MUSCLE (3.8) multiple sequence alignment

KAFR0B05450        -----MGKKDKQRKRLRKFVQLK----EAQRLFDDPTTPIAKETILANAIPI--------
KNAG0H03180        -----MGKKDRQRHKVKKFVEKKKIVVDRSPSPLNELVAMEGTSSDGKLSVGNPEQCA--
NCAS0B03780        -----MGRKDKQRKKLREFAKLK----EKQRLLENKI-----------------------
NDAI0J01280        -----MGRKDKQRKRLRDFAKLK----EKQRQLHLDQFIATSDNLKNKLIA---------
Suva_2.279         -----MGKKDRQRKKLREFAKLK----NRQQNLRKSVQSLKKEVQRKSVAPENLNRIVFG
Smik_4.363         -----MGKKDRQRKKLREFAKLK----NRQRNLKESVQNLKKEVQQKAVCSEHLDLVQLE
Skud_4.379         -----MGKKDRQRKKLREFAKLK----NRQQKLQNSVQNLKNEVQREVGESENPNPIAIE
YDR119W            -----MGKKDRQRKKLREFAKLK----NRQRNLRKSVQTLKNEVQREAKVPRTSNQIALG
Ecym_4298          MGRKRSGIKTKERNRLKEFAKLK----GRQRTLKSDEAGETYLGDK--------------
TBLA0F03040        -----MSKKQKQRKKVRSKKRKQ----QKSKGPVQETTPDKSLSNELLTENNKIEQQDVP
AGR076C            MGKRRKGLKTKQRDRLREFAKRK----ERQRALAGQNQAGVGQDAQ--------------
KLTH0G13464g       -----MVQS---------------------------------------------------
Kwal_56.23754      -----MSPG---------------------------------------------------
TPHA0A01750        -----MVENDVIS--------------NIGDDSLSHVPPRVQE-----------------
Kpol_543.44        -----MGKKDKQRKKLRNFTKAKVKQVQEDQEPMVPDPPEFDGTESFVQTLAETSQLTKE
KLLA0A04631g       -----MVES---------------------------------------------------
SAKL0H16808g       -MARKKNSKNKQRKKLQAFVKLK----ERQRQLLNDEPKVVIQQNPAHSIEPT-------
ZYRO0C01430g       -----METNNSKNDLT--------------------------------------------
TDEL0F03990        -----MGKKDKQRNKLREFTRQKQLQQAKKNDMLEETRPLVAPSSAEP------------
                                                                               

KAFR0B05450        ------------------------------------------------------------
KNAG0H03180        --------------SQEVTVTGSSTGSGDKTSGRDMETSCSKDGTENALTEGVSNSDYTS
NCAS0B03780        ------------------------------------------------------------
NDAI0J01280        -------------------------------------------------TSQNSVPQTID
Suva_2.279         NLK-------REEASENSPLLPAPSEPREGSGPKTLNINANDTRSLPELPENSTSVETES
Smik_4.363         NDKSEEINDESEEINENVPLLSTHGGQKEEKVSKVPDVDTINTHPLHS-SKNDDSHQTEA
Skud_4.379         NDK-------SEENKENTPLLLTSSERREDDGSKPLDIDTFDTRPFQERSKSGNPVQAEG
YDR119W            NDK-------IEEINENSPLLSAPSKQEEVSIPKAVDIDTIDAQPLHEGPKIDDSPQDEV
Ecym_4298          ------------------------------------------------------------
TBLA0F03040        EVHENRQDETDWVKSDKVETVKVFNDKPSKTTEPAIQLSNTATSIIEESTPSNPITEDTE
AGR076C            ------------------------------------------------------------
KLTH0G13464g       ------------------------------------------------------------
Kwal_56.23754      ------------------------------------------------------------
TPHA0A01750        ------------------------------------------------------------
Kpol_543.44        D-----------------------------------------------------------
KLLA0A04631g       ------------------------------------------------------------
SAKL0H16808g       ------------------------------------------------------------
ZYRO0C01430g       ------------------------------------------------------------
TDEL0F03990        ------------------------------------------------------------
                                                                               

