MUSCLE (3.8) multiple sequence alignment

CAGL0B01881g       ---------------MSAMLKAAFSKVRNNLFKGQLPAVA------------VDPSDFTI
ZYRO0D06886g       --------MSPLKRIRIIKMIQVWQQLKNKIIGSNPNA--------------FNLEDFNV
KNAG0H03160        ------------------MWKSVLQKLIGRGVPEAAASGSATPEY-------LNVEDFNV
KAFR0B05430        ------------------MLRSAINKIKSSFLQKNIKAAAKNN---------IKIEDFKI
TBLA0H01440        ------------------MLKA-VTSIKNKLISLKNLNSK------------ISPDDYNI
TPHA0A01730        ---------------------------MSS----------------------INPEDYNV
NDAI0J01300        MTIKSVYIFQETISLASTMIRAALTKIKSKINTYIPPIQSQTQAQSHVEHKPIHVEDYNI
NCAS0B03760        ------------------MIRAAFTKIKSKINTYIPPQQAQ-----------INVEDYNI
Kpol_543.45        ------------------MLQAVASKIKSKIFDSEPKRIE------------INPDDYNI
TDEL0F04010        ------------------MLRAALTKIKSRFASAGSSW--------------INPEDYNV
Skud_4.381         ------------------MLRAAISKIKANLTAYGAPR--------------INIEDFNI
Suva_2.281         ------------------MFRAAISKIKANLTAYGARK--------------INIEDFNI
YDR120C            --MEGFFRIPLKRANLHGMLKAAISKIKANFTAYGAPR--------------INIEDFNI
Smik_4.365         --MRSSFRIRLKRTVSYGMLKAAISKIKANFTAYGAPR--------------INIDDFNI
KLLA0F19404g       ------------------MLRAAFQSLKSKFGRKVTLDSST-----------IDVSQFKV
AGR075W            ------------------MFRAAIQKLKANFVGSPTPLASSAPASKAQ----INLAEYNV
Ecym_4296          ------------------MLRAALHKLKANLGTGSSSRNANTPSKPA-----INLSDFNV
SAKL0H16764g       ------------------MIRAALNKITKRFCRPSVTPSTTK----------INPDDYNI
KLTH0G13420g       ------------------MIRAALAKVRSRFVKPAPK---------------PDASKFTV
Kwal_56.23747      ------------------MIRAALTKVRNRFLKPVIK---------------PDADKFTI
                                                                           .:.:

CAGL0B01881g       VTEGKADILFPKQEEVFYNPIQQFNRDLSVTCIQAWDHLYGSKL-------------KSH
ZYRO0D06886g       VKEGKAEILFPKKDTVFYNPIQQFNRDLSVCCIKAWDQLYRENK-------------HKK
KNAG0H03160        VEEGKAQILFPKRETVFYNPVQQFNRDLSVTCIKAWDNLYGFPQ-------------HRQ
KAFR0B05430        VKEGSAEILFPKKEDVFYNPIQQFNRDLSVMCIKAWDKMYRQEA-------------QTK
TBLA0H01440        IKEGRAEILFPKEETVFYNPIQQFNRDLSVTCIKAWNNLYGPKA------KNNRKTVIKP
TPHA0A01730        ITEGKANILFPKTETVFYNPIQQFNRDLSVTCIKAWDNLYGSKLPPSININNKRVKNQNT
NDAI0J01300        IKEGSAEILFPKTETVFYNPVQQFNRDLSVTCIKAWSNLYGSSS----GSKNRKGRRDNN
NCAS0B03760        VKEGSAEILFSKKETVFYNPVQQFNRDLSVTCIKAWDNLYGPRS-------------NNK
Kpol_543.45        VKEGKAEILFPKKETVFYNPVQQFNRDLSVTCIKAWDNLYGPKS------SGNGKKSKKA
TDEL0F04010        VKEGKAEILFPKAETVFCNPVQEFNRDLSVCCIKAWDNLYGGQT-------KIGRKSKSN
Skud_4.381         VKEGKAEILFPKKETVFYNPVQQFNRDLSVTCIKAWDNLYGEDC-------GQKRKNKKS
Suva_2.281         VKEGKAEILFPKKETVFYNPIQQFNRDLSVTCIKAWDNLYGDEC-------GQKRRNKKG
YDR120C            VKEGKAEILFPKKETVFYNPIQQFNRDLSVTCIKAWDNLYGEEC-------GQKRNNKKS
Smik_4.365         VKEGKAEILFPRKETVFYNPIQQFNRDLSVTCIKAWDNLYGEDC-------GQKRKSKKG
KLLA0F19404g       VQEGDAKILFPNKETVFYNPIQQFNRDLSVTCIKAWDELYQEEQ------RESRELKSKN
AGR075W            VSEGKAQILFPEKETVFYNPIQQFNRDLSVTCIKAWDNLYGSKA-------IRGKRVGSN
Ecym_4296          VTEGKAQILFPEKETVFYNPVQQFNRDLSITCIKAWDNLYGTTN------DGNSTKASYT
SAKL0H16764g       ITEGKAHILFPEKETVFYNPIQQFNRDLSVTCIKAWDNLYGNLK------------QTRK
KLTH0G13420g       VTEGKAHILFPEKETVFYNPIQQFNRDLSVSCIKAWDNLYGQAK---------QEKSRGK
Kwal_56.23747      VTEGKAHILFPEKETVFYNPIQQFNRDLSVSCIKAWDNLYGQPK---------QERSKSK
                   : ** * ***.  : ** **:*:******: **:**. :*                    

CAGL0B01881g       RQRK------RTSSEPEAKRRKLDPKDEEH--------------RYITILEALSATGLRA
ZYRO0D06886g       GSKR------SSEDEPLEKRRKINTDNDDR--------------RYMRILEALSATGLRA
KNAG0H03160        GPSR--------------KRRKTADGSTRATGE-----------RYMRILEALSATGLRA
KAFR0B05430        GNKR------SKSSRFTSKKRKLEDGSTITEEIKEQDPE-----KYMRILEALSATGLRA
TBLA0H01440        SHKRANEDS-DSDDQTSIKHRKLEDGSVQVETFVHRK-------PYLKILEALSATGLRA
TPHA0A01730        EKENDEP---VANEEITAKSRKLEDGSRGDVKDEIKRENKKETIPYIKILEALSATGLRA
NDAI0J01300        KKKRTSSEKDQEQKDDDLKRRKLSNGNVEITTTGIPTK------PYIKILEALSATGLRA
NCAS0B03760        TQKKI---------QHMDKRRKLNNSSAKNARSDND--------SYLNILEALSATGLRA
Kpol_543.45        QNKRS-----IEEDEDIAKIRRLADGSKQEISTSKHA-------PYLKILEALSATGLRA
TDEL0F04010        SRKRSNT---GEDDGTCEKRRKLDDKSAERNVP-----------SYMRILEALSATGLRA
Skud_4.381         KKKRP-----AQNSDDSSKRQKMDNGSSKEIFEEANKKT-----PYINILEALSATGLRA
Suva_2.281         KKKRT-----AQNSDDSSKRQKMEDGSSREIAEDSRTKT-----PYINILEALSATGLRA
YDR120C            KKKRC-----AETNDDSSKRQKMGNGSPKEAVGNSNRNE-----PYINILEALSATGLRA
Smik_4.365         KKKRC-----AENNDDSSKRQKTENGSPKETVENFNKKE-----PYINILEALSATGLRA
KLLA0F19404g       KKRKPIESNEDGSDYDTIKRRKLNEDQDSVAVSSKDHSTR----PYIKILEALSATGLRA
AGR075W            GKRSF-----DGTDQEATKKRKLAASKEAVDPTGSGSDDPG---RYIKVLEALSATGLRA
Ecym_4296          NNKRSF----DGIESGSTKKRRITDGAGNDGAIKSNSPPGL---PYMRILEALSATGLRA
SAKL0H16764g       GRKRSL----QSPGEESSKKRKLEDGSAETQTSSR---------PYIKILEALSATGLRA
KLTH0G13420g       GKKRG-----LEHGEEASKKRKLEDGSSAEVKASSSR-------PYIKILEALSATGLRA
Kwal_56.23747      GKKRG-----MDESEESSKKRKLDDGSASHVKAANR--------PYIKILEALSATGLRA
                                     * ..                       *: :***********

CAGL0B01881g       IRYAKEIPHVKEIIANDLLPAAVKSIQRNIDYNGVQDIVTANQDDANVLMYRNKSDNKKY
ZYRO0D06886g       IRYAHEIPRVKKIVANDLLPEAVESIRRNAEYNHVEELVEPNTDDANVLMYRNKALNQKY
KNAG0H03160        IRYANELPHIQKVVANDLLPAAVESIARNARYNGTQQLVQANEDDANVLMHRETAQGRKF
KAFR0B05430        IRYAKEIPNVKELVANDLIPAAVDSIQRNISFNEVDHLVKANLDDANALLYREKGQNNRF
TBLA0H01440        IRYAKEIPNVKEIVANDLLPEAVESIRRNAQYNNVLDIVKPNQDDANVLMYRNKAQNKKY
TPHA0A01730        IRYAHEIPNVKEIIANDLLPAAVDSIKRNVEYNKVEAIVKPNIDDANILMYRNMASNTKY
NDAI0J01300        IRYANEIPHVKEIIANDLLPAAVESISRNAQFNNVSHIVKPNLDDANVLMYRNKAENNKY
NCAS0B03760        IRYANEIPHIKEIVANDLLPAAVESINRNAQYNNVEDKVTGNLDDANVLMYRNKAQGTKY
Kpol_543.45        IRYAHEIPNVKEIVANDLLPEAVDSIRRNAEYNKVENIVKPNIDDANVLMYRNKSTNTRY
TDEL0F04010        IRYAHEIPHVKEIVANDLLPEAIESIKRNVQFNGVENIVKPNLDDANVLMYRNKSENVKY
Skud_4.381         IRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDDANVLMYRNKAINNKF
Suva_2.281         IRYAHEIPHVKQVIANDLLPDAVESIKRNVEYNNVESIVKPNLDDANVLMYRNKATNNKF
YDR120C            IRYAHEIPHVREVIANDLLPEAVESIKRNVEYNSVENIVKPNLDDANVLMYRNKATNNKF
Smik_4.365         IRYAHEIPHVREVIANDLLPDAVESIKRNVEYNNVENIVKPNLDDANVLMYRNKATNNKF
KLLA0F19404g       IRYSKEVPNVKTIVANDLLPEAVESIKRNVIYNEVSDKVVPNLDDANVLMYRNKSKNEKY
AGR075W            IRYAHEIPHVKNIVANDLLPEAVDSIRRNIDYNHLSHLITANQDDANVLMYRSKAEGKKF
Ecym_4296          IRYAHEIPNAKQIVANDLLADAVESIKRNVQFNDVSNIVTPNKDDANVLMYRTKSEGGKF
SAKL0H16764g       IRYAHEISNVKEIVANDLLPAAVESIKKNVEYNKVEKIVKPNLDDANVLMYRNKSTNTRY
KLTH0G13420g       IRYAHEIPNVKEVVANDLLPEAVDAIQRNVDYNKVGHIVKPNIDDANVLMYRNKAAHKRY
Kwal_56.23747      IRYAHEIPNVKEVIANDLLPEAVEAIQRNVDYNDVGHIVKPNIDDANVLMYRNKANHKKY
                   ***::*:.. . ::****:. *:.:* .*  :*     :  * **** *::*  .   .:

CAGL0B01881g       HVIDLDPYGTVTPFIDAALQSIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHD
ZYRO0D06886g       HVIDLDPYGTVTPFIDSSLQAIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHE
KNAG0H03160        HVVDLDPYGTVTPFVDAAVQSVEDGGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHE
KAFR0B05430        HVIDLDPYGTVTPFIDAALQNIEENGLLLVTCTDLSVLAGNGYPEKCFALYGGVNMVNHE
TBLA0H01440        HIIDLDPYGTVTPFVDAAFQNIEDDGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMISHE
TPHA0A01730        HVIDLDPYGTATPFVDAALHSIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHE
NDAI0J01300        HIIDLDPYGTVTPFVDSALQTIEEDGMMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHE
NCAS0B03760        HVIDLDPYGTVTPFVDAALQSIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGGVNLVSHE
Kpol_543.45        HVIDLDPYGTVTPFVDAALQTIEDDGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHE
TDEL0F04010        HVIDLDPYGTVTPFVDAALQSIEENGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHE
Skud_4.381         HVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGGANMVSHE
Suva_2.281         HVIDLDPYGTVTPFVDAAIQNIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHE
YDR120C            HVIDLDPYGTVTPFVDAAIQSIEEGGLMLVTCTDLSVLAGNGYPEKCFALYGGANMVSHE
Smik_4.365         HVIDLDPYGTVTPFVDAAIQNIEEGGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHE
KLLA0F19404g       HVIDLDPYGTVTPFVDASMQSIEDGGLMLVTCTDLSVLAGNGYPEKCFALYSGVNMAGHD
AGR075W            HVIDLDPYGTATPFIDASLQSIEEGGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMAGHD
Ecym_4296          HVIDLDPYGTATPFIDSSMQCIEDGGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMAGHD
SAKL0H16764g       HVIDLDPYGTATPFIDAAMQTIDDEGLMLVTCTDLSVLAGNGYPEKCFALYGGTNLAGHD
KLTH0G13420g       HVIDLDPYGTATPFIDAALQNIEDDGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMAGHD
Kwal_56.23747      HVIDLDPYGTATPFIDAALQNIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMAGHD
                   *::*******.***:*::.: ::: *::***********************.*.*: .*:

CAGL0B01881g       ATHESALRLVLNLLNQSAAKYKKHVEPLLSLSIDFYVRVFVKVKTSPIKVKELQSNTMIT
ZYRO0D06886g       ATHESALRLVLHQLGQSAAKYKKTVEPLLSLSIDFYVRVFVRIRTSPIEVKNLQANTMTV
KNAG0H03160        ATHESALRLVVQLLAATAAKYKKNVEPLLCLSIDFYVRVFVRVTTSPLAVKNLQSNTMVT
KAFR0B05430        ATHESALRLVLNLINQTAAKYKKTVTPLLSLSIDFYVRVFVQVKTSPIEVKSLQSKTMIT
TBLA0H01440        ATHESALRLVLNLLGQTAAKYKKSIEPLLSLSIDFYVRVFIKVKTSPIKVKDLQSNTMIT
TPHA0A01730        ATHESALRLVLNLLSQSAAKYKKTITPVLSLSIDFYVRVFVKVKTSPINVKNLMSNTMIT
NDAI0J01300        STHESALRLVLNLLNQSAAKYKKVVEPLLCLSIDFYVRVFVKVRTSPIEVKELQSKTMIT
NCAS0B03760        ATHESALRLVINLLNQSAAKYKKVVEPLLCLSIDFYVRVFVKVRTSPIEVKQLQSNTMVT
Kpol_543.45        ATHESALRLVLNLLSQSAAKYKKTIEPLLSLSIDFYVRVFIKVKTSPINVKNLQSNTMIT
TDEL0F04010        STHESALRLVLNLLSQSAAKYKKTVEPLLCLSIDFYVRVFVKVKTSPIEVKNLQSKTMTT
Skud_4.381         STHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVRTSPIEVKNLMSNTMTT
Suva_2.281         STHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVKTSPIEVKNVMSNTMTT
YDR120C            STHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVKTSPIEVKNVMSSTMTT
Smik_4.365         STHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFIKVRTSPIEVKNLMSNTMTT
KLLA0F19404g       ATHESALRLVLNLLGQSAAKYKKTIEPLLSLSIDFYVRVFIRVKTSPIEVKNLQSNTMVG
AGR075W            ATHESALRLVLNLLSQSAAKQKKYIEPLLSLSIDFYVRVFVRVRTSPSEVKNLQHNTMIG
Ecym_4296          ATHESAIRLVLNLLGSSAAKYKKSIEPLLSLSIDFYIRVFIRVRTSPTEVKNLQNNTMTG
SAKL0H16764g       ATHESALRLVLNLLGQSAAKYKKSIEPLLSLSIDFYVRVFIKVRTNPTEVKNLQHNTMVT
KLTH0G13420g       ATHESALRLVLNLLGQSAAKYKKSIEPLLSLSIDFYVRVFVKVKTNPTKVKDLQHNTMIT
Kwal_56.23747      ATHESALRLVLNLLSQSAAKYKKTVEPLLSLSIDFYVRVFVKVKTNPTLVKNLQHNTMVT
                   :*****:***:: :  :*** ** : *:*.******:***:.: *.*  **.:  .**  

CAGL0B01881g       YHCSQCGSFANQKLGRKVDKQSRK-KKQQTITKFSVAQGPPIDSKCQFCGGTSLLAGPMY
ZYRO0D06886g       YHCSQCGSFHEQPLGRTSEKVTKK-NQPIK--KYSVAQGPPVDSKCKFCDGTYHLAGPMY
KNAG0H03160        YHCSQCGSVHNQFLGRISEREGKK-GKTIV--KYSVAQGPPVDRRCQFCGGAFHLAGPMY
KAFR0B05430        YHCTQCGSYHNQPLGRKSEVESKK-KKNITQFKYSVAQGPPVDRKCRYCQGTYHLAGPMY
TBLA0H01440        YHCSNCGSFANQPLGRKSEKVGKKSSKPYV--KFAPASGPPVNEKCQFCDGTFHLAGPMY
TPHA0A01730        YHCTQCGSYHNQSLGRVEERTTKK-EKVFK--KYLVAKGPPVDSKCKFCGGTYHIAGPMY
NDAI0J01300        YHCSQCGSYHNQPLGRMIEREGKN-GKTFT--KYLVAQGPPVDSKCKFCRGTYHVAGPMY
NCAS0B03760        YHCSQCGSLENQHLGRMLEREGKN-GKKYI--KYAVAQGPPVDTKCKFCQGTYHVAGPMY
Kpol_543.45        YHCSQCGSYHNQHLGRIQERSGKN-GKPFK--KYLVAQGPPVDSKCKFCKGTYHLAGPMY
TDEL0F04010        YHCSQCGSYHNQPLGRATERLNNK-QKKSI--KYSVAQGPPVDSKCKFCGGTYHLAGPMY
Skud_4.381         YHCSRCGSYHNQPLGRVSQREGKK-SKTFT--KYSVAQGPPVDIRCRFCDGTYHLAGPMY
Suva_2.281         YHCSRCGSYHNQPLGRISQREGKK-NKTFT--KYSVAQGPPVDTRCKFCGGTYHLAGPMY
YDR120C            YHCSRCGSYHNQPLGRISQREGRN-NKTFT--KYSVAQGPPVDTKCKFCEGTYHLAGPMY
Smik_4.365         YHCSRCGSYHNQPLGRISQREGKK-NKTFT--KYSVAQGPPVDTKCKFCEGTYHLAGPMY
KLLA0F19404g       YMCSGCNAYHTQPLGRQQERTTKK-GVKFT--KFSLAQGPPVDRNCSYCGSVHHIVGPMY
AGR075W            YMCSGCSAWHTQRLGKQSQRASKK-GKPYT--KYSLAQGPPADKRCHYCGSPHHVFGPMY
Ecym_4296          YMCSGCGSYHTQRLGKQSERVSKK-GKAFI--KYSLAQGPPVDRNCKYCRAVHHVVGPMY
SAKL0H16764g       YMCSGCGSYHNQRLGRQTKRESKK-GKEYL--KYSLAQGPPVNVRCNFCGGAHHIVGPMY
KLTH0G13420g       YVCSGCRSYHSQRLGKQTERESKK-GKPYL--KYSLAQGPPVDKKCHYCGGAHHLTGPMY
Kwal_56.23747      YVCSGCRSYHNQRLGKQSQRESKK-GKPYL--KYSLAQGPPVDKKCQFCGGSHHITGPMY
                   * *: * :   * **.  .   .:        *:  *.*** : .* :* .   : ****

CAGL0B01881g       AGPLHNHEFIEEVLKINEKRFKEKDT---VYGTKERIKGMLTLAKNELNHDGSQFYFSPN
ZYRO0D06886g       GGPLHNKEFIEKVLQVNANH---DDD---TYGTRRRIEGMLALAQNEIPN--APFYFSPN
KNAG0H03160        GGPLHNREFIEEVLRINSEEH--TDS---TYKTRKRIEGMATLALNELPQ--APFYFSPN
KAFR0B05430        AGPLHNEEFVKEVLKINKEDEKKQED---IYGTHKRIEGMLTLALNEVAD--SPFYFSPN
TBLA0H01440        AGSLHNDEFVKEVLRINKEEHSKKKEFEGVYGTTKRIEGMVTLAAQELKD--APFYFSPN
TPHA0A01730        AGPLHDENFINEILRINEEDH--TDD---TYGTRKRIEGMVTLAKNELKN--SPFYFSPN
NDAI0J01300        AGKLHNQEFIDEVLRINREEH--KDD---TYGTRKRIEGMVTLAKNELSN--APFYFSPN
NCAS0B03760        AGPLHNKKFIEEVLRINNDEH--IDE---IYGTRKRIEGMLTLAQNELDD--APFYFSPN
Kpol_543.45        AGALHNKEFLDEVLRINKVEHANMGD---VYGTRKRIEGMVTLASKELAD--APFYFSPN
TDEL0F04010        GAPLHNQEFIDEVLRINREEH--TDD---TYGTRKRIEGMLTLAKSEIPD--APFYFSPN
Skud_4.381         AGPLHNKEFIEEVLRINKEEHHDQDD---TYGTRKRIEGMLSLAKNELSD--SPFYFSPN
Suva_2.281         AGPLHNKEFIEEVLRINNEEHHGRDD---TYGTRKRIEGMLSLAKNELSD--SPFYFSPN
YDR120C            AGPLHNKEFIEEVLRINKEEHRDQDD---TYGTRKRIEGMLSLAKNELSD--SPFYFSPN
Smik_4.365         AGPLHNKEFIEEVLRINKEEHRDKDD---TYGTRKRIEGMLSLAKNELSD--APFYFSPN
KLLA0F19404g       GGPLHNKKFIDRVLRINKEEH--KDD---IYGTRKRIEGMLTLAKNEI-A--APFYFTPN
AGR075W            AGPLHNHEFIDEVLRINEEEH--QDD---IYGTRKRIKGMLTLARNELPE---PFYFVPT
Ecym_4296          AGTLHNQQFLDEVLRINREEH--NDE---VYGTRKRIEGMLTLAKNEL-N--VPFYFSPN
SAKL0H16764g       AGSLHNKEFINEVLRINKEEH--GDE---VYGTRKRIEGMLTLARNEL-E--TPFYFTPN
KLTH0G13420g       AGPLHNREFIDEVLRINRDVH--GDD---VYKTRKRIEGMLTLAKNEV-D--APFYFTPN
Kwal_56.23747      AGPLHNREFIDEVLRINSEVH--DDD---VYKTRKRIEGMLTLAKNEV-D--APFYFTPN
                   .. **: :*:. :*.:*             * *  **:** :** .*:      *** *.

CAGL0B01881g       TLSSLIKLQVPALKTIAAGLGSLGFECSLTHAQPSTIKTNAPWDAIWYVMKKCH----EN
ZYRO0D06886g       HLSSILKLQVPPLKKIVAGLGSLGYECSLTHAQPSSIKTDAPWEAIWYVVAHSD------
KNAG0H03160        MVSSVLKLQVPPLKTVAAGLGSLGYNCSLTHAQPSSLKTDAPWEAIWYTLSKCA------
KAFR0B05430        HVSSILKLQVPQMKKVIAGLGSLGFQCSLTHAQPSSIKTNAPWEAIWYVMRQCD------
TBLA0H01440        NVSSIIKLQVPPLKRIVAGLGSLGYQSSLSHAKHSCLKTNAPWEAIWYVMRESQKIDFPD
TPHA0A01730        NLSSILKLQVPPLKRIVAGLGSLGYNCSLTHAQPSSLKSDAPWEAIWYVMKESD------
NDAI0J01300        KIASIIKLQVPPLKTVVAGLGSLGYNCSLTHAQPSSLKTNAPWEVIWYVMKQFD------
NCAS0B03760        KISSIIKLQVPPLKKVVAGLGSLGYDCSLTHAKPSSLKTNAPWEAVWYVLSKCD------
Kpol_543.45        NISSILKLQVPPLKKVVAGLGSLGYNCSLSHAQPSSLKTDAPWEAIWYVMKECD------
TDEL0F04010        HISSILKLQVPPLKRVVAGLGSLGYDCSLTHAQPSSLKTNAPWEAIWYVMKQCE------
Skud_4.381         HIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQKCD------
Suva_2.281         HIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQKCD------
YDR120C            HIASVIKLQVPPLKKVVAGLGSLGFECSLTHAQPSSLKTNAPWDAIWYVMQKCD------
Smik_4.365         HIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMEKCD------
KLLA0F19404g       SVSSVLKFQVPTLKAVVAGLGSLGFECSLTHAKASSLKTDASWDAIWYVMKKYC------
AGR075W            SISSILKFQVPPLKTVVAGLGSLGYACSLTHAKASSLKTNAPWDAIWYVMKRYC------
Ecym_4296          SLSSILKFQVPPLKTIVAGLGSLGYTSSLTHAKASSLKTDAPWDAVWYVMKKYC------
SAKL0H16764g       RVSSVLKFQVPSLKTVVAGLGSLGYECSLTHAQPSSLKTNAPWETIWYVMKKYC------
KLTH0G13420g       RVSSILKFQVPSLKTVVAGLGSLGYECSLTHAQPSSLKTDAPWGAIWYVMKRYC------
Kwal_56.23747      RVSSILKFQVPSLKTVVAGLGSLGYECSLTHAQPSSLKTDAPWDAIWYVMKRYC------
                    ::*::*:*** :* : *******: .**:**: * :*::*.* .:**.:          

CAGL0B01881g       KEDYQGRNLEDMPEKGIGYRILKYLEDNKEHYDQL-------------------------
ZYRO0D06886g       -DQL---HNKKLKENSIGHRILNNMKSWSKDQ----------------------------
KNAG0H03160        -PEGR--DFTKLNERTPGYKILSRIDQWMAARPED-------------------------
KAFR0B05430        -SEK---DVSRMNPNTAGYKILSTMSSWLPSPSDEI---------------------KSS
TBLA0H01440        IDMNK--KLSKMNKNTAGYKILSKMNEWLPKEEDSIAKENKNADEKPKKDYGEIDYSRKN
TPHA0A01730        -EERKNRDVDAMNHNTVGYRILNNIDKWISKEEQD-----------------------T-
NDAI0J01300        -DSKK--DISKMNHNTTGYKILSSIDAWEPKENIC-------------------------
NCAS0B03760        -DTNK--DISKMNPNTAGYKILSTIDEWLPKTPNE-----------------------KN
Kpol_543.45        -DKEV--NLEKMNPNTAGYKILSTFDQWMPEEEDG-----------------------RE
TDEL0F04010        -EQK---DLQKMNQNSTGYKILSTEDRWLSDENRE-------------------------
Skud_4.381         -DEKK--DLSKMNPNTTGYKILSAMPKWLSDDIKS-----------------------E-
Suva_2.281         -DEKK--DLSKMNPNTTGYKILSAMPKWLSEDVKS-----------------------E-
YDR120C            -DEKK--DLSKMNPNTTGYKILSAMPGWLSGTVKS-----------------------E-
Smik_4.365         -DEKK--DLSKMNPNTTGYKILSTMPKWLNDDVKS-----------------------E-
KLLA0F19404g       -IDNNLVNIEKMNKNGNGYKILT--NDTIGQTED--------------------------
AGR075W            -LDNELADIKKMNQNGFGYKILT--NESIDGSTDE-------------------------
Ecym_4296          -LDNDLVDINKMNTNGRGYKILT--NDQICGSEHM-------------------------
SAKL0H16764g       -TDNKLCNLEKMNKNSFGYKILT--NDEIGSKDSE-------------------------
KLTH0G13420g       -LDNGLCNVEKMNQNSWGYKILS--NDLVAEAAQ--------------------------
Kwal_56.23747      -LDNDLCNVEKMNQNSWGYKILT--NDAVSDQDK--------------------------
                              :  .  *:.**.                                     

CAGL0B01881g       ---YGEKLSFAPNETSGSIEKLRKLKIVRYQENPTKNWGPKARPSGKET-----
ZYRO0D06886g       ---DFKTLSYEPNDQSGKVESLRKLKIVRYQENPTKNWGPKARPTSS-------
KNAG0H03160        -SFDPEQLSFEPNEQSGKIESLRKLKIVRYQENPTKNWGPKARPQSS-------
KAFR0B05430        VFFDSSKLSFEENEQSGNVEKLRKLKIVRYQENPTKNWGPKARPNPSTKPSPQK
TBLA0H01440        NSFDITKLSFEPNEQSNKVEGLRHLKMVRYQENPTKNWGPKARPNSS-------
TPHA0A01730        ---INEKLNFEPNEQSGKIEKLRKLKIVRYQENPTKNWGPKARPNSS-------
NDAI0J01300        ---DISKLSFEPNEESKHLEKLRKLKIVRYQENPTKNWGPKARPNSS-------
NCAS0B03760        SNLDITKLTFEPNEQSEHLEKLRKLKIVRYQENPTKNWGPKARPNLS-------
Kpol_543.45        PMFKKSDLSFKENEQSGAVEKLRKLKIVRYQENPTKNWGPKARPNSS-------
TDEL0F04010        ---AFKKLSFEPNEQSGQVEKLRKLKIVRYQENPSKNWGPKARPNTK-------
Skud_4.381         ---YDLRLSFTPNEQSGNIEKLRKLKIVRYQENPTKNWGPKARPNAS-------
Suva_2.281         ---YDSKLSFTPNEESGSIEKLRKLKIVRYQENPTKNWGPKARPNAS-------
YDR120C            ---YDSKLSFAPNEQSGNIEKLRKLKIVRYQENPTKNWGPKARPNTS-------
Smik_4.365         ---YESKLSFASNEQSGSIEKLRKLKIVRYQENPTKNWGPKARPNTS-------
KLLA0F19404g       ---WDKKISFEPNEYSGRFEKLRKLKIVRYQENPTKNWGPKARPQ---------
AGR075W            ---WAEKLSFSPNQQSIDLERLRKLKIVRYQENPTKNWGPKARPQ---------
Ecym_4296          ---WDEKLSFDPNEQSGKVEKLRKLKMVRYQENPTKNWGPKAKPQ---------
SAKL0H16764g       -----SKLSFEPNDQSGRVEKLRKLKIVRYQENPTKNWGPKARPQ---------
KLTH0G13420g       ---YGDQLSFEPNDQSGRVEKLRKLKIVRYQENPTKNWGPKARPQ---------
Kwal_56.23747      ---YKEMLSFEPNEQSGKVEKLRKLKIVRYQENPTKNWGPKSRPQ---------
                          :.:  *: *  .* **:**:*******:******:.*          

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0B01881g
---------------MSAMLKAAFSKVRNNLFKGQLPAVA------------VDPSDFTI
VTEGKADILFPKQEEVFYNPIQQFNRDLSVTCIQAWDHLYGSKL-------------KSH
RQRK------RTSSEPEAKRRKLDPKDEEH--------------RYITILEALSATGLRA
IRYAKEIPHVKEIIANDLLPAAVKSIQRNIDYNGVQDIVTANQDDANVLMYRNKSDNKKY
HVIDLDPYGTVTPFIDAALQSIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHD
ATHESALRLVLNLLNQSAAKYKKHVEPLLSLSIDFYVRVFVKVKTSPIKVKELQSNTMIT
YHCSQCGSFANQKLGRKVDKQSRK-KKQQTITKFSVAQGPPIDSKCQFCGGTSLLAGPMY
AGPLHNHEFIEEVLKINEKRFKEKDT---VYGTKERIKGMLTLAKNELNHDGSQFYFSPN
TLSSLIKLQVPALKTIAAGLGSLGFECSLTHAQPSTIKTNAPWDAIWYVMKKCH----EN
KEDYQGRNLEDMPEKGIGYRILKYLEDNKEHYDQL-------------------------
---YGEKLSFAPNETSGSIEKLRKLKIVRYQENPTKNWGPKARPSGKET-----
>ZYRO0D06886g
--------MSPLKRIRIIKMIQVWQQLKNKIIGSNPNA--------------FNLEDFNV
VKEGKAEILFPKKDTVFYNPIQQFNRDLSVCCIKAWDQLYRENK-------------HKK
GSKR------SSEDEPLEKRRKINTDNDDR--------------RYMRILEALSATGLRA
IRYAHEIPRVKKIVANDLLPEAVESIRRNAEYNHVEELVEPNTDDANVLMYRNKALNQKY
HVIDLDPYGTVTPFIDSSLQAIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHE
ATHESALRLVLHQLGQSAAKYKKTVEPLLSLSIDFYVRVFVRIRTSPIEVKNLQANTMTV
YHCSQCGSFHEQPLGRTSEKVTKK-NQPIK--KYSVAQGPPVDSKCKFCDGTYHLAGPMY
GGPLHNKEFIEKVLQVNANH---DDD---TYGTRRRIEGMLALAQNEIPN--APFYFSPN
HLSSILKLQVPPLKKIVAGLGSLGYECSLTHAQPSSIKTDAPWEAIWYVVAHSD------
-DQL---HNKKLKENSIGHRILNNMKSWSKDQ----------------------------
---DFKTLSYEPNDQSGKVESLRKLKIVRYQENPTKNWGPKARPTSS-------
>KNAG0H03160
------------------MWKSVLQKLIGRGVPEAAASGSATPEY-------LNVEDFNV
VEEGKAQILFPKRETVFYNPVQQFNRDLSVTCIKAWDNLYGFPQ-------------HRQ
GPSR--------------KRRKTADGSTRATGE-----------RYMRILEALSATGLRA
IRYANELPHIQKVVANDLLPAAVESIARNARYNGTQQLVQANEDDANVLMHRETAQGRKF
HVVDLDPYGTVTPFVDAAVQSVEDGGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHE
ATHESALRLVVQLLAATAAKYKKNVEPLLCLSIDFYVRVFVRVTTSPLAVKNLQSNTMVT
YHCSQCGSVHNQFLGRISEREGKK-GKTIV--KYSVAQGPPVDRRCQFCGGAFHLAGPMY
GGPLHNREFIEEVLRINSEEH--TDS---TYKTRKRIEGMATLALNELPQ--APFYFSPN
MVSSVLKLQVPPLKTVAAGLGSLGYNCSLTHAQPSSLKTDAPWEAIWYTLSKCA------
-PEGR--DFTKLNERTPGYKILSRIDQWMAARPED-------------------------
-SFDPEQLSFEPNEQSGKIESLRKLKIVRYQENPTKNWGPKARPQSS-------
>KAFR0B05430
------------------MLRSAINKIKSSFLQKNIKAAAKNN---------IKIEDFKI
VKEGSAEILFPKKEDVFYNPIQQFNRDLSVMCIKAWDKMYRQEA-------------QTK
GNKR------SKSSRFTSKKRKLEDGSTITEEIKEQDPE-----KYMRILEALSATGLRA
IRYAKEIPNVKELVANDLIPAAVDSIQRNISFNEVDHLVKANLDDANALLYREKGQNNRF
HVIDLDPYGTVTPFIDAALQNIEENGLLLVTCTDLSVLAGNGYPEKCFALYGGVNMVNHE
ATHESALRLVLNLINQTAAKYKKTVTPLLSLSIDFYVRVFVQVKTSPIEVKSLQSKTMIT
YHCTQCGSYHNQPLGRKSEVESKK-KKNITQFKYSVAQGPPVDRKCRYCQGTYHLAGPMY
AGPLHNEEFVKEVLKINKEDEKKQED---IYGTHKRIEGMLTLALNEVAD--SPFYFSPN
HVSSILKLQVPQMKKVIAGLGSLGFQCSLTHAQPSSIKTNAPWEAIWYVMRQCD------
-SEK---DVSRMNPNTAGYKILSTMSSWLPSPSDEI---------------------KSS
VFFDSSKLSFEENEQSGNVEKLRKLKIVRYQENPTKNWGPKARPNPSTKPSPQK
>TBLA0H01440
------------------MLKA-VTSIKNKLISLKNLNSK------------ISPDDYNI
IKEGRAEILFPKEETVFYNPIQQFNRDLSVTCIKAWNNLYGPKA------KNNRKTVIKP
SHKRANEDS-DSDDQTSIKHRKLEDGSVQVETFVHRK-------PYLKILEALSATGLRA
IRYAKEIPNVKEIVANDLLPEAVESIRRNAQYNNVLDIVKPNQDDANVLMYRNKAQNKKY
HIIDLDPYGTVTPFVDAAFQNIEDDGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMISHE
ATHESALRLVLNLLGQTAAKYKKSIEPLLSLSIDFYVRVFIKVKTSPIKVKDLQSNTMIT
YHCSNCGSFANQPLGRKSEKVGKKSSKPYV--KFAPASGPPVNEKCQFCDGTFHLAGPMY
AGSLHNDEFVKEVLRINKEEHSKKKEFEGVYGTTKRIEGMVTLAAQELKD--APFYFSPN
NVSSIIKLQVPPLKRIVAGLGSLGYQSSLSHAKHSCLKTNAPWEAIWYVMRESQKIDFPD
IDMNK--KLSKMNKNTAGYKILSKMNEWLPKEEDSIAKENKNADEKPKKDYGEIDYSRKN
NSFDITKLSFEPNEQSNKVEGLRHLKMVRYQENPTKNWGPKARPNSS-------
>TPHA0A01730
---------------------------MSS----------------------INPEDYNV
ITEGKANILFPKTETVFYNPIQQFNRDLSVTCIKAWDNLYGSKLPPSININNKRVKNQNT
EKENDEP---VANEEITAKSRKLEDGSRGDVKDEIKRENKKETIPYIKILEALSATGLRA
IRYAHEIPNVKEIIANDLLPAAVDSIKRNVEYNKVEAIVKPNIDDANILMYRNMASNTKY
HVIDLDPYGTATPFVDAALHSIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHE
ATHESALRLVLNLLSQSAAKYKKTITPVLSLSIDFYVRVFVKVKTSPINVKNLMSNTMIT
YHCTQCGSYHNQSLGRVEERTTKK-EKVFK--KYLVAKGPPVDSKCKFCGGTYHIAGPMY
AGPLHDENFINEILRINEEDH--TDD---TYGTRKRIEGMVTLAKNELKN--SPFYFSPN
NLSSILKLQVPPLKRIVAGLGSLGYNCSLTHAQPSSLKSDAPWEAIWYVMKESD------
-EERKNRDVDAMNHNTVGYRILNNIDKWISKEEQD-----------------------T-
---INEKLNFEPNEQSGKIEKLRKLKIVRYQENPTKNWGPKARPNSS-------
>NDAI0J01300
MTIKSVYIFQETISLASTMIRAALTKIKSKINTYIPPIQSQTQAQSHVEHKPIHVEDYNI
IKEGSAEILFPKTETVFYNPVQQFNRDLSVTCIKAWSNLYGSSS----GSKNRKGRRDNN
KKKRTSSEKDQEQKDDDLKRRKLSNGNVEITTTGIPTK------PYIKILEALSATGLRA
IRYANEIPHVKEIIANDLLPAAVESISRNAQFNNVSHIVKPNLDDANVLMYRNKAENNKY
HIIDLDPYGTVTPFVDSALQTIEEDGMMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHE
STHESALRLVLNLLNQSAAKYKKVVEPLLCLSIDFYVRVFVKVRTSPIEVKELQSKTMIT
YHCSQCGSYHNQPLGRMIEREGKN-GKTFT--KYLVAQGPPVDSKCKFCRGTYHVAGPMY
AGKLHNQEFIDEVLRINREEH--KDD---TYGTRKRIEGMVTLAKNELSN--APFYFSPN
KIASIIKLQVPPLKTVVAGLGSLGYNCSLTHAQPSSLKTNAPWEVIWYVMKQFD------
-DSKK--DISKMNHNTTGYKILSSIDAWEPKENIC-------------------------
---DISKLSFEPNEESKHLEKLRKLKIVRYQENPTKNWGPKARPNSS-------
>NCAS0B03760
------------------MIRAAFTKIKSKINTYIPPQQAQ-----------INVEDYNI
VKEGSAEILFSKKETVFYNPVQQFNRDLSVTCIKAWDNLYGPRS-------------NNK
TQKKI---------QHMDKRRKLNNSSAKNARSDND--------SYLNILEALSATGLRA
IRYANEIPHIKEIVANDLLPAAVESINRNAQYNNVEDKVTGNLDDANVLMYRNKAQGTKY
HVIDLDPYGTVTPFVDAALQSIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGGVNLVSHE
ATHESALRLVINLLNQSAAKYKKVVEPLLCLSIDFYVRVFVKVRTSPIEVKQLQSNTMVT
YHCSQCGSLENQHLGRMLEREGKN-GKKYI--KYAVAQGPPVDTKCKFCQGTYHVAGPMY
AGPLHNKKFIEEVLRINNDEH--IDE---IYGTRKRIEGMLTLAQNELDD--APFYFSPN
KISSIIKLQVPPLKKVVAGLGSLGYDCSLTHAKPSSLKTNAPWEAVWYVLSKCD------
-DTNK--DISKMNPNTAGYKILSTIDEWLPKTPNE-----------------------KN
SNLDITKLTFEPNEQSEHLEKLRKLKIVRYQENPTKNWGPKARPNLS-------
>Kpol_543.45
------------------MLQAVASKIKSKIFDSEPKRIE------------INPDDYNI
VKEGKAEILFPKKETVFYNPVQQFNRDLSVTCIKAWDNLYGPKS------SGNGKKSKKA
QNKRS-----IEEDEDIAKIRRLADGSKQEISTSKHA-------PYLKILEALSATGLRA
IRYAHEIPNVKEIVANDLLPEAVDSIRRNAEYNKVENIVKPNIDDANVLMYRNKSTNTRY
HVIDLDPYGTVTPFVDAALQTIEDDGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHE
ATHESALRLVLNLLSQSAAKYKKTIEPLLSLSIDFYVRVFIKVKTSPINVKNLQSNTMIT
YHCSQCGSYHNQHLGRIQERSGKN-GKPFK--KYLVAQGPPVDSKCKFCKGTYHLAGPMY
AGALHNKEFLDEVLRINKVEHANMGD---VYGTRKRIEGMVTLASKELAD--APFYFSPN
NISSILKLQVPPLKKVVAGLGSLGYNCSLSHAQPSSLKTDAPWEAIWYVMKECD------
-DKEV--NLEKMNPNTAGYKILSTFDQWMPEEEDG-----------------------RE
PMFKKSDLSFKENEQSGAVEKLRKLKIVRYQENPTKNWGPKARPNSS-------
>TDEL0F04010
------------------MLRAALTKIKSRFASAGSSW--------------INPEDYNV
VKEGKAEILFPKAETVFCNPVQEFNRDLSVCCIKAWDNLYGGQT-------KIGRKSKSN
SRKRSNT---GEDDGTCEKRRKLDDKSAERNVP-----------SYMRILEALSATGLRA
IRYAHEIPHVKEIVANDLLPEAIESIKRNVQFNGVENIVKPNLDDANVLMYRNKSENVKY
HVIDLDPYGTVTPFVDAALQSIEENGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHE
STHESALRLVLNLLSQSAAKYKKTVEPLLCLSIDFYVRVFVKVKTSPIEVKNLQSKTMTT
YHCSQCGSYHNQPLGRATERLNNK-QKKSI--KYSVAQGPPVDSKCKFCGGTYHLAGPMY
GAPLHNQEFIDEVLRINREEH--TDD---TYGTRKRIEGMLTLAKSEIPD--APFYFSPN
HISSILKLQVPPLKRVVAGLGSLGYDCSLTHAQPSSLKTNAPWEAIWYVMKQCE------
-EQK---DLQKMNQNSTGYKILSTEDRWLSDENRE-------------------------
---AFKKLSFEPNEQSGQVEKLRKLKIVRYQENPSKNWGPKARPNTK-------
>Skud_4.381
------------------MLRAAISKIKANLTAYGAPR--------------INIEDFNI
VKEGKAEILFPKKETVFYNPVQQFNRDLSVTCIKAWDNLYGEDC-------GQKRKNKKS
KKKRP-----AQNSDDSSKRQKMDNGSSKEIFEEANKKT-----PYINILEALSATGLRA
IRYAHEIPHVKEVIANDLLPEAVESIRRNVEYNNVGNIVKPNLDDANVLMYRNKAINNKF
HVIDLDPYGTVTPFVDAAIQSIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGGANMVSHE
STHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVRTSPIEVKNLMSNTMTT
YHCSRCGSYHNQPLGRVSQREGKK-SKTFT--KYSVAQGPPVDIRCRFCDGTYHLAGPMY
AGPLHNKEFIEEVLRINKEEHHDQDD---TYGTRKRIEGMLSLAKNELSD--SPFYFSPN
HIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQKCD------
-DEKK--DLSKMNPNTTGYKILSAMPKWLSDDIKS-----------------------E-
---YDLRLSFTPNEQSGNIEKLRKLKIVRYQENPTKNWGPKARPNAS-------
>Suva_2.281
------------------MFRAAISKIKANLTAYGARK--------------INIEDFNI
VKEGKAEILFPKKETVFYNPIQQFNRDLSVTCIKAWDNLYGDEC-------GQKRRNKKG
KKKRT-----AQNSDDSSKRQKMEDGSSREIAEDSRTKT-----PYINILEALSATGLRA
IRYAHEIPHVKQVIANDLLPDAVESIKRNVEYNNVESIVKPNLDDANVLMYRNKATNNKF
HVIDLDPYGTVTPFVDAAIQNIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHE
STHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVKTSPIEVKNVMSNTMTT
YHCSRCGSYHNQPLGRISQREGKK-NKTFT--KYSVAQGPPVDTRCKFCGGTYHLAGPMY
AGPLHNKEFIEEVLRINNEEHHGRDD---TYGTRKRIEGMLSLAKNELSD--SPFYFSPN
HIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMQKCD------
-DEKK--DLSKMNPNTTGYKILSAMPKWLSEDVKS-----------------------E-
---YDSKLSFTPNEESGSIEKLRKLKIVRYQENPTKNWGPKARPNAS-------
>YDR120C
--MEGFFRIPLKRANLHGMLKAAISKIKANFTAYGAPR--------------INIEDFNI
VKEGKAEILFPKKETVFYNPIQQFNRDLSVTCIKAWDNLYGEEC-------GQKRNNKKS
KKKRC-----AETNDDSSKRQKMGNGSPKEAVGNSNRNE-----PYINILEALSATGLRA
IRYAHEIPHVREVIANDLLPEAVESIKRNVEYNSVENIVKPNLDDANVLMYRNKATNNKF
HVIDLDPYGTVTPFVDAAIQSIEEGGLMLVTCTDLSVLAGNGYPEKCFALYGGANMVSHE
STHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFVKVKTSPIEVKNVMSSTMTT
YHCSRCGSYHNQPLGRISQREGRN-NKTFT--KYSVAQGPPVDTKCKFCEGTYHLAGPMY
AGPLHNKEFIEEVLRINKEEHRDQDD---TYGTRKRIEGMLSLAKNELSD--SPFYFSPN
HIASVIKLQVPPLKKVVAGLGSLGFECSLTHAQPSSLKTNAPWDAIWYVMQKCD------
-DEKK--DLSKMNPNTTGYKILSAMPGWLSGTVKS-----------------------E-
---YDSKLSFAPNEQSGNIEKLRKLKIVRYQENPTKNWGPKARPNTS-------
>Smik_4.365
--MRSSFRIRLKRTVSYGMLKAAISKIKANFTAYGAPR--------------INIDDFNI
VKEGKAEILFPRKETVFYNPIQQFNRDLSVTCIKAWDNLYGEDC-------GQKRKSKKG
KKKRC-----AENNDDSSKRQKTENGSPKETVENFNKKE-----PYINILEALSATGLRA
IRYAHEIPHVREVIANDLLPDAVESIKRNVEYNNVENIVKPNLDDANVLMYRNKATNNKF
HVIDLDPYGTVTPFVDAAIQNIEEGGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMVSHE
STHESALRLVLNLLKQTAAKYKKTVEPLLSLSIDFYVRVFIKVRTSPIEVKNLMSNTMTT
YHCSRCGSYHNQPLGRISQREGKK-NKTFT--KYSVAQGPPVDTKCKFCEGTYHLAGPMY
AGPLHNKEFIEEVLRINKEEHRDKDD---TYGTRKRIEGMLSLAKNELSD--APFYFSPN
HIASVIKLQVPPLKKVVAGLGSLGYECSLTHAQPSSLKTNAPWDAIWYVMEKCD------
-DEKK--DLSKMNPNTTGYKILSTMPKWLNDDVKS-----------------------E-
---YESKLSFASNEQSGSIEKLRKLKIVRYQENPTKNWGPKARPNTS-------
>KLLA0F19404g
------------------MLRAAFQSLKSKFGRKVTLDSST-----------IDVSQFKV
VQEGDAKILFPNKETVFYNPIQQFNRDLSVTCIKAWDELYQEEQ------RESRELKSKN
KKRKPIESNEDGSDYDTIKRRKLNEDQDSVAVSSKDHSTR----PYIKILEALSATGLRA
IRYSKEVPNVKTIVANDLLPEAVESIKRNVIYNEVSDKVVPNLDDANVLMYRNKSKNEKY
HVIDLDPYGTVTPFVDASMQSIEDGGLMLVTCTDLSVLAGNGYPEKCFALYSGVNMAGHD
ATHESALRLVLNLLGQSAAKYKKTIEPLLSLSIDFYVRVFIRVKTSPIEVKNLQSNTMVG
YMCSGCNAYHTQPLGRQQERTTKK-GVKFT--KFSLAQGPPVDRNCSYCGSVHHIVGPMY
GGPLHNKKFIDRVLRINKEEH--KDD---IYGTRKRIEGMLTLAKNEI-A--APFYFTPN
SVSSVLKFQVPTLKAVVAGLGSLGFECSLTHAKASSLKTDASWDAIWYVMKKYC------
-IDNNLVNIEKMNKNGNGYKILT--NDTIGQTED--------------------------
---WDKKISFEPNEYSGRFEKLRKLKIVRYQENPTKNWGPKARPQ---------
>AGR075W
------------------MFRAAIQKLKANFVGSPTPLASSAPASKAQ----INLAEYNV
VSEGKAQILFPEKETVFYNPIQQFNRDLSVTCIKAWDNLYGSKA-------IRGKRVGSN
GKRSF-----DGTDQEATKKRKLAASKEAVDPTGSGSDDPG---RYIKVLEALSATGLRA
IRYAHEIPHVKNIVANDLLPEAVDSIRRNIDYNHLSHLITANQDDANVLMYRSKAEGKKF
HVIDLDPYGTATPFIDASLQSIEEGGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMAGHD
ATHESALRLVLNLLSQSAAKQKKYIEPLLSLSIDFYVRVFVRVRTSPSEVKNLQHNTMIG
YMCSGCSAWHTQRLGKQSQRASKK-GKPYT--KYSLAQGPPADKRCHYCGSPHHVFGPMY
AGPLHNHEFIDEVLRINEEEH--QDD---IYGTRKRIKGMLTLARNELPE---PFYFVPT
SISSILKFQVPPLKTVVAGLGSLGYACSLTHAKASSLKTNAPWDAIWYVMKRYC------
-LDNELADIKKMNQNGFGYKILT--NESIDGSTDE-------------------------
---WAEKLSFSPNQQSIDLERLRKLKIVRYQENPTKNWGPKARPQ---------
>Ecym_4296
------------------MLRAALHKLKANLGTGSSSRNANTPSKPA-----INLSDFNV
VTEGKAQILFPEKETVFYNPVQQFNRDLSITCIKAWDNLYGTTN------DGNSTKASYT
NNKRSF----DGIESGSTKKRRITDGAGNDGAIKSNSPPGL---PYMRILEALSATGLRA
IRYAHEIPNAKQIVANDLLADAVESIKRNVQFNDVSNIVTPNKDDANVLMYRTKSEGGKF
HVIDLDPYGTATPFIDSSMQCIEDGGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMAGHD
ATHESAIRLVLNLLGSSAAKYKKSIEPLLSLSIDFYIRVFIRVRTSPTEVKNLQNNTMTG
YMCSGCGSYHTQRLGKQSERVSKK-GKAFI--KYSLAQGPPVDRNCKYCRAVHHVVGPMY
AGTLHNQQFLDEVLRINREEH--NDE---VYGTRKRIEGMLTLAKNEL-N--VPFYFSPN
SLSSILKFQVPPLKTIVAGLGSLGYTSSLTHAKASSLKTDAPWDAVWYVMKKYC------
-LDNDLVDINKMNTNGRGYKILT--NDQICGSEHM-------------------------
---WDEKLSFDPNEQSGKVEKLRKLKMVRYQENPTKNWGPKAKPQ---------
>SAKL0H16764g
------------------MIRAALNKITKRFCRPSVTPSTTK----------INPDDYNI
ITEGKAHILFPEKETVFYNPIQQFNRDLSVTCIKAWDNLYGNLK------------QTRK
GRKRSL----QSPGEESSKKRKLEDGSAETQTSSR---------PYIKILEALSATGLRA
IRYAHEISNVKEIVANDLLPAAVESIKKNVEYNKVEKIVKPNLDDANVLMYRNKSTNTRY
HVIDLDPYGTATPFIDAAMQTIDDEGLMLVTCTDLSVLAGNGYPEKCFALYGGTNLAGHD
ATHESALRLVLNLLGQSAAKYKKSIEPLLSLSIDFYVRVFIKVRTNPTEVKNLQHNTMVT
YMCSGCGSYHNQRLGRQTKRESKK-GKEYL--KYSLAQGPPVNVRCNFCGGAHHIVGPMY
AGSLHNKEFINEVLRINKEEH--GDE---VYGTRKRIEGMLTLARNEL-E--TPFYFTPN
RVSSVLKFQVPSLKTVVAGLGSLGYECSLTHAQPSSLKTNAPWETIWYVMKKYC------
-TDNKLCNLEKMNKNSFGYKILT--NDEIGSKDSE-------------------------
-----SKLSFEPNDQSGRVEKLRKLKIVRYQENPTKNWGPKARPQ---------
>KLTH0G13420g
------------------MIRAALAKVRSRFVKPAPK---------------PDASKFTV
VTEGKAHILFPEKETVFYNPIQQFNRDLSVSCIKAWDNLYGQAK---------QEKSRGK
GKKRG-----LEHGEEASKKRKLEDGSSAEVKASSSR-------PYIKILEALSATGLRA
IRYAHEIPNVKEVVANDLLPEAVDAIQRNVDYNKVGHIVKPNIDDANVLMYRNKAAHKRY
HVIDLDPYGTATPFIDAALQNIEDDGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMAGHD
ATHESALRLVLNLLGQSAAKYKKSIEPLLSLSIDFYVRVFVKVKTNPTKVKDLQHNTMIT
YVCSGCRSYHSQRLGKQTERESKK-GKPYL--KYSLAQGPPVDKKCHYCGGAHHLTGPMY
AGPLHNREFIDEVLRINRDVH--GDD---VYKTRKRIEGMLTLAKNEV-D--APFYFTPN
RVSSILKFQVPSLKTVVAGLGSLGYECSLTHAQPSSLKTDAPWGAIWYVMKRYC------
-LDNGLCNVEKMNQNSWGYKILS--NDLVAEAAQ--------------------------
---YGDQLSFEPNDQSGRVEKLRKLKIVRYQENPTKNWGPKARPQ---------
>Kwal_56.23747
------------------MIRAALTKVRNRFLKPVIK---------------PDADKFTI
VTEGKAHILFPEKETVFYNPIQQFNRDLSVSCIKAWDNLYGQPK---------QERSKSK
GKKRG-----MDESEESSKKRKLDDGSASHVKAANR--------PYIKILEALSATGLRA
IRYAHEIPNVKEVIANDLLPEAVEAIQRNVDYNDVGHIVKPNIDDANVLMYRNKANHKKY
HVIDLDPYGTATPFIDAALQNIEEDGLMLVTCTDLSVLAGNGYPEKCFALYGGVNMAGHD
ATHESALRLVLNLLSQSAAKYKKTVEPLLSLSIDFYVRVFVKVKTNPTLVKNLQHNTMVT
YVCSGCRSYHNQRLGKQSQRESKK-GKPYL--KYSLAQGPPVDKKCQFCGGSHHITGPMY
AGPLHNREFIDEVLRINSEVH--DDD---VYKTRKRIEGMLTLAKNEV-D--APFYFTPN
RVSSILKFQVPSLKTVVAGLGSLGYECSLTHAQPSSLKTDAPWDAIWYVMKRYC------
-LDNDLCNVEKMNQNSWGYKILT--NDAVSDQDK--------------------------
---YKEMLSFEPNEQSGKVEKLRKLKIVRYQENPTKNWGPKSRPQ---------