MUSCLE (3.8) multiple sequence alignment

ZYRO0D06600g       ---MMLILIAALILQIAVLLISPLFKYQWPFSLYYKYVFLPLFQDNDRFRWKFYLVPLFY
KNAG0H03110        --MWTQLLLILAVLQVFLLLLSPLARLQWPLSWYYEKVYRPFLADPTRYRVKYYIVPVFY
TBLA0D04040        -MGFGTFLVVLVILQILILFISPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFY
TPHA0C01070        ---MWFQVICLVVLQVTLLLLSPFLKNRWPFSVYYRRLYVPYLKDVNSYKWKYHVVPGFY
KAFR0B05370        -MMFRILLNIFVISQIIFLLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIFY
TDEL0F04130        MGLFSVLLFLVVAAQIIVLLLSPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFY
NCAS0B03590        --MIEYICLLLIVSQVILLLISPRYRLIWPFSVYYKKVFHPLIQDNKKFKIKFYIIPIFY
Kpol_1033.16       ---MLIYLGGLVVIQVLLLVLSPIFKLTWPLSIYYTKFYRPFFLDKERYRWKYYLVPGLY
NDAI0J01000        -MSWSIIVIIITIFQVILLLLSPRYKNRSPFSIYYRHVFQPIVQDSHRYRWKYHLVPFFY
Smik_4.372         --MSWNVLFVLLVGVVVLILLSPVFKSTWPFSTFYRNVFQPFIADDQKYRWKFHLVPIFY
Skud_4.387         --MLWNVLFVLLVSIVVLILFSPVFKSTWPFSTLYRRVFQPFVSDDQKYRWKFHLVPLFY
YDR126W            --MSWNLLFVLLIGFVVLILLSPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFY
Suva_2.289         --MSWNALVVPLVGIVLLVLLSPVFKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFY
AGR065W            ---MMGALCALAVTQAGLILAAPALRAYWPFSWYYHVVFRTVLQDTQRHRWKYWATPAFY
Ecym_4282          -MSMLVVLWLLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFY
CAGL0B01991g       --MLLFLVFILVVSQVVLLLLSPQFRDKFIFRWYYDEVYKPMILDNSRYRIKFYVVPVFY
KLTH0G13112g       -MKMGLFIWILIIPQLVLSLFSPLFRTKPVFRWYYTRVFHPIFEDVNRFRWKFRAIPAFY
Kwal_56.23697      ---MSLYIWAFVVVQLVLLLFSPLLRARPVFKWYYRNVFYPIFEDADKFRFKFHVVPILY
KLLA0F19690g       ---MFLLFLLFVVSQVGLLVFSPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFY
SAKL0H16434g       ---MILLFWLFVVPQIVLLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFY
                                    . . :*  .    :   *   : . . :   .. *    * :*

ZYRO0D06600g       SSIYLGVVHLAIKNVIPQLSPGLNFFDYWFFIPFFIVL-TPATGILAAIIGPETTKSCKR
KNAG0H03110        FSLYCYMLNLYRSELLPVIWGRLYFIELYFFQPLLLAA-IPVSGLLTMFTRPEGCGGRDQ
TBLA0D04040        ITLFIYLVINFYAKVEPLIHDKLTYFERFFFIPISIIS-TPFFGIITMLINPDTALMYSN
TPHA0C01070        FSIYLYLVYCYYAKVEYLIVNHLNLFERGILLPLLIVL-TPSFGILTMVTKPINIHGNGI
KAFR0B05370        VTLYTYMVLLYFTKLNPIIKSQLTILERWVIIPFSLLI-SLLSGILTMRIRPESSLGFNS
TDEL0F04130        LSLYCYIIFVLIRDVIPVIGNRLLSVEKLCIIPVLVVA-TPVLGWLSMTVKAKTSRGCQP
NCAS0B03590        FVLYLYLIYCYYSKVAPFINNQLWAFEKYMWIPLIIIASPLIFGVFTMFTKPTYTKKYSD
Kpol_1033.16       LGLYLFVIIYYHLRVNFMVNPHLYWFEKGLILPIMFTS-LPYFGVMTMITKPENSIEHGI
NDAI0J01000        LTLFIYLTYCYYTKVEPLIASQLYFIEVWIWIPFMIFS-PVIFGILTMVTIPNTVNNRRN
Smik_4.372         TLIYLYLVYTYHTRVEWLVRSELFLCERILVVPIITLA-PIACGILVMVTKAEDSYHHKP
Skud_4.387         TSIYLYLVYTYHAKVEPLIKNDLFLLERILIGPIIILP-PVALGILAMVTKAEDSNVHRP
YDR126W            TSIYLYLVYTYHMRVESTIKNELFLLERILIVPIIILP-PVALGILAMVSRAEDSKDHKS
Suva_2.289         TSIYLYLVFTYHTRVEPLIKNELFLLERILIVPIIILP-PVVLGILAMVTKAEDSNNHKL
AGR065W            AGVYAYCVWLFYGEVYAEIAKALWVPERWVL-PAAVVA-PAAAGVAAAATPAAVPA----
Ecym_4282          TGIYIYCSFVFYVHVYGEIRSGLYTLEARCL-PVVLAL-PLLSGYYTIVTSPHDTITYVG
CAGL0B01991g       LSVYSYMVYIFYSRTFAIISPMLTSIETYVVIPLMLIL-PLFFGSMSMIIKPDSSNAHQI
KLTH0G13112g       LSIYAYCTFLFFKDIEGLIRSRLFGVERLLIIPVALSA-PIITGLLTIWIKPKSTYASPM
Kwal_56.23697      LAIYLYCCLLFFRDIEGLIHSRLYAIERWFIIPVALMT-PISCGLLTMLVKPESTYIAPP
KLLA0F19690g       ACILIFCVHLFYNKLNDTVNPYLYSLEKAFI-PITIAF-TSLTGVASVFVKPLGLQAGP-
SAKL0H16434g       TSIYIYCVLMFYKDLYRDLSPYLLFLERFLIVPLLLLG-PIITGYLCMTIEPDSTKSLAD
                     :               :   *   :     *          *       .        

ZYRO0D06600g       RNID----KFRYDNLLFYPNINCRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGL
KNAG0H03110        GVAP-SEGQWPYDGILYYPNTTCRSCHTVKWARSKHCSICRRCIQLADHHCIWFNTCIGR
TBLA0D04040        DSIK----KYAYDRILYFPDTECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGR
TPHA0C01070        SQHDKLKNKFPFDNIIYHSGNVCSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGL
KAFR0B05370        SPYQ----DFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGL
TDEL0F04130        GSAQ----EYDYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGK
NCAS0B03590        EIDN----EYAFDNLIFYPQILCRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGK
Kpol_1033.16       NSNN----RYRFDEILYFPNVSCKTCRKPKPARSKHCSICDKCILLQDHHCIWVNNCIGM
NDAI0J01000        QEKV-LY-RYPYDEIMYYPNIECRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGE
Smik_4.372         GSTE----KYPYDYLLYYPVVKCSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGK
Skud_4.387         GSTE----KYPYDYLIYYPDVQCSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGK
YDR126W            GSTE----EYPYDYLLYYPAIKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGK
Suva_2.289         GSTE----KYPYDYLLYYPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGK
AGR065W            --------DAAYDGLLFHDGVECRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGR
Ecym_4282          P-------EIPFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGL
CAGL0B01991g       GSEK----RYPYDNLLYFPQHECRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGM
KLTH0G13112g       --------LDAYDELIFHSGVSCRTCKLPKFARTKHCPICDQCVQLADHHCVWANNCIGR
Kwal_56.23697      --------VDQFDGILFHAGVECRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIGK
KLLA0F19690g       --------QFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGY
SAKL0H16434g       C-------RVPFDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGK
                               * :::.    * :*   * .*:.** :*  *    ****:* *.*:* 

ZYRO0D06600g       GNYLYFYLFLVLNSLSMSYAFIRSMSIVG----LKPNIKYPRSILAFNLLTGCFALICIV
KNAG0H03110        GNFFYFYVFLACHCLILTYAFARLFFFVV---VADNKLTSTRSTLTLLMLTGTFALLVDL
TBLA0D04040        GNFLYFYLFLFDNTLFMSYASMRLLEITLN--FRRAGENVPRDVMTLDILCGCFLFICGT
TPHA0C01070        GNYKYFFMFLLLNTISLSYAFLRLLHITL----SKPDVPKSKNILALCILTGSFSVICGV
KAFR0B05370        GNYQYFYTFLVSNTLLLGYAFLRIILLTA-----YSDIGFPNIVLTFLILSGAFFAILLV
TDEL0F04130        GNYQFFYAFLVVNVISLSYGFLRVLWISVM--KDPSMVVYPRSILIFTILCGTFAIICGV
NCAS0B03590        GNYTYFYMFLITNTFSLTYAFIRLLTIFY-----TTNVYLPKNTLTLTILCGCFSVICGI
Kpol_1033.16       GNYKWFYLFIGGNSLTMIYCFTRLLFISI-----KYKVTSSRAILTMNILCGSFAIICSV
NDAI0J01000        GNYLYFYSFLLCNCITMTYSFIRLFLMYC-----QGHAPSSRNILTLLILCGSFAVICAG
Smik_4.372         GNYLQFYLFLISNIFSLLYAFLRLWCISL-----NSKTALPRAVLTLTILCGCFTIICII
Skud_4.387         GNYIQFYLFLISNIVSMSYAFLRLCSISL-----KSSTALPRAVLTLSILCGCFTIICAI
YDR126W            GNYLQFYLFLISNIFSMCYAFLRLWYISL-----NSTSTLPRAVLTLTILCGCFTIICAI
Suva_2.289         GNYLQFYLFLFSNIFSMSYAFLRLYFISF-----NSTAVLPRAVLTLTILCGCFTIICAI
AGR065W            GNYGLFYLALGAHCALLTYGAVRLPLAAP-------AGRWPRALLALELLVASFAVLCVW
Ecym_4282          GNYQYFYLFLLSNCSMLSYATIRLSSVAP-----SGLWRSNKSFLSLMILVCCFAVISIS
CAGL0B01991g       GNYMYFYSFLCSNLLLLSYSFIRLIFIQFNKSAYNTTPTGEKSLLILSILCGSFTVILAV
KLTH0G13112g       GNYQYFYLFLVSNVFLTNYGFLRLLFLQR--------FVHSRQLLILSILLGCFGVILAV
Kwal_56.23697      GNYEYFYLFLASNVFLTVYGFTRLLYLQP--------TVKSRTLLTLALLLGSFALILVI
KLLA0F19690g       GNYEYFYSFLLSNCLLLTYASLRLLTLFR-----ITAFKKDKFFLSLFLLTTAFSLIAIV
SAKL0H16434g       GNYKYFYGFLLSNVTLLSYSFLRLTSIQL---MSQTENIKTKPMLVLTILTGCFDIIVAV
                   **:  *:  :  :     *   *                  .  : : :*   *  :   

ZYRO0D06600g       FTYLQLCMVREGMTTNEKDKWFTIHEYMREKRLVK-SSSGK---WYYDLTDRL-------
KNAG0H03110        FTYWQMMLVKEGMTTNEQDKWFLIHEYMRDGKCVNVSCNGSTKKWFL-------------
TBLA0D04040        FSYMQLLIVKDGMTTNEKDKWYTIQCLMEDKKLVK-SSDNN---WYISFVN---------
TPHA0C01070        FFYLQMKQVNNGMTTNETDKWYAVQELMREGKLIK-SEDNN---WFALSTE---------
KAFR0B05370        FTYLQFALVYDGMTTNEKDKWFTIQEFMREGRLIR-TDNGQ---WLIAHPE---------
TDEL0F04130        FTYLQLQLVNDGMTTGEKDKWYTIQQIMREGNLVR-TLDGQ---FFIQ------------
NCAS0B03590        FTFLQLNLAQEGMTTNEKDKWFTVHEFMRDGKLVR-TQSGR---WYFADPHD--------
Kpol_1033.16       FTYLQLDLVSQGITTNEMDKWYTIHEYCRDGKLAR-SKSGN---WFLIDSN---------
NDAI0J01000        FTFLQLQLVKDGMTTNEQDKWFTLQEYMRDGKLIRTKDENK---WFIANPNDDAT-----
Smik_4.372         FTYLQLTIVREGMTTNEQDKWYTIQEYMREGKLVR-SLNDNCQSWFLKLTEDDTTK----
Skud_4.387         FTYLQLAIVREGMTTNEQDKWYTIQEYMREGKLVR-SLNDDPQSWFLKLTEKGDAAE---
YDR126W            FTYLQLAIVKEGMTTNEQDKWYTIQEYMREGKLVR-SLDDDCPSWFFKCTEQKDDAAE--
Suva_2.289         FTYLQLAIVKEGMTTNEQDKWYTIQEYMREGKLVR-SLDDDSRSWFLKFTEKGDTGQ---
AGR065W            FTATQVALVRDGMTTNEQDKWYAVQESMREGTLVR--LRGR---FYHR------------
Ecym_4282          FTYMQFALVRDGMTTNEKDKWYTIHKLMRNEQLLKLNNDCK---FYIRIKNS--------
CAGL0B01991g       YCYFVFELVNSGMTTNEKDKWQMVHDYINTGDLVR-DPEGK---YFIKY-----------
KLTH0G13112g       FSYFQFVLVRDGMTTNEENKWLVIHDMIRARQMVT-DDTGK---YYFRLLADCQEDSAES
Kwal_56.23697      FSYFQVVLIKDGMTTNEESKWLVVHDMMRARKLVV-DNAGK---FYYRIPENEDSLSPEL
KLLA0F19690g       FTYYQLKLVNDGMTNNEQDKWYLVQEYMRNGNLVK-DMDGV---LYYRSMST--------
SAKL0H16434g       FGYTQFNLVHDGMTTNEQDKWFTVQEFMRDGNLVR-DKKGH---YYFRILDESSSDRDQK
                   :    .    .*:*..* .**  ::                                   

ZYRO0D06600g       ------------------------------------------------------------
KNAG0H03110        ------------------------------------------------------------
TBLA0D04040        ------------------------------------------------------------
TPHA0C01070        ------------------------------------------------------------
KAFR0B05370        ------------------------------------------------------------
TDEL0F04130        ------------------------------------------------------------
NCAS0B03590        ------------------------------------------------------------
Kpol_1033.16       ------------------------------------------------------------
NDAI0J01000        ------------------------------------------------------------
Smik_4.372         ------------------------------------------------------------
Skud_4.387         ------------------------------------------------------------
YDR126W            ------------------------------------------------------------
Suva_2.289         ------------------------------------------------------------
AGR065W            ------------------------------------------------------------
Ecym_4282          ------------------------------------------------------------
CAGL0B01991g       ------------------------------------------------------------
KLTH0G13112g       LTNPRH------------------------------------------------------
Kwal_56.23697      K-----------------------------------------------------------
KLLA0F19690g       ------------------------------------------------------------
SAKL0H16434g       EEEDSYRSNNKKKMLLENANTRIDYGGNVGLKPGADGIGGGFGAGINLRDKLKAGGGFGA
                                                                               

ZYRO0D06600g       --DLPTDQ----------------------------------------------------
KNAG0H03110        --ESDEDG----------------------------------------------------
TBLA0D04040        --DQGETE----------------------------------------------------
TPHA0C01070        --DAPDSP----------------------------------------------------
KAFR0B05370        --EPAGQA----------------------------------------------------
TDEL0F04130        --DQQNPN----------------------------------------------------
NCAS0B03590        --SDISED----------------------------------------------------
Kpol_1033.16       ------------------------------------------------------------
NDAI0J01000        --ITINAD----------------------------------------------------
Smik_4.372         --LTQDQH----------------------------------------------------
Skud_4.387         --PLQDQQ----------------------------------------------------
YDR126W            --PLQDQH----------------------------------------------------
Suva_2.289         --PLQDQH----------------------------------------------------
AGR065W            --VEGGDG----------------------------------------------------
Ecym_4282          --PTPSSHTS--------------------------------------------------
CAGL0B01991g       --QNGGNN----------------------------------------------------
KLTH0G13112g       --SSQGPNEF--------------------------------------------------
Kwal_56.23697      --SNEGPE----------------------------------------------------
KLLA0F19690g       --DAQTAE----------------------------------------------------
SAKL0H16434g       GLDSQDPEKLGMGGGFGAGLDYNDNFGMGGGSGGGFDYDGIDKFGGGGGGGFGLDYKDSF
                                                                               

ZYRO0D06600g       ------------------------------------------------------------
KNAG0H03110        ------------------------------------------------------------
TBLA0D04040        ------------------------------------------------------------
TPHA0C01070        ------------------------------------------------------------
KAFR0B05370        ------------------------------------------------------------
TDEL0F04130        ------------------------------------------------------------
NCAS0B03590        ------------------------------------------------------------
Kpol_1033.16       ------------------------------------------------------------
NDAI0J01000        ------------------------------------------------------------
Smik_4.372         ------------------------------------------------------------
Skud_4.387         ------------------------------------------------------------
YDR126W            ------------------------------------------------------------
Suva_2.289         ------------------------------------------------------------
AGR065W            ------------------------------------------------------------
Ecym_4282          ------------------------------------------------------------
CAGL0B01991g       ------------------------------------------------------------
KLTH0G13112g       ------------------------------------------------------------
Kwal_56.23697      ------------------------------------------------------------
KLLA0F19690g       ------------------------------------------------------------
SAKL0H16434g       NTGGGAGAGFNKRPDSAADPGFGFGGGGGTSTNVHIGEQHRKTIFDAKISMGGGAGMDYH
                                                                               

ZYRO0D06600g       ----------------------------------------------HEFFSTNPYDGRLY
KNAG0H03110        -----------------------------------------------KFYSTNAYDHTAY
TBLA0D04040        ------------------------------------------------FYSTNAYDHKKY
TPHA0C01070        ----------------------------------------------SQVYSTNFYDNKTY
KAFR0B05370        ----------------------------------------------TRFYSTNAYDHTIY
TDEL0F04130        -----------------------------------------------QFYSTNAYDSKLY
NCAS0B03590        ----------------------------------------------SVFYSTNGYDHTEY
Kpol_1033.16       ----------------------------------------------NTFYSTNIYDHTRY
NDAI0J01000        ----------------------------------------------TIFYSTNAYDHEGY
Smik_4.372         ----------------------------------------------ATFYSTNAYDHKQY
Skud_4.387         ----------------------------------------------GTFYSTNAYDHKRY
YDR126W            ----------------------------------------------VTFYSTNAYDHKHY
Suva_2.289         ----------------------------------------------VTFYSTNAYDHHRY
AGR065W            ----------------------------------------------VEFYSTNAYDHRTY
Ecym_4282          -------------------------------------TSTRTTHYQYEYYSTNPYDPKTY
CAGL0B01991g       ----------------------------------------------YEFYSTDSYDGTQY
KLTH0G13112g       -------------------------------------HLNDSSPDIYVYYSTNPYDNATY
Kwal_56.23697      --------------------------------------LTTTSPSRYTFYSTNPYDNCTY
KLLA0F19690g       ----------------------------------------------PIFYSTNLYDHSKY
SAKL0H16434g       ENTGLPSLGGGSAVEIHVNALGRELDLAKDIGGGFPGHSNVSPKKNYRFYSTNPYDDLTY
                                                                    :**: **   *

ZYRO0D06600g       RLQ--SYTLIEDAERINNIYDEGSFMANLRTLCLT------------
KNAG0H03110        TLT--NYHIVKNASEIINMYDKGSFWENFKDMCR-------------
TBLA0D04040        QLT--EYKVIDNVEDIPNIYDKGSLWKNFKDFCE-------------
TPHA0C01070        KISN-DYHIVKDASEIPNVYDRGTFLDNLKGFCNE------------
KAFR0B05370        CPV--NFRPITHHDEIPNIYDKGSFLKNLKELCKY------------
TDEL0F04130        VPQ--NYSIVNDPKDITNIYDQGSFWYKLERLCT-------------
NCAS0B03590        TLR--NFEIIEDPSRITNIYDRGDFLANLRDLCK-------------
Kpol_1033.16       SPT--QYTIINDPTDIQNIYDKGSCWLNFIDICTT------------
NDAI0J01000        HLSSDEYTIVEDPRQITNLYDSGDFFTNLKDFCYDP-----------
Smik_4.372         NLA--HYITIKDASEISNIYDKGTFLANFTDLIQ-------------
Skud_4.387         ILM--HYITIKDASEITNVYDKGTFLANFTDLIQ-------------
YDR126W            NLT--HYITIKDASEIPNIYDKGTFLANLTDLI--------------
Suva_2.289         RLK--HYTTIKDASEITNIYDKGTFLANLVDLI--------------
AGR065W            ALHNEPYAVVTSHEEIPNVYDTGSFCENLRQRLDPQARIFRRRVRGL
Ecym_4282          SLSDTSYHVVNSYQDIPNIYDRCSFWQNLKQRCVL------------
CAGL0B01991g       TIV--DYFTVKSPAEITNIYDKGNFINNLREFIG-------------
KLTH0G13112g       DVK--NPKEILSTAAITNIYDEGGFWKNLMARVDFT-----------
Kwal_56.23697      TVK--YPREIVDYEEITNIYDKGSFCNNLKDRIRR------------
KLLA0F19690g       HLI--NPAKILSHEEIINLYDRGSFLDNLKERIHLLD----------
SAKL0H16434g       HVE--DYDVIKDPKDLNNIYDKGNFWANLWDRIGK------------
                            :     : *:**      ::                  

FASTA FORMAT for MUSCLE Version 3.6

>ZYRO0D06600g
---MMLILIAALILQIAVLLISPLFKYQWPFSLYYKYVFLPLFQDNDRFRWKFYLVPLFY
SSIYLGVVHLAIKNVIPQLSPGLNFFDYWFFIPFFIVL-TPATGILAAIIGPETTKSCKR
RNID----KFRYDNLLFYPNINCRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGL
GNYLYFYLFLVLNSLSMSYAFIRSMSIVG----LKPNIKYPRSILAFNLLTGCFALICIV
FTYLQLCMVREGMTTNEKDKWFTIHEYMREKRLVK-SSSGK---WYYDLTDRL-------
------------------------------------------------------------
--DLPTDQ----------------------------------------------------
------------------------------------------------------------
----------------------------------------------HEFFSTNPYDGRLY
RLQ--SYTLIEDAERINNIYDEGSFMANLRTLCLT------------
>KNAG0H03110
--MWTQLLLILAVLQVFLLLLSPLARLQWPLSWYYEKVYRPFLADPTRYRVKYYIVPVFY
FSLYCYMLNLYRSELLPVIWGRLYFIELYFFQPLLLAA-IPVSGLLTMFTRPEGCGGRDQ
GVAP-SEGQWPYDGILYYPNTTCRSCHTVKWARSKHCSICRRCIQLADHHCIWFNTCIGR
GNFFYFYVFLACHCLILTYAFARLFFFVV---VADNKLTSTRSTLTLLMLTGTFALLVDL
FTYWQMMLVKEGMTTNEQDKWFLIHEYMRDGKCVNVSCNGSTKKWFL-------------
------------------------------------------------------------
--ESDEDG----------------------------------------------------
------------------------------------------------------------
-----------------------------------------------KFYSTNAYDHTAY
TLT--NYHIVKNASEIINMYDKGSFWENFKDMCR-------------
>TBLA0D04040
-MGFGTFLVVLVILQILILFISPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFY
ITLFIYLVINFYAKVEPLIHDKLTYFERFFFIPISIIS-TPFFGIITMLINPDTALMYSN
DSIK----KYAYDRILYFPDTECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGR
GNFLYFYLFLFDNTLFMSYASMRLLEITLN--FRRAGENVPRDVMTLDILCGCFLFICGT
FSYMQLLIVKDGMTTNEKDKWYTIQCLMEDKKLVK-SSDNN---WYISFVN---------
------------------------------------------------------------
--DQGETE----------------------------------------------------
------------------------------------------------------------
------------------------------------------------FYSTNAYDHKKY
QLT--EYKVIDNVEDIPNIYDKGSLWKNFKDFCE-------------
>TPHA0C01070
---MWFQVICLVVLQVTLLLLSPFLKNRWPFSVYYRRLYVPYLKDVNSYKWKYHVVPGFY
FSIYLYLVYCYYAKVEYLIVNHLNLFERGILLPLLIVL-TPSFGILTMVTKPINIHGNGI
SQHDKLKNKFPFDNIIYHSGNVCSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGL
GNYKYFFMFLLLNTISLSYAFLRLLHITL----SKPDVPKSKNILALCILTGSFSVICGV
FFYLQMKQVNNGMTTNETDKWYAVQELMREGKLIK-SEDNN---WFALSTE---------
------------------------------------------------------------
--DAPDSP----------------------------------------------------
------------------------------------------------------------
----------------------------------------------SQVYSTNFYDNKTY
KISN-DYHIVKDASEIPNVYDRGTFLDNLKGFCNE------------
>KAFR0B05370
-MMFRILLNIFVISQIIFLLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIFY
VTLYTYMVLLYFTKLNPIIKSQLTILERWVIIPFSLLI-SLLSGILTMRIRPESSLGFNS
SPYQ----DFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGL
GNYQYFYTFLVSNTLLLGYAFLRIILLTA-----YSDIGFPNIVLTFLILSGAFFAILLV
FTYLQFALVYDGMTTNEKDKWFTIQEFMREGRLIR-TDNGQ---WLIAHPE---------
------------------------------------------------------------
--EPAGQA----------------------------------------------------
------------------------------------------------------------
----------------------------------------------TRFYSTNAYDHTIY
CPV--NFRPITHHDEIPNIYDKGSFLKNLKELCKY------------
>TDEL0F04130
MGLFSVLLFLVVAAQIIVLLLSPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFY
LSLYCYIIFVLIRDVIPVIGNRLLSVEKLCIIPVLVVA-TPVLGWLSMTVKAKTSRGCQP
GSAQ----EYDYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGK
GNYQFFYAFLVVNVISLSYGFLRVLWISVM--KDPSMVVYPRSILIFTILCGTFAIICGV
FTYLQLQLVNDGMTTGEKDKWYTIQQIMREGNLVR-TLDGQ---FFIQ------------
------------------------------------------------------------
--DQQNPN----------------------------------------------------
------------------------------------------------------------
-----------------------------------------------QFYSTNAYDSKLY
VPQ--NYSIVNDPKDITNIYDQGSFWYKLERLCT-------------
>NCAS0B03590
--MIEYICLLLIVSQVILLLISPRYRLIWPFSVYYKKVFHPLIQDNKKFKIKFYIIPIFY
FVLYLYLIYCYYSKVAPFINNQLWAFEKYMWIPLIIIASPLIFGVFTMFTKPTYTKKYSD
EIDN----EYAFDNLIFYPQILCRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGK
GNYTYFYMFLITNTFSLTYAFIRLLTIFY-----TTNVYLPKNTLTLTILCGCFSVICGI
FTFLQLNLAQEGMTTNEKDKWFTVHEFMRDGKLVR-TQSGR---WYFADPHD--------
------------------------------------------------------------
--SDISED----------------------------------------------------
------------------------------------------------------------
----------------------------------------------SVFYSTNGYDHTEY
TLR--NFEIIEDPSRITNIYDRGDFLANLRDLCK-------------
>Kpol_1033.16
---MLIYLGGLVVIQVLLLVLSPIFKLTWPLSIYYTKFYRPFFLDKERYRWKYYLVPGLY
LGLYLFVIIYYHLRVNFMVNPHLYWFEKGLILPIMFTS-LPYFGVMTMITKPENSIEHGI
NSNN----RYRFDEILYFPNVSCKTCRKPKPARSKHCSICDKCILLQDHHCIWVNNCIGM
GNYKWFYLFIGGNSLTMIYCFTRLLFISI-----KYKVTSSRAILTMNILCGSFAIICSV
FTYLQLDLVSQGITTNEMDKWYTIHEYCRDGKLAR-SKSGN---WFLIDSN---------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------NTFYSTNIYDHTRY
SPT--QYTIINDPTDIQNIYDKGSCWLNFIDICTT------------
>NDAI0J01000
-MSWSIIVIIITIFQVILLLLSPRYKNRSPFSIYYRHVFQPIVQDSHRYRWKYHLVPFFY
LTLFIYLTYCYYTKVEPLIASQLYFIEVWIWIPFMIFS-PVIFGILTMVTIPNTVNNRRN
QEKV-LY-RYPYDEIMYYPNIECRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGE
GNYLYFYSFLLCNCITMTYSFIRLFLMYC-----QGHAPSSRNILTLLILCGSFAVICAG
FTFLQLQLVKDGMTTNEQDKWFTLQEYMRDGKLIRTKDENK---WFIANPNDDAT-----
------------------------------------------------------------
--ITINAD----------------------------------------------------
------------------------------------------------------------
----------------------------------------------TIFYSTNAYDHEGY
HLSSDEYTIVEDPRQITNLYDSGDFFTNLKDFCYDP-----------
>Smik_4.372
--MSWNVLFVLLVGVVVLILLSPVFKSTWPFSTFYRNVFQPFIADDQKYRWKFHLVPIFY
TLIYLYLVYTYHTRVEWLVRSELFLCERILVVPIITLA-PIACGILVMVTKAEDSYHHKP
GSTE----KYPYDYLLYYPVVKCSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGK
GNYLQFYLFLISNIFSLLYAFLRLWCISL-----NSKTALPRAVLTLTILCGCFTIICII
FTYLQLTIVREGMTTNEQDKWYTIQEYMREGKLVR-SLNDNCQSWFLKLTEDDTTK----
------------------------------------------------------------
--LTQDQH----------------------------------------------------
------------------------------------------------------------
----------------------------------------------ATFYSTNAYDHKQY
NLA--HYITIKDASEISNIYDKGTFLANFTDLIQ-------------
>Skud_4.387
--MLWNVLFVLLVSIVVLILFSPVFKSTWPFSTLYRRVFQPFVSDDQKYRWKFHLVPLFY
TSIYLYLVYTYHAKVEPLIKNDLFLLERILIGPIIILP-PVALGILAMVTKAEDSNVHRP
GSTE----KYPYDYLIYYPDVQCSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGK
GNYIQFYLFLISNIVSMSYAFLRLCSISL-----KSSTALPRAVLTLSILCGCFTIICAI
FTYLQLAIVREGMTTNEQDKWYTIQEYMREGKLVR-SLNDDPQSWFLKLTEKGDAAE---
------------------------------------------------------------
--PLQDQQ----------------------------------------------------
------------------------------------------------------------
----------------------------------------------GTFYSTNAYDHKRY
ILM--HYITIKDASEITNVYDKGTFLANFTDLIQ-------------
>YDR126W
--MSWNLLFVLLIGFVVLILLSPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFY
TSIYLYLVYTYHMRVESTIKNELFLLERILIVPIIILP-PVALGILAMVSRAEDSKDHKS
GSTE----EYPYDYLLYYPAIKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGK
GNYLQFYLFLISNIFSMCYAFLRLWYISL-----NSTSTLPRAVLTLTILCGCFTIICAI
FTYLQLAIVKEGMTTNEQDKWYTIQEYMREGKLVR-SLDDDCPSWFFKCTEQKDDAAE--
------------------------------------------------------------
--PLQDQH----------------------------------------------------
------------------------------------------------------------
----------------------------------------------VTFYSTNAYDHKHY
NLT--HYITIKDASEIPNIYDKGTFLANLTDLI--------------
>Suva_2.289
--MSWNALVVPLVGIVLLVLLSPVFKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFY
TSIYLYLVFTYHTRVEPLIKNELFLLERILIVPIIILP-PVVLGILAMVTKAEDSNNHKL
GSTE----KYPYDYLLYYPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGK
GNYLQFYLFLFSNIFSMSYAFLRLYFISF-----NSTAVLPRAVLTLTILCGCFTIICAI
FTYLQLAIVKEGMTTNEQDKWYTIQEYMREGKLVR-SLDDDSRSWFLKFTEKGDTGQ---
------------------------------------------------------------
--PLQDQH----------------------------------------------------
------------------------------------------------------------
----------------------------------------------VTFYSTNAYDHHRY
RLK--HYTTIKDASEITNIYDKGTFLANLVDLI--------------
>AGR065W
---MMGALCALAVTQAGLILAAPALRAYWPFSWYYHVVFRTVLQDTQRHRWKYWATPAFY
AGVYAYCVWLFYGEVYAEIAKALWVPERWVL-PAAVVA-PAAAGVAAAATPAAVPA----
--------DAAYDGLLFHDGVECRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGR
GNYGLFYLALGAHCALLTYGAVRLPLAAP-------AGRWPRALLALELLVASFAVLCVW
FTATQVALVRDGMTTNEQDKWYAVQESMREGTLVR--LRGR---FYHR------------
------------------------------------------------------------
--VEGGDG----------------------------------------------------
------------------------------------------------------------
----------------------------------------------VEFYSTNAYDHRTY
ALHNEPYAVVTSHEEIPNVYDTGSFCENLRQRLDPQARIFRRRVRGL
>Ecym_4282
-MSMLVVLWLLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFY
TGIYIYCSFVFYVHVYGEIRSGLYTLEARCL-PVVLAL-PLLSGYYTIVTSPHDTITYVG
P-------EIPFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGL
GNYQYFYLFLLSNCSMLSYATIRLSSVAP-----SGLWRSNKSFLSLMILVCCFAVISIS
FTYMQFALVRDGMTTNEKDKWYTIHKLMRNEQLLKLNNDCK---FYIRIKNS--------
------------------------------------------------------------
--PTPSSHTS--------------------------------------------------
------------------------------------------------------------
-------------------------------------TSTRTTHYQYEYYSTNPYDPKTY
SLSDTSYHVVNSYQDIPNIYDRCSFWQNLKQRCVL------------
>CAGL0B01991g
--MLLFLVFILVVSQVVLLLLSPQFRDKFIFRWYYDEVYKPMILDNSRYRIKFYVVPVFY
LSVYSYMVYIFYSRTFAIISPMLTSIETYVVIPLMLIL-PLFFGSMSMIIKPDSSNAHQI
GSEK----RYPYDNLLYFPQHECRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGM
GNYMYFYSFLCSNLLLLSYSFIRLIFIQFNKSAYNTTPTGEKSLLILSILCGSFTVILAV
YCYFVFELVNSGMTTNEKDKWQMVHDYINTGDLVR-DPEGK---YFIKY-----------
------------------------------------------------------------
--QNGGNN----------------------------------------------------
------------------------------------------------------------
----------------------------------------------YEFYSTDSYDGTQY
TIV--DYFTVKSPAEITNIYDKGNFINNLREFIG-------------
>KLTH0G13112g
-MKMGLFIWILIIPQLVLSLFSPLFRTKPVFRWYYTRVFHPIFEDVNRFRWKFRAIPAFY
LSIYAYCTFLFFKDIEGLIRSRLFGVERLLIIPVALSA-PIITGLLTIWIKPKSTYASPM
--------LDAYDELIFHSGVSCRTCKLPKFARTKHCPICDQCVQLADHHCVWANNCIGR
GNYQYFYLFLVSNVFLTNYGFLRLLFLQR--------FVHSRQLLILSILLGCFGVILAV
FSYFQFVLVRDGMTTNEENKWLVIHDMIRARQMVT-DDTGK---YYFRLLADCQEDSAES
LTNPRH------------------------------------------------------
--SSQGPNEF--------------------------------------------------
------------------------------------------------------------
-------------------------------------HLNDSSPDIYVYYSTNPYDNATY
DVK--NPKEILSTAAITNIYDEGGFWKNLMARVDFT-----------
>Kwal_56.23697
---MSLYIWAFVVVQLVLLLFSPLLRARPVFKWYYRNVFYPIFEDADKFRFKFHVVPILY
LAIYLYCCLLFFRDIEGLIHSRLYAIERWFIIPVALMT-PISCGLLTMLVKPESTYIAPP
--------VDQFDGILFHAGVECRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIGK
GNYEYFYLFLASNVFLTVYGFTRLLYLQP--------TVKSRTLLTLALLLGSFALILVI
FSYFQVVLIKDGMTTNEESKWLVVHDMMRARKLVV-DNAGK---FYYRIPENEDSLSPEL
K-----------------------------------------------------------
--SNEGPE----------------------------------------------------
------------------------------------------------------------
--------------------------------------LTTTSPSRYTFYSTNPYDNCTY
TVK--YPREIVDYEEITNIYDKGSFCNNLKDRIRR------------
>KLLA0F19690g
---MFLLFLLFVVSQVGLLVFSPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFY
ACILIFCVHLFYNKLNDTVNPYLYSLEKAFI-PITIAF-TSLTGVASVFVKPLGLQAGP-
--------QFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGY
GNYEYFYSFLLSNCLLLTYASLRLLTLFR-----ITAFKKDKFFLSLFLLTTAFSLIAIV
FTYYQLKLVNDGMTNNEQDKWYLVQEYMRNGNLVK-DMDGV---LYYRSMST--------
------------------------------------------------------------
--DAQTAE----------------------------------------------------
------------------------------------------------------------
----------------------------------------------PIFYSTNLYDHSKY
HLI--NPAKILSHEEIINLYDRGSFLDNLKERIHLLD----------
>SAKL0H16434g
---MILLFWLFVVPQIVLLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFY
TSIYIYCVLMFYKDLYRDLSPYLLFLERFLIVPLLLLG-PIITGYLCMTIEPDSTKSLAD
C-------RVPFDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGK
GNYKYFYGFLLSNVTLLSYSFLRLTSIQL---MSQTENIKTKPMLVLTILTGCFDIIVAV
FGYTQFNLVHDGMTTNEQDKWFTVQEFMRDGNLVR-DKKGH---YYFRILDESSSDRDQK
EEEDSYRSNNKKKMLLENANTRIDYGGNVGLKPGADGIGGGFGAGINLRDKLKAGGGFGA
GLDSQDPEKLGMGGGFGAGLDYNDNFGMGGGSGGGFDYDGIDKFGGGGGGGFGLDYKDSF
NTGGGAGAGFNKRPDSAADPGFGFGGGGGTSTNVHIGEQHRKTIFDAKISMGGGAGMDYH
ENTGLPSLGGGSAVEIHVNALGRELDLAKDIGGGFPGHSNVSPKKNYRFYSTNPYDDLTY
HVE--DYDVIKDPKDLNNIYDKGNFWANLWDRIGK------------