KAFR0B05450        ------------KLETKLNAT---------LPTAKKEPDHELQRIKKG------------
KNAG0H03180        DRLLRKDSVPMDKDESVDHSR-------FVLERGGTDATTDVASAQDS------------
NCAS0B03780        ------------HHATPNGTQ------------KPTSELNTVQQLEPE------------
NDAI0J01280        EQPTGNIEDNDSTELTPLLLK------------------KQSENHIAV------------
Suva_2.279         DDIEGKLAENANEEPPKFLSQEEPPKFLSREEPGKKSPSQNSVSDFSD------------
Smik_4.363         DCAERKSGNKTDHDYPKSLSQ---------DEPGIKLPLQSSMTDFTD------------
Skud_4.379         DDMEGKSEDKADQDHHKFLSQ---------DESGTKSPLQNSMIDFSD------------
YDR119W            NSIKGKPADKANEDDLKPPSQ---------HEACGNSALQSSITDFSD------------
Ecym_4298          ------------------------------SNTISFGPYSRSSDESQG------------
TBLA0F03040        STPDSNITLKASEPVPDDTPKANKIIIQPVNTTASIIEDQLPSMPMEGTPNAKATQQVLG
AGR076C            -------------------------------------PARRQHRPRAG------------
KLTH0G13464g       ------------------------------------------------------------
Kwal_56.23754      ------------------------------------------------------------
TPHA0A01750        ------------------------------------------------------------
Kpol_543.44        ------------------------------------------------------------
KLLA0A04631g       ------------------------------------------------------------
SAKL0H16808g       ------------------------------------------------------------
ZYRO0C01430g       ------------------------------------------------------------
TDEL0F03990        ------------------------------------------------------------
                                                                               

KAFR0B05450        ------------------------------------------------------------
KNAG0H03180        ------------------------------------------------------------
NCAS0B03780        ------------------------------------------------------------
NDAI0J01280        ------------------------------------------------------------
Suva_2.279         ------------------------------------------------------------
Smik_4.363         ------------------------------------------------------------
Skud_4.379         ------------------------------------------------------------
YDR119W            ------------------------------------------------------------
Ecym_4298          ------------------------------------------------------------
TBLA0F03040        DTPKVNIATFPPSNATTSVIEASNSLTNDTTNTTDIVITDFSKSTESATITDTPKTNESG
AGR076C            ------------------------------------------------------------
KLTH0G13464g       ------------------------------------------------------------
Kwal_56.23754      ------------------------------------------------------------
TPHA0A01750        ------------------------------------------------------------
Kpol_543.44        ------------------------------------------------------------
KLLA0A04631g       ------------------------------------------------------------
SAKL0H16808g       ------------------------------------------------------------
ZYRO0C01430g       ------------------------------------------------------------
TDEL0F03990        ------------------------------------------------------------
                                                                               

KAFR0B05450        ------------------------------------------------------------
KNAG0H03180        ------------------------------------------------------------
NCAS0B03780        ------------------------------------------------------------
NDAI0J01280        ------------------------------------------------------------
Suva_2.279         ------------------------------------------------------------
Smik_4.363         ------------------------------------------------------------
Skud_4.379         ------------------------------------------------------------
YDR119W            ------------------------------------------------------------
Ecym_4298          ------------------------------------------------------------
TBLA0F03040        TAIPESNPLKSLTKKDSISTTDGNGTLEANESSVINETIGASINNLSLGNEEMISIITGS
AGR076C            ------------------------------------------------------------
KLTH0G13464g       ------------------------------------------------------------
Kwal_56.23754      ------------------------------------------------------------
TPHA0A01750        ------------------------------------------------------------
Kpol_543.44        ------------------------------------------------------------
KLLA0A04631g       ------------------------------------------------------------
SAKL0H16808g       ------------------------------------------------------------
ZYRO0C01430g       ------------------------------------------------------------
TDEL0F03990        ------------------------------------------------------------
                                                                               

KAFR0B05450        ----------------------------------TESCLFSPKLTTSNPLRETDL-----
KNAG0H03180        ----------------------------------AKLAAVPSLRHETGTIRSVGS-----
NCAS0B03780        ----------------------------------ESTPLLKTSNHETSTPAEKEMPDKRD
NDAI0J01280        ----------------------------------AESSGIDALKSDTVEEPIEEE-----
Suva_2.279         ----------------------------------RSVSPLQSITSDNTPMSVHEV-----
Smik_4.363         ----------------------------------RSISPLQSITSNNTPMSEHEL-----
Skud_4.379         ----------------------------------RSISPLQSITSDHTQMSEREL-----
YDR119W            ----------------------------------RSVSPLQSITSCNTPMSEHEL-----
Ecym_4298          ----------------------------------ETIPFLTRIDKNVIQDTSSGR-----
TBLA0F03040        SCNRSLNHTTETIYNPSTSQDYASVATGTTNNNLDSSQILKPIRDEFIQDASTDI-----
AGR076C            ----------------------------------EQSGLLEASRGTLVSDPSSGL-----
KLTH0G13464g       ----------------------------------EHSPLLTPVDRDAMQDPSTDL-----
Kwal_56.23754      ----------------------------------ERTSFLAPIDKDVIQDPSTGL-----
TPHA0A01750        ----------------------------------DKSPLLHAIRGELLQDSSFSL-----
Kpol_543.44        ----------------------------------DENSVLLPIRDELLQDPSTEL-----
KLLA0A04631g       ----------------------------------DRTSLLQPVRNALNPELSEGL-----
SAKL0H16808g       ----------------------------------ETTPFLQPIRRELVLDPTSDL-----
ZYRO0C01430g       ----------------------------------SRTNFLNPVRDDILQDASTDI-----
TDEL0F03990        ----------------------------------IEASLLLPIKPEILQDPSTDL-----
                                                          .                    

KAFR0B05450        ------SLSTNE----RIIDKSVAITTSLRESHSLELG----------------------
KNAG0H03180        -----SSEANQQRHKKNKKGADTVDLPVKRITSNFQMTPALCESTPILDSASEAPERPNS
NCAS0B03780        LKFPAPSFSTQYRNMALNIQDASAAQDPVPLPTEELRQQITSSDTTTIYTDNNTTSSLYA
NDAI0J01280        -----VTSLAHQKQKNISDDNQLIEEPSRPQSSREEISSS-------ASTNEAPIVPHKK
Suva_2.279         -----PESLANA----LEGNGDIVVAQLDSCVPAINALPTSDLSPTSATSAPEVLVDRPQ
Smik_4.363         -----PASSTNS----LERGDNMPIVQPSSQIPTGQILSM-------AASPPEVPGGRAQ
Skud_4.379         -----PGSSTNS----LEGNGDIHVAQSESERPTSKTLAT-------ATSAPAVPVSRAE
YDR119W            -----PVSSSNS----FERADDMPVVQADNQTSSSKSLHI-------VAPSPEVPVSGDE
Ecym_4298          -----PGFVINK----LEVQELSLGSAGSQSTTILNS-----------------------
TBLA0F03040        -----AGFVAGE----LEEIEEEAREAREGEEGEALITST--------------------
AGR076C            -----SGLVASE--LEVQRQQEVCAAVTAESMATSGSGS---------------------
KLTH0G13464g       -----PGFVANQ----IEQQDHLLDIEQGR------------------------------
Kwal_56.23754      -----AGFVANE----VEQQDYNSRTGHD-------------------------------
TPHA0A01750        -----PGFVAAE----IEEREELYREASIASNQHH-------------------------
Kpol_543.44        -----PGFIAAE----IEEGEQEYEETRSG------------------------------
KLLA0A04631g       -----PAYVGAE----VAETEHL-------------------------------------
SAKL0H16808g       -----PGFVAGE----LEEQEERCAEEQTNAS----------------------------
ZYRO0C01430g       -----PGFVAEE----LEEREELYRECQGT------------------------------
TDEL0F03990        -----PGFVAEE----IGQQEEVAN-----------------------------------
                                                                               

KAFR0B05450        ---SEYGSIDFENSVAKDGNFNVCQ----------AHQIKISATR------------LHF
KNAG0H03180        DEFDGYAFSAESNRTSLRANYGSIHEFLP---E--SPTHPLSPVQSSTVRTVERSNLRQS
NCAS0B03780        RTTDGYGSIHGQSSNTSDIDLHVDTESSA------PQADLMTCVK------------SKL
NDAI0J01280        IHSPSYGSIEQRLSHEEPAFTEEVVDLET---NN-RDISLLNEPQ------------LTA
Suva_2.279         MRAYEYGSISRTVKDVENGTTSSYARVAS------SDKFVHDLTR------------RRI
Smik_4.363         MDPYGYGSISRTIEDVESGANPTYVANSS------SDELVHDLTR------------KRI
Skud_4.379         ISPYGYGSISQTIEDVEDETDPSYIASTS------SDAFVHQETR------------RRI
YDR119W            ITSYGYGSIPQSIGDVENGLNPPYVENTS------SDELVHDLTR------------RRI
Ecym_4298          ----SYGSTSTTVTPDSNKNGNVFIRSSSVEVGNIGDSQNISQIR------------FAA
TBLA0F03040        ---ASYGTLPI------------------------EPSVEMSNMK------------MNI
AGR076C            ----SYGSTQKPTEVYLTATAVEAAK---------EDAGGLGATR------------RRV
KLTH0G13464g       ----AYGSTTKSSISSENEREDAGGATVA---GCGSAEFYLPSSR------------ILI
Kwal_56.23754      ----SYGATAVDDRTATSARCDLTFPPSE------TPEFALSSSR------------IRI
TPHA0A01750        ----DYGSVANSIILD-------------------NDKNNLSPTR------------LRL
Kpol_543.44        ----HYGAIESRRIS--------------------SKGTELSTAR------------LKI
KLLA0A04631g       --------LESEDEAREG-----------------LQVSEMSRAR------------LHI
SAKL0H16808g       ----GYDSIKKNTVATAKTIDLETSSIEA------KNNTGLSPAR------------IKI
ZYRO0C01430g       ----DYGSIDNEDDSRDG-----------------VASSPVPPDK------------LLV
TDEL0F03990        ----GYGSITDPHDGDNKSERPV------------STAEEISGAR------------LRV
                                                               .               

KAFR0B05450        IIACIC-ISM-LSLGADFSFTLVSSPSISSEFDHLADFFI-IFGIYLLAI----PIAFYV
KNAG0H03180        IGSTIF-SGMSFITGLDLMMIWSRSALISSDYNKFLSYFL-FPALYLFPIATSHFL--RS
NCAS0B03780        LLTVLS-LGL-FMIFFEFSAMIELSSFILSGFDRFSQLALSLGSSFALIGLTLSALIEYP
NDAI0J01280        GMIFLFSLLL-FTIIFDFTLAMMLSTTSGSHVKQSSNSSW-IIASYLITMYISQLL--TA
Suva_2.279         FSSCMC-TYL-FFIAMDSTILMSIVSKIASEFHELWRLSL-IISIYLLSNAIGQLV--FL
Smik_4.363         FSSCMC-TYL-FFIAMDSSIILVIASKIASEFHELWRLSL-VISVYLLGNAIGQLM--FL
Skud_4.379         FSSCMC-TYL-FFIAMDSSILLVIVSKIASEFHELWRLSL-IVSVYLLSNAIGQLL--FL
YDR119W            FSSCMC-TYL-FFIAMDSSIILVIASKIASEFHELWRLSL-VISAYLLSNAIGQLV--FL
Ecym_4298          IVSSLV-VGV-FLGSLDGTILSTLLDYIASEFEALPYISW-IAASYLLSACIFQPL--YG
TBLA0F03040        IMCSMY-LGV-FLAALDNTVVSTLMAHIGSEFNQIPKVPW-VATSYLLSSAVFQPL--YG
AGR076C            VMASMC-LGV-FLAALDGTIVTTLLDHIASEFNELPRISW-IATAYLLSSATFQPL--YG
KLTH0G13464g       IMFSMF-LGI-FLAALDGTIVSTLLTHIGSEFNSLDKASW-IATSYLLSSSTCQPL--YG
Kwal_56.23754      IMISMF-LGI-FLAALDGTIVSTLLTRIGSEFNSLDKVSW-IATSYLLSSSTCQPL--YG
TPHA0A01750        AMSSMY-LGI-FLSALDNTIVSTLLARIGSEFNELPRISW-IATAYLLSSATFQPL--YG
Kpol_543.44        IMLSMY-LGI-FLAALDNTIVSTLLAHIASEFNELPRISW-VATAYLLSSATFQPI--YG
KLLA0A04631g       IISSMC-LGS-FLAALDNTIVTTLLSHIASEFNELSHISW-IATAYLLSSATFQPL--YG
SAKL0H16808g       IMGSMY-LGI-FLASLDNTIVSTLLAHIASEFNEMPHISW-IATAYLLSSATFQPL--YG
ZYRO0C01430g       ITLSMY-LGI-FLAAADGTLVSTIMAHIASEFNELPRISW-IATAYLLSSATFQPL--YG
TDEL0F03990        IMLSMY-LGI-FLAAIDNTIVSTTSAHVASEFNQLSKVSW-IATSYLLSSATFQPL--YG
                       :      :    :            *           .   : :       :    

KAFR0B05450        TSLTIKKYFISSTILSNLLALISS-LSCTYFKGLNMLVLSRILFGAA-CGSCCYIDLTLC
KNAG0H03180        RISL---SIRSNMLMSQLLSIVGF-LITALGRHFSVILLGRFFIGLGVSSHLITAPSTIE
NCAS0B03780        KLC----TLKSSIIAGNVAFVVGS-LLIFNSKLYFSFGLGRCINAIG-AALIIYTTFTTN
NDAI0J01280        QVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMARFILGLA-SGSLIYVMLTII
Suva_2.279         KLSIVT-SVKLLLCVAQFSFILGS-YLSWSAFHFWTFVFARSITGFG-SGALMALKSTIM
Smik_4.363         KLSLVS-GVKLLLCVAQFSFILGS-YLSWSSIHFWTFILARSVTGFG-SGSLIALKSTIM
Skud_4.379         KLSIIS-SVKLLLCMAQFSFILGS-YLSWSSSHFWTFIFARFVAGFG-SGSLIALKSTIM
YDR119W            KLSLIS-SVKLLLCIAQFSFILGG-YLSWSSAHFWTFIFARCVTGFG-GGSLIALKSTIM
Ecym_4298          KLSDIF-GRKAILLFSNLMFGLGC-LVCGTAPTVWWLLAGRFVAGIG-GGGLTSMPSIII
TBLA0F03040        KLSDIF-GRKALLIFSNLIFFFGC-IICGMSNSLNMLVWGRFVAGIG-GGGITSMTTITV
AGR076C            KLSDIF-GRRPLLVFSNLVFCLGA-LICGMSKNLWVLVLGRFVAGIG-GGGLTSMCSITT
KLTH0G13464g       KLSDRL-GRKPLLVFSNAVFAIGC-LICGLSNSIWAVVAGRFISGIG-GCGLTSLATMIM
Kwal_56.23754      KLSDQL-GRKPLLVFSNVVFSIGC-LICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVI
TPHA0A01750        KISDIF-GRKIVLTFCNVNFFIGC-LICGTAKSFWVLVIGRFISGVG-GGGITSMSTITV
Kpol_543.44        KISDIF-GRKVVLIFCNITFFVGS-LICGLSPSFEWLVAGRFIAGIG-GGGITSMSSITT
KLLA0A04631g       KISDIF-GRRPLIIISNLFFILGC-LICGLSKNLWTLVAGRFIAGIG-GGGVTSLGSITA
SAKL0H16808g       KISDIF-GRKPLLIFSNVMFALGC-LICGLSPGLWCLVAGRFIAGIG-GGGLTSMSSITT
ZYRO0C01430g       KLSDIF-GRKPLLMLNNIVFLVGC-LMCGLTPSFWGLVGARFISGIG-GGGVTSMCSITI
TDEL0F03990        KVSDIF-GRKCLLVFTNVAFLIGC-LMCGLSKSFWWLVIARFVAGVG-GGGLTSMSSITI
                                        ..             .  .* . . .             

KAFR0B05450        EKLVPTNTKNKYSNIALAHFGLGTIIPALL----LNRNILTEW--SSMETTITVIFAPLI
KNAG0H03180        SMRLPLPNFIFLQS-----FALGLLCGSLIPVNWQ-------WAQGIFA----CVYILMF
NCAS0B03780        LMAHELCKKYVYYLISM----LGAVCGTIT-SGVF-CDL---WRKIYIIPTILAIIQ--I
NDAI0J01280        NKCI-LNKR--FSRPSMKIFTIPIV-GGLS-LAYATAIFITSWQNVYFLLAIFSFFTLFL
Suva_2.279         NRFSDKKKNGYSLSASVIVFSLGVAIGPFL-VYLFDNSRGSGWKNAFLIPVPFCLVNASI
Smik_4.363         NRFSQKNENQYPLSTSMTVFSLGVAVGPFL-VSFFDSSHGSGWKNAFLIPVPFCLVNASI
Skud_4.379         NRFSQKNESRYSLSASVIIFSLGVAIGPFV-VGLFDSSHGSGWKNAFLIPVPFCLVNASI
YDR119W            NRFSQKNDSRYSLSASMITFAMGVVIGPFM-MNLFDSSHGSGWRNAFLIPVPFCLVNASI
Ecym_4298          SDIVPLRSRASYQDLFNICYVLGITLGGSM-GGWL-AEY-GGWRLVFLLQVVAALISGCF
TBLA0F03040        SDIVPLRSRAVYQGICNFFFGLGTAFGGVI-GGIF-VDHQYGWRMVFWSQVPVSGLSTLL
AGR076C            TDIVPLRSRALYQGICNVFFGLGTACGGLV-GGLF-ADRAVGWRMAFLVQVPLTLLSTTA
KLTH0G13464g       SDLVPLRDRAVYQGLCNFVFGLGTASGGLV-GAYF-RD----WRLAFILQCPISVLSGIL
Kwal_56.23754      SDLVPLRERAVYQGLCNFIFGLGTASGGLV-GAAF-QD----WRMAFTIQCPISLASCAL
TPHA0A01750        SDIIPLRNRALYQGVCNFYYGLGIALGGII-GGWF-TEKLGSWRGAFLFQVPLSVISTVT
Kpol_543.44        SDIVPLRNRALYQGICNFYFGLGTALGGVV-GGWF-SDRSVGWRMSFLIQLPIAFFSTIL
KLLA0A04631g       SDIVPLRSRALYQGIFNFFFGLGIAIGGLI-GGWF-SESKNGWRMAFLVQVPLCAISLVL
SAKL0H16808g       SDIVPLRNRALYQGICNFFFGLGTACGGLV-GGWF-SEHGGGWRVAFLIQIPLCAISCSL
ZYRO0C01430g       SDIVPLRDRALYQGMCNFFFGLGTACGGVV-GGWF-SDHGGGWRMAFLIQVPLSALSSLL
TDEL0F03990        TDLVPLRERAMYQGICNVFYGLGTACGGIV-GGWF-SDNKGGWRMAFLIQVPLSAISLLV
                                        :                    *                 

KAFR0B05450        VSFWLALPKTDKNT------------------FEYSLHGMKMRHYLILLLTLFTTSALYI
KNAG0H03180        LTTVVAVPRGSHRRRNSVHDVRDHEDYV----WSVAFRLLNIMGISIMLNAVL----VYA
NCAS0B03780        VLLFLYFPLDDITNKDEIS-----------------------------------------
NDAI0J01280        IMFYFPSNESYKTNNTNLS-------------SIVATLDIDLIGCTILSVFLL----LIA
Suva_2.279         MLADIYSIKDNLHHGGSAPISWKR--------IKKILMSPDLYEILTLALLLL----CFV
Smik_4.363         MLADIYSVKNTIHHEGPTTTLQKR--------FKKVLWSPDLYEILTLALFLL----CFV
Skud_4.379         MLADIYSVKDNLHHEGSTFTLWKR--------VKKILLSPDLYEILTLTLFLL----CFV
YDR119W            MLADMYSVKSTL-YGRPTPTLWKR--------FKNTLLSPDLYEILTLTLFLL----CFV
Ecym_4298          IQAFLILPKVHHGNGIALANKES---------LKTKLYMMDWLGTFCLVIFLA----SLT
TBLA0F03040        ICSFLVVPRIKNYEVS----------------LGRKLMRVDWLGSISMILWLT----SFL
AGR076C            IQLFLTLPKPVDAHKGAGQRSIP---------WTTKLRMVDWTGTVTLVVFLF----CFT
KLTH0G13464g       IVVYLELPPRASASNKDC--------------WSARLRRLDWAGATSLIAFLF----LFM
Kwal_56.23754      IVSYLELPPRHEDDKDRH--------------WTSKLRDLDWAGVVTLVCFLF----LFM
TPHA0A01750        VMVWLQLPKDSKSYGLEITMSNNSSNNGTESIIMKKLKTIDWYGAMSLVIFLL----SFM
Kpol_543.44        IILFLRLPKESKGRGLQVDGNYFST-------IKVRLSAVDWIGATTLVLFLF----SFM
KLLA0A04631g       IIIFLKLPPGCKGLGLVSNDKDGKVD------IKDKLKRIDWLGSLSLVTFLF----AFM
SAKL0H16808g       IVAYLELPKGCKGSGIQSDEDNQ---------ISEKLRRIDWFGALSLVVFLL----LFM
ZYRO0C01430g       IAVFMKLPPRSKRVNSPAS-------------IKNKLLSVDWIGASALVVFLