITLNGLGF---SSGKKRGTI
SATKVPALLDSGTTLSYFPTELAAAIASNVGAVWNARLRKFLI-PCSQ-AKRNNIDLIYN
FGGVEITSPLVNYLSET-----NVEDVCLLGIVPTSSND-IILGDVFLTSVYTVYDLEAL
EVSIAQAAYGASAE--KENIEVIKST--VPGATKAPGYSNTWST-YAPIST-GGNMFN--
-------AAANHS-----------------------------------------------
--------------------------------------EESQGQSLENRSTQNAAVG---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------LSP--SVIF-AFPSAVL------------------------------------
-------------------------------------------------------IGMLS
LFF------
>KLLA0E04049g
------------------MKLSDVCLGALLASLGSAGYITKRDVSQVG-----------E
ANK------------KHVFMSFDKLRGNDA-SE---------------------ASLSKR
RVGHLKKRA-----DG-YVDVEIDNQNTFYSVDLEIGTPAQKVGVLIDTGSSDLWVPGSG
NPFCSA--------SRSSSKKKRQDYTAL-----------LSSLLSVFGTDVA-------
-----------------------------------------TDYTYTGIASATGSAGTQT
VPTALTSG-------TVAATSIRSVPS-SLATLDCSEFGTFDTSKSSSWQSNDTR--FYI
SYADGTFADGDWGVDEIHLDD-VNVTGLSFAVSNYTDSQFGVLGIGLTGSESTYSGQLST
YNR----------Y----------------QYDNFPIVLQRNGVIEKNAYSVFLNDLDAD
SGSILFGAVDHSKYTG-TLYTVPMVNALRSIGYTEQIRLSITLQGIGV---TSSYGNETV
TQTKYPALLDTGATFCYFPSSLAAAIASSVSATYSSSSGYYFV-DCDS---GSDYDLVFD
FGGFHIISPLSDYIVTT-----SSSSQCVLGILPQSDNE-ITLGDAFLTSAYVVYDLEEL
EISLAQASYT-SGD--E-KIEVIRDS--VPSAVAAPGYSSTWST-AASLST-GGNIFT--
-------VTNNANGTVSTGTGSSGSGSSTSG-----------------------------
--------------------------------------NSGSTSTGSSSKKEGAASS---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------LPV--PHLA------AL------------------------------------
-------------------------------------------------------ICLLL
SAVSIPSLF
>KLTH0G12386g
-----------------MKLLSTSTFLAACGLASAAVVSSRDEGA--------------Q
SAS------------KFVKVSFDKLRGDTA-ED---------------------ATAGAV
AHGVLAKRA-----DG-SETVVIKNQQTFYSVELGVGSPAQNVTLLIDTGSSDMWVMGSN
NPYCEG--------GSSGNSKHVL----------------LGDHVDSRDEEVN-------
-------------------------------------------RDWFSTLRSFLTATATA
TATATATATGSADSGGNAPSRTSVNS--QYATLTCSSYGTFATDSSSSFQSNNTA--FYI
EYGDSTYALGTWGRDNVTLQD-ITLSGISMAVANESNSTFGVLGIGLAALEVTNVGTLAT
RGNS---------Y----------------TYENLPAKMVSEGIIHKNAYSLFLDSLDAK
EGSVLFGAVDHSKYTG-SLYTLPLSNSYKSMGYSDPIQLEVTLQGFGM---TANNTNSTF
TTTPLTALLDSGTTLTYLPTTLVRQVAAKYGARYDSSYGYYLL-SCSD--VKDTDELVFD
FGGFHINSKVENFLIRA------TSNICALGLIPQSSSS-LILGDNFLTAAYVVYDLDNL
EISLAQANYD-GGS--S-NIEVISSS--VPSAVKGPSYSSTWST-SVPIST-GGNIFT--
-------VSGSNSTTTAGNSASGTT-----------------------------------
--------------------------------------SSSRSSSTSSAGKKNAAVG---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------AAS--PGVS------GL------------------------------------
-------------------------------------------------------LGALV
LFIAAGLA-
>Kwal_56.23902
------------------MRISSSTAILGLAGLVSSTAISAEAKYS-------------Q
DES------------KFVKLSFDKLRGDLV-EN---------------------ARAGQI
PRVKRVKRD-----DG-TASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSN
NPYCEG--------SSGKSKHVLLHED-------------SGFEDDTNGKDF--------
---------------------------------------YSDLLSYLTATGTAEYSGSYW
ATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSEYGTFATDSSSSFKSNGTQ--FLI
QYGDLSYALGVWGRDDVTLQD-VKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAESP
SDA----------Y----------------TYKNFPAMLVDQGKIRKSAYSLFVNDLNAT
HGSVLFGAVDHSKYTG-TLQTIPLVNSIKSAQVPKPIQFDVTLHGLGI---TLNDTNTTI
TTTPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRY-QCDE--ISDSDELVFD
FGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE-IILGDNFLTAAYVVYDLENL
EISMAQANLD-GGS--E-DIEEIVST--VPSAVKAPGYSSTWTS-AIPIST-GGNIFT--
-------ISGSNSSSSKTASGSKSSSASKSSSASNSSSAAASTSGSG-------------
------------------------STASSSSSSSSGSSSSSGSSSTSTGSKSSAVAG---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------VML--PESY------SV------------------------------------
-------------------------------------------------------LSGLF
FLVAAILT-
>NDAI0J01030
MKIPSIL------RDTILTTTSSLLLLSTIKNVIATTSIPSQQEQ--------------N
KKQGEASENQPAPTLKYVKLPFEKYTGDSF-ES---------------------ATRNNK
PLNQLLKRDNEDG-AG-YEDVKITNQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSM
NPFCQSSLNSRNVVIKRDDDDDDDDDDDDTQQAAGMFTEILVTNLSDLGNLSD-------
---------------------------------------LLGSFTIISTGIPGGIIPTGV
TTATTTGGGGGAGGAGGLPTATNDIPR-SERTLDCQEYGTFNSSRSSTFKNNYTS--FSI
SYGDSTFASGTWAQDVLNLSD-LNVTGLSFAVANMTNSTVGVLGIGLPALESTYSGASGA
TQRQM--------Y----------------QYMNFPMVLKQSGAIHTTTYSLFLDDLDES
HGSVLFGAIDHSKYTG-QLYTVPMINIMRNSGYSNPIQFDVTLFGIGL---QNGERNLTL
TTTKLAALLDSGTTISYFPTSVVELVARQINAQYSARLGFYTV-PCRS--VSSNTNLVFD
FGGFHISGPLQDFLIQT------SQQTCILAMAPQESQH-VILGDIFLTHAYVVYDLDNY
VIALAQADTSTSNQSSSSDIELITNST-IPRAIRAPLYSETWTA-NRPVQS-GGNIFA--
--------GNGTVIYNQGSGSMTTLSGTAGAQQFTS------------------------
--------------------------------------SSTGSASSGTRRENEANAK---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------VAK--SYVG------ST------------------------------------
-------------------------------------------------------FALLV
TIFMVSLV-
>NCAS0B03560
MRLSTIK-----------YIFSSSLLFTNILASTIPEHETT------------------D
QSS------------KYVILPFNKLVGDSY-ED---------------------ATPDKK
PHFALVKR------DGSYENVAIKNEQSFYSVELLIGTPSQKITVLVDTGSSDLWIMGSD
NPYCAS--------TSNGKNVMRKDDSNLPDGILF-----TEITVTNLSDLTG-------
---------------------------------------FFSDFSFIP--MSETDIPTGV
TSTNTVGG-------PVFPTQTNNIAL-SERTIDCSQYGTFDKNQSSTFQTNFTS--FLT
SYGDSTFASGTWAHDVLNLGG-LNITGLSFAVANMSNSTVGVLGIGLPGLETTYSGSTSK
L------------Y----------------QYNNFPMLLKQSGAIDSTSYSLFLDDLDAK
QGSVLFGAVDHTKYVG-NLYTVPMVNILASKGYPNPIQFDVTLAGIGI---QNDSKNYTV
TTNKFPALLDSGTTISYFPQEVVQTIARQLGARYSSALGFYAM-SCNG--VSSSTNFVFD
FGGFHITGPVSDFLLPT------SGNTCVLAMAPQESQH-ILLGDIFLTHAYVVYDLDNY
EISLAQANTGTQNL--DSNIQIISDS--VPSAIKAPLYSETWSK-AMPIST-GGNIFT--
-------VPANGSATSTHSGSRVTS-----------------------------------
--------------------------------------GSSTSATGSQKKNGAPALM---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------VGSSSSIFG------SL------------------------------------
-------------------------------------------------------LSLIM
AYLL-----
>KNAG0I00910
------------------------------------------------------------
------------------------------------------------------------
MREWLAKRDNT---DG-YSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTD
NPLCASGRRGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWN-------
------------------------------------SVAGDLESGWTM--MTGAENTMMM
TGTGTETA-------VATGVPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTA--FAI
SYGDTSYASGSWGIDTMSINK-LNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTA
SGKKDIAAASSSLY----------------QYANFPMVLKNDGIIHKVAYSLFLNDPQEQ
EGSVLFGAVDHSKYTG-TLYTVPLVDIYHDSASSKPVEFDITLYGLGV---DKDGSQSTI
ATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTM-SCSY--DTSNTNLVFD
FGGFHITAPLDDFVVQQ------SSQTCVLAIGPQQENW-VVLGDVFLSNAYVVYDLENL
EVSMAQANFD-SSL--PESVEVISST--VPSAVKAASYSNPWSS-AVMMST-GGNIFT--
-------VEGASNTTGSSSTRSGSRITSRVGSSSSTR-----------------------
--------------------------------------RSEASSSMGTNQRKNAGAI---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------VLP--SFST------AI------------------------------------
-------------------------------------------------------FTFIA
SFLL-----
>TDEL0F04450
------------------MQLLPAALISGFLLGSQAVALSDVD----------------E
KPG------------KYVHLSFDKLRGNSY-EE---------------------AGKGNK
PSAELRKRD-----DG-YEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPE
NPYCID--------SD--------------------------------------------
---------------------------------------DTKPVT---------------
QLSTSTLA-------TSSGTATSSGNS-GIATVDCSEYGTFDPSKSTSFRSNNTA--FSI
SYGDTTFASGTWGTDNFDLGD-LNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSA
SSGA---------Y----------------QYENFPMALKSQGIIDRNAYSLFLNEPDAD
KGSVLFGAVDHSKYSG-QLYTVPMLNMYRNRGIQNPIEFDVTVQGVSV---TSGSTIRNL
TNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSM-RCPS--ENNDTRLNFD
FGGFQISANLSSYLLSS----RSSSSTCYLGMIPLTSNA-AIFGDNFLVHAYVVYDLENY
EISMAQAAFN-NSD--S-QIEVISDS--IPSAVRAQGYSSTWST-NQAIST-SGS-----
---------------GSGSGTAR-------------------------------------
--------------------------------------TTTTSSNGASGARNAVGDT---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------LAPS-PLFL------LF------------------------------------
-------------------------------------------------------ATIIS
FFI------
>KAFR0H02300
------------------MILLAYLVESLFFIPNYSLSLPQIGGGD-------------S
KQP------------DYVNLKFKKTYGDSF--------------------------EGST
TWSALAKRT-----RG-YELVDLVNRQNFYSVDLDIGTPSQTITVLVDTGSSDLWVTGSD
NPYCVS--------V---------------------------------------------
------------------------------------------------------------
---------------------KSNLVS-STNKFDCNTYGTFDKNQSSTWSSNDTL--FSI
TYGDTSFARGTWGQDKLHLDD-LDVSGLSFAVANVTNSTVGVLGIGLPGLEVTYINAPRN
R------------Y----------------QYDNFPMILKNSGATHSNLYSLHLDHPEAE
HGTVLFGAVDHSKYTG-SLYTIPLVNTLKTHGFSDPAKFEVTLQGVGI---VANNTQTTL
TNTKIAALLDSGTTLTYLPQALVQVIADSIGARWSSRYGYYIV-SCRA-VENSDTTLVFD
FGGFHINGKLTDFIVET------FGNVCLLTIIEETGSNSAILGDNFLINAYVVFDLENN
EISMAQALHNVDDD--Q-DIEIVTSNAGVASAVTALGYSSTWTAEPSTIETFAGDIFT--
-------VSAGATANYTTAKTRQSSS----------------------------------
--------------------------------------DTESNTASTSMNRKNLANM---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------NVP--FTFL------YS------------------------------------
-------------------------------------------------------FPLLG
SIIACIL--
>SAKL0H15664g
------------------MRFDIIAISLLLSQLVTASVLK-------------------K
RSP------------KYVSLPFDKSRGSTY-EE---------------------SSKHNK
PYAVLSKRD-----DG-FQEIELKNQVSFFSVELEIGTPRQNVTVLVDTGSSDLWVTGSN
NPYCRA--------GSVGNRRNDASSGSG-----------SGSGSSNNKKRVN-------
----------------------------------IKRDEISSVRSWLT--ASG-------
TNTRTQSG-------SASATRANSLSS-ALATIDCSQYGTFNTSASSTFSSNDTL--FVI
FYGDSSYAYGTWGQDELYLHD-IDIGGLSFAVANQTNSTVGVLGIGLPGLEVTYSGYASS
ARNR---------Y----------------QYDNFPLILKRNNVIKANAYSLFLNSTNSS
SGSLLFGAVDHSKYSG-QLYTVPLLNTLESSGYTDPIQFEVAVQGIGV---RTSGSNTTL
TTTVIPALLDSGATLSYFPVQVAEMIADALDATYSSSYGYYIV-DCPS--SDDDTEIIYD
FGGFHIASKLTDYILTT-----NRPSICVLGIVPQNSNR-FILGDVFLTSAYVVYDLDNF
EISLAQANYE-GGD--E-QIEVISES--VPSAIKAPSYSSTRFS-SASAST-GGDIFT--
------------------------------------------------------------
--------------------------------------VTGSNTTSSSAPRTSIGSQ---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------VSP--STYI------II------------------------------------
-------------------------------------------------------AGFLL
ASLSAFLL-
>Suva_2.305
------------------MKFSAITLATNAFLFYSSMANADSLASPSL-----------A
AGD------------NYVRIQFQKKYGDSF-EN---------------------ASSNKK
TEARLVKRG-----DD-YEVVDLSNQNSFYSVDLDIGTPSQKVTVLVDTGSSDLWVTGSN
NPYCST--------K-------------------------SGHTSSSSKERKD-------
---------------------------------------EDNILSLVQ--SVVQSVASEI
SYDTTITD-------TDATATQDSTSS-ALQTIDCTTYGVFDSSKSSTFQSNKTD--FSI
TYGDLTFASGTWGHDQLNLNN-LNVTGLSFAVANETNSTVGVLGIGLAGLESTYSGATLS
SAQES--------Y----------------TYNNFPMVLKNSGAIKSAAYSLFLNETNAK
HGSILFGAVDHGKYSG-DLYTIPIINTLQDHGYKDPIQFQVTLQGLGL--AKGDSESTTI
TTTKIPALLDSGTTISYMPVELMEMLADKLGASYSSKVGYYLM-DCIT-DTDDDINVVFD
FGGFYISGNLSSYQLSA----DSSSDVCILGFAPQSDST-VILGDNFLSNAYVVYDLDNM
EISMAQVDLS-GRS--E-DIDVIEDS--VPSAVKAPSYSSTWST-DGSIVS-GGDIFT--
-------VSSGSSNQRSGSGSYSTTSTSSSKGQKDQGSTTYAKSGAG-------------
--------------------------------STASSTMASSSTSASSTKKENVGHT---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------LNP--PFFA------KF------------------------------------
-------------------------------------------------------ITIVL
SYI------
>Skud_4.403
------------------MKFSAATFVANAFLLYSSTVSADSIASASI-----------A
TSE------------SYVIMNFEKKYGDSF-EN---------------------ASNDRN
AGAHLVRRE-----DD-YELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSN
NPYCST--------K-------------------------GKDTSDFSFKQIH-------
---------------------------------------KDNPASVVE--SVI----TEI
SYDTTISV-------IEATATLDNTPL-ASQKINCGTYGTFDSSKSSTFESNKTK--FSI
TYGDSTFASGTWGHDQLNLNN-LNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLS
SVQKS--------Y----------------TYNNFPMVLKNSGAIKSSAYSLFSNKSNSE
HGTILFGAVDHGKYTG-DLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTL
TTTKIPALLDSGTTISYLPVKLVELLADKVGASYSSEYGYYVM-NCIH-EVKKDITVVFD
FGGFHISSWLSNFQLFT----DSSSDVCILGFAPQSDPT-VILGDNFLVSTYIVYDLDNM
EISMANADFS-DND--E-YIDVIESA--VPSALKAPNYSNTWST-YESIVP-GGNIFS--
-------TSSNVSMSGSGSRSHSATSSSSLKGQKLQTSTT--------------------
------------------------------NSRSSAATSVSSPTLSSSTRKENGGDN---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------LSP--PFFA------RL------------------------------------
-------------------------------------------------------ITTIL
YYI------
>Smik_4.388
------------------MKLSTIKFVVNALLLHSSMVFADSIISQSS-----------E
IND------------GYVKMNFQRKYGDSF-ES---------------------ATNDTK
ARARLVTRG-----DD-YELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSD
NPYCFT--------E-------------------------GEDTSGSSFKHVN-------
---------------------------------------KDNLVSVVE--SVF----TEI
SYDTTMVT-------SVATATIGNTAS-TSQAMNCTTYGTFDTSKSSTFESNKTE--FSI
TYGDSTFASGTWGHDRLSLNN-LNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLS
SAQKS--------Y----------------TYNNFPMILKNSGAIKSTAYSLFTNHSDSK
HGTILFGAVDHGKYAG-DLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTL
TTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIM-DCIN-EMEEESSLIFD
FGGFYIANWLSNFQLLT----DSRSNVCILGIAPQSDPA-IILGDNFLVSTYVVYDLDNM
EISMAHADFS-DGG--E-YIDTIKDS--VPSALKAPGYSSTWST-YESIVP-GGNMFP--
-------TSYNFSSSNSVSLSHSATGTSSNKGQKSQTSTTAFSNSRS-------------
-------------------------------SSTISSTAMSSSTSSSSTRKENGGHN---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------LNP--PFFA------TF------------------------------------
-------------------------------------------------------VMAIL
YHIR-----
>YDR144C
------------------MKLSVLTFVVDALLVCSSIVDAGVTDFPSL-----------P
SNE------------VYVKMNFQKKYGSSF-EN---------------------ALDDTK
GRTRLMTRD-----DD-YELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSD
NPYCST--------K-------------------------KKDTTGSSFKQVN-------
---------------------------------------KDALASVVE--SVF----TEI
SYDTTIVT-------SEATATFDSTAS-TSQLIDCATYGTFNTSKSSTFNSNNTE--FSI
AYGDTTFASGTWGHDQLSLND-LNITGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLS
SVQKS--------Y----------------TYNNFPMVLKNSGVIKSTAYSLFANDSDSK
HGTILFGAVDHGKYAG-DLYTIPIINTLQHRGYKDPIQFQVTLQGLGTSKGDKEDNLTTL
TTTKIPVLLDSGTTISYMPTELVKMLADQVGATYSSAYGYYIM-DCIK-EMEEESSIIFD
FGGFYLSNWLSDFQLVT----DSRSNICILGIAPQSDPT-IILGDNFLANTYVVYDLDNM
EISMAQANFS-DDG--E-YIEIIESA--VPSALKAPGYSSTWST-YESIVS-GGNMFS--
-------TAANSSISYFASTSHSATSSSSSKGQKTQTSTTALSISKS-------------
-------------------------------TSSTSSTGMLSPTSSSSTRKENGGHN---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------LNP--PFFA------RF------------------------------------
-------------------------------------------------------ITAIF
HHI------
>TBLA0H01290
--------------MKDHAILLALLALINVSISDPIPPVENSNNDGKVN----------S
VNS------------NFLKLGFEKFYADSI-NDIVIEYDNDTDDYRLQKRDSIIDLKESK
PYVNLIKRN-----DG-YEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSD
NPYCKS--------NSGKSTNLLTPTDSDSDSDSDSQPDLESGSSSGNNDGDDGSILSWF
EKFKFWKNNNKQEEVAKKNIVIIDDVLQIKNAQADSEKPDWNPFGW-------------G
STATATTG-------GNSGYQTMSLDP-SQATINCDTYGTFDIEDSSTFQSNKTS--FAI
RYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQS
TKP----------Y----------------IYDNFPLVLKNSGAIHKSVYSLYLNKQNAK
NGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGV---TDNTNNYTV
TTTQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVM-NCPD--SDDNTQIVFD
FGGFHINANLTNFVLSS------ASGKCVLGLLPYNGNS-AILGDMFLTHAYVVYNLDDL
EISMAQANYD-NSN--E-DIEVITST--VPNAVKAPGYSYTYST-SKSIVS-GGNIFG--
-------STTYSINPSSSNSGDSHDSTSTVQGTGSTSS----------------------
--------------------------------------RISTRTTSKTKQANDASNL---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------FSPTNSLFT------LL------------------------------------
-------------------------------------------------------FTFIC
TLLV-----
>KNAG0G02410
------------------MLLAPSVLFPLVAVCAAAK-----------------------
---------------DYVGMRFEKKFGDNY-AG---------------------ATKWQR
PQMRLAKRN-----TG-YEEITLTNQQSFFSVELDVGTPAQNVTVLVDTGSSDLWITGAD
NPYCLT--------Y---------------------------------------------
------------------------------------------------------------
-----------------SGSGADSIP--RRDRVDCSEYGTFSLEDSSTWSQNSSAPPFYI
TYGDTTFASGVWGQDHLHLQD-VNVTGVSFAVANRTNSTVGVMGIGLPGLETTNSGSRP-
-------------Y----------------TYANFPQVLKNSGATQSALYSLYLNDLEEE
RGSILFGAVDHSKYTG-SMYTLPIINRLQSYGYTTPIQFDITLQGIGLSSSESNGDEVTI
TSTKMPALLDSGTTMTYLPSNIVSQIAQQLGASMSARFGQYVL-PCSN--VPENMHLVYD
FGGFHINSNLTNYIVQA------SQTLCILGLFPRDSNT-AILGDTFLTDAYVVYDLENL
QIGLAQAKFGVSDS--DAKIDIVTGSAGIPSAQRAPDYSSTWSTSVGTVTT-GGNIFT--
-------LNPHETAVLISSVSGSGVVTQTVTRRTSTATSTS-------------------
--------------------------------------TQTTGTTGTTTVRRNDAIA---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------LSGNHGWIM------AA------------------------------------
-------------------------------------------------------AAFCC
SFLY-----
>KAFR0B05710
------------------MKLLNSKLILSTSLITALTDASIVAKD--------------S
KQPSDFNKN------KYLKLGFDKYVGESF---------------------------DKS
SKDSLQKRA-----E--YAIFNLTNQASFYSVELAIGTPSQNVTVLVDTGSSDLWVTGSD
NPLCST--------DSSDDDDDSYAF---KKKRAETIVVTEEATITENGNNLD-------
---------------------------------------GLDPFGWLG--GS--------
----TATS-------GSFETSFPSSSS-SSGDFDCSEYGTFNTNDSSTWSSNHTS--FFI
SYGDSSVAEGVWGQDVLSISD-VDVSGVSFAVANYTNSTVGVLGIGLSGLETTYSGTSSS
ES-----------Y----------------IYENLPMLLKSSGVIDTIAYSLFLNEKSDT
TGNLLFGAVDHSKYSG-SLYTLPIVNVYASEGYKNPLEFDVTMYGLGI---STSDSNTTI
ATMKIPALLDSGTTIVYFPETLLELVADQLGASYSDELGFYAM-SCVS--SSDDTEFVFD
FGGFHITVPLSDFLIRV------SGSECILAMAAQDDES-IILGDYFLTNAYVVYDLENY
EISMAQANYD-SED--E-DIEVISST--VPSAVKAASYSNSWSS-TGSITS-GGDIFT--
-------VASNSTATNSVTTTKSSSSKT--------------------------------
--------------------------------------SSGHSTTDSSSRKSNAGSG---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------ISYASYLLM------AS------------------------------------
-------------------------------------------------------ITFVL
SYLL-----
>CAGL0M04191g
------------------MKFSSLCMLASVAAHSKAAKNVADL-----------------
---------------SYVKLDFDKYYGETFETA---------------------KRGRSQ
ADIRVNKRA-----NG-YEEVQITNQNSFYSVTLEVGTPPQSVVVLVDTGSSDLWITGSD
NPYCRG--------STGTSGKNMLLEAELKRALEDARDIAKERTTLAPRDDEH-------
---------------------------------------NDGLLSWLT--GSDGLLGGQG
GTTITLTD-------SAQPTAAGTSNG-ARATINCAKYGTFDTSKSSTWHSNDTA--FMI
QYGDSTFASGTWGMDNLHLSD-LNVTGLSFAVANRTNSTVGVLGIGLPALEVTYSGRTAV
SGQRP--------Y----------------QYDNFPLVLLRNGAIKSNSYSLFLNNASAE
TGSVLFGAVDHSKYLG-DLYTIPMVNTYASQGYKNPIQFEVTLNGLGI---SSSSDNTTI
TTTKIPALLDSGTTLTYLPQALVTRIVQKLQATYSNRAGYYVF-SCPS--QSDDTEVVFD
FGGFHINAPITNFIIGS------SGDSCILGIMPQSGGG-IILGDSFLNSAYVVYDLENY
EISMAQANYA-GGQ--E-DIEVISSS--VPGAVRAPGFSSTWSTLATSFNT-QGDIFT--
-------VQAAATVSGSATNTGTGRATATGNSNSTRSTTSRS------------------
--------------------------------------RTSATSTRSDSQKKNDASR---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------TSFTSTLLF-------V------------------------------------
-------------------------------------------------------AGLLV
SFI------
>Suva_10.211
MRLATIR-----------SALLSSLFASQTLAKLIPVATDGDGG---------------D
TGS------------KFVKLSFDKLYGDSL-DT---------------------AGRDKK
PEVRLSKRA-----DG-YEEIIITNQQSFYSVDLEVGTPAQNITVLVDTGSSDLWIMGSS
NPYCSS--------DDSSKYVLR-----------------KRDTSSSSGDLVN-------
---------------------------------------DINPFGWLTETGSVT------
GATATATG---------SGTATQSVPA-SEATMDCEEYGTFTSSDSSTFKSNNTA--FEI
SYGDGTFAAGTFGTDVLNLSD-LNVTGLSFAVANETNSTMGVLGIGLPSLEVTYSGSSAS
NGGKS--------Y----------------KYDNFPIVLKNSGAIKSNAYSLYLNDSDAK
HGTILFGGVDHNKYSG-TLYTVALVNTL--SGFTSPIQFDITLNGLGI--IDDNGDEKTL
TTTKIPVLLDSGTTLTYLPVEMVELIAENVGAQYSSRIGYYVM-ECPS--SDNSTEIVFD
FGGFHINASLSSFILST------SGNTCLLGIIPTSDSTGSILGDSFLTNAYVVYDLENL
EISMAQAKYN-VTS--E-DIEVISTS--VPNAVKAPGYTNTWST-TASIAT-GGNIFT--
-------VDSSST--ASYSGNVT-------------------------------------
--------------------------------------SSTASATSTTSSKKNGGDR---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------IVP--SLPF------TL------------------------------------
-------------------------------------------------------ISLLF
AFI------
>YLR120C
MKLKTVR-----------SAVLSSLFASQVLGKIIPAANKRDD----------------D
SNS------------KFVKLPFHKLYGDSL-EN---------------------VGSDKK
PEVRLLKRA-----DG-YEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSD
NPYCSS--------NSMGSSRRRVID--------------KRDDSSSGGSLIN-------
---------------------------------------DINPFGWLT--GTGSAI----
GPTATGLG-------GGSGTATQSVPA-SEATMDCQQYGTFSTSGSSTFRSNNTY--FSI
SYGDGTFASGTFGTDVLDLSD-LNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTAS
HSGKA--------Y----------------KYDNFPIVLKNSGAIKSNTYSLYLNDSDAM
HGTILFGAVDHSKYTG-TLYTIPIVNTLSASGFSSPIQFDVTINGIGI--SDSGSSNKTL
TTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVL-DCPS---DDSMEIVFD
FGGFHINAPLSSFILST-------GTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENL
EISMAQARYN-TTS--E-NIEIITSS--VPSAVKAPGYTNTWST-SASIVT-GGNIFT--
-------VNSSQTASFSGNL----------------------------------------
--------------------------------------TTSTASATSTSSKRNVGDH---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------IVP--SLPL------TL------------------------------------
-------------------------------------------------------ISLLF
AFI------
>Skud_12.192
MKLTTVR-----------SAVLSSLFALQTLAKIIPAASKRDD----------------D
SNS------------KFVKLPFHKLYGDTR-DD---------------------VGTDKK
PEVRLLKRA-----DG-YEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSN
NPYCSS--------GSMSSSRRRVIN--------------KRDDSSSSGALVN-------
---------------------------------------DINPFGWLT--GTGSAI----
GPTATGSG-------GGSGTATQSVPA-SEATMNCQEFGTFTTSDSSTFRSNNTY--FSI
SYGDGTFASGTFGTDILDLSD-LNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTAS
SSRRP--------Y----------------TYDNFPMVLKNSGAIKTNAYSLYLNDSDAK
HGTILFGAVDHSKYAG-TLYTVPIVNTLSASGFSSPIQFDVTINGIGI--SYPDNSQKTL
TTTQIPALLDSGTTLTYLPQAVVAMIADELDAQYSSRLGYYVL-DCPS--NSNSTQIVFD
FGGFHINASLSSFILNA-------GNICLLGIIATDDTT--ILGDSFLTNAYVVYDLDNL
EISMAQAQYN-ITN--E-NIEVITSS--IPSAIKAPGYTSTWST-SASIVT-GGNIFT--
-------VDSSQT--ASFSGNVT-------------------------------------
--------------------------------------SATASATSTTSKSRNVGDR---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------MAP--SLPF------TL------------------------------------
-------------------------------------------------------ITLLF
AFI------
>Smik_12.186
MRLATVR-----------SAVLSSLFALQVLAKIIPVASKRDNDDD-------------D
SNS------------KFVKLPFHKLYGDSL-DN---------------------VGRDKK
PEAHLFKRA-----DG-YEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSN
NPYCSS--------DTRSNSRRRVID--------------KRDDSSSSGALVN-------
---------------------------------------DINPFGWLT--GTGGLI----
GPTATGSG-------GSSETATQSVPA-SEATMDCKEYGTFTTSDSSTFRSNNTY--FSI
SYGDGTFASGTFGTDVLDLSD-LNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTAS
RGRRP--------F----------------KYDNFPIVLKNSGAIKTNAYSLYLNDSDAE
HGTILFGAVDHSKYTG-TLYTIPIVNTLSASGFSSPIQFDVTINGIGV--SDSKNGEKTL
TTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVL-DCPS---DDSTQIVFD
FGGFHINASLSSFILST-------GSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNL
EISMAQAQYN-TTT--E-NIEVISSS--IPSAVKAPGYTNTWST-SATIVT-GGNIFT--
-------VDSSQTASFSGNV----------------------------------------
--------------------------------------TSSTASATSTSSKRNAADC---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------IAP--SLPL------TL------------------------------------
-------------------------------------------------------FSLLF
AFI------
>Kpol_543.61
MKLFTSKESAIAMALAFSACIDQAASFALPFGLGKKRVVSELEIP-HGKHAKAQQPGASN
ESQ------------GFVRYHFDKLVGDSF-EN---------------------ASNKNK
RYANIVKRD-----NG-VEEVEIMNQSNFYSVSLSIGSNAQNVTVLLDTGSSDLWVTGSN
NPLCSR--------GDS-------------------------------------------
------------------------------------------------------------
----------------------------NSDAVDCAKFGTFNPSTSDTWSSNETS--FSI
SYADSSYASGTWGQDTLKLQD-LDVTGLSFAVANYTNSTVGVLGIGLPSLEVTYSGSNNV
AGTR---------Y----------------QYENFPLLLKNSGATKANAYSLYLNDLDSR
TGSVLFGGVDHNKYSG-TLYTIPLVNTLRAAGFSQPVEFDVTLQGMGI--SDDEHGNVTL
TTTKIPALLDSGTTLVYLPSALVSLIADEYDAVYNSRTGYYVM-NCPD--SDEDSQIVFD
FGGFHISTNLTTYIIQA------VGGICVLGILPQSSGT-AILGDSFLQHAYVVYDLDNL
EISMAQASFE-TDD--E-NVEVISSS--IPSAVKAPGYSSTWST-FSSISS-GGNIFTVD
VNTASASSSGSSATSSASSGSGAASGSTSSGTARSSSSANSGQTTSR-------------
------------------------AASTTTRSSSSSRSSSSTSRSGSGTSNDAMHIA---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------AAP--SLFV------FI------------------------------------
-------------------------------------------------------ASLLT
MVF------
>TPHA0A01580
MKVLNSN------SVVYAAVLLSDLSNGLSLFGNKKPQLTKRDG---------------S
EID------------NFIKFKFDKSYGDSY-KN---------------------SSKRNK
PKLDIVKR------DG-YEEIELKNESSFYSIKLSIGTPAQNVTVLIDTGSSDLWVTGSD
NPLCSS--------D---------------------------------------------
------------------------------------------------------------
-----------------DATFTGSDGS-SQSSIDCSLYGTFDIDDSSSFTSNDTS--FAI
TYGDGSYALGNWGQDVLSLQD-IDVTGLSFAVANYTNSTVGVLGIGLPSLEATYSGSLAG
SNP----------Y----------------QYDNLPLVLRNSGAVKSYAYSLFLNDEDSS
EGSILFGGVDHSKYEG-TLNTLPLVNYQKSSGFQSPYEFDITLQGLGI---STSSKNTTV
SDTQIVALLDSGTTLTYLPVTLTSLLAAELNASYSARLGYYTM-SCPS--SSDSTEIVFD
FGGFHINVPLTSFIVTS------SMNVCILGIIPRSGDQ-AILGDSFLQHAYVVYDLENL
EISLAQAKYG-SSS--E-DIEAIVSS--VPSAVRAASYSNTWST-AATINS-GGDIFT--
-------VSTTASNGTTSSGSSTRSSTSSRRTGTATSSSTGSAKDSSASSLRPSSSTIDS
VSGSSGSSSSTSSTSISNSATTLASTTRSSSTSSSLSTSTSSSRTSSSNSNSNGSNI---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------IVP--SFI-------TI------------------------------------
-------------------------------------------------------LASLF
YFI------
>NDAI0G02620
----------------MTSRIISHILLSLPYFISQASASSKDN----------------T
SPP------------KYLALNFEKRYGDSF-LN---------------------SSSSNG
PSAQLIKRD-----DG-YEQVTLTNQQSFYSVEVEMGTPSQKLTVLLDTGSSDFWVTSSD
NPYCGT------------------------------------------------------
------------------------------------------------------------
-----------------TSTEGSLYGGETQDTIDCSTYGTFDSSKSSTFQSNDTD--FLI
SYGDGSFAEGTWGTDVIKLDDSLSLNDVSVAVASSTNSSMGVLGIGLRPLETTYSSTKSV
NEKTS--------Y----------------MYDNFPISLKKSGLIESTAYSLYLNDPSSK
SGNILFGGVDHSKYTG-QLYTVPMLS--STTSYKTPVEFDVTLNGIGI--IDSSGNKKTL
TATQFYGLLDSGTTFSYLPSALVAMIGEELGASYDSNIGYYTI-DCSA-EDSDDTKIVFD
MGGFHINTTLSDFVIQI------STSTCILSIVPQDGK--VVLGDSFLNNAYIVYDLDNY
EIAMAQAAWD-STR--EANIDVISTT--IPSAIRAPGYSSTWST-SRSISS-GGDIFTTT
EVTLSTSATSSPESSASSVTSASTLSSDSSAASSYSRSTSTLRSSSRSSSFVSSNNRATA
STSSSIRS----------------SSSSSSSSSSSSSSSSSSTGITSSTNRTNSGIQ---
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------LAIS-PLLL------AA------------------------------------
-------------------------------------------------------VSMLS
IFLFV----
>NCAS0C03300
------------------MVFAKQLLSTSLLLSSSLWDFAQALDN--------------E
LPN------------KFVNLRFNKKYGDHYDTA---------------------STDSRK
PKLELVKRD-----GSDYEEVELTNQQSFYSVEVDVGTPSQRVTVLLDTGSSDFWVMGSD
NPYCSD--------DT--------------------------------------------
------------------------------------------------------------
----------------------------STTGIDCSEFGTFDSSSSSTFHNNGTA--FNI
HYGDGSFALGTWGTDTVSIDD-ITLDALSLAVANSSNSSMGVIGLGLAGLETTYSSSHAV
KSGQT--------Y----------------QYANFPLALKNAGIVAANAYSLYLNDPEET
TGNILFGAVDHSLYSG-QLYTIPLVNIYSGSGFKNAVEFDVTLNGIGI--VDSSGSATTV
STTPIIALLDSGTTLTYFPTQYVSLLAAQLGAQYSSSNGYYTI-SCDA-MQDTTTKLVFD
FGGFHINATLADFVVQS------GTSTCFLSIIPQNSSS-AILGDTFLNNAYVVYDLDNL
EISMAQAKWDQSSD--E-DIEVISSS--VPSAVKAPGYSNTWST-TMSITS-GGNIFT--
-------VNADASATVSNSGSSASASSSSASSGSNSRTTSTLSTSSRKST----------
------------------------QTSTRTSSGTSSRRSSTSTSTSSSNNKEENGSTTV-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------MVPSISFFV--------------------------------------------
-------------------------------------------------------LAFLS
IFVAF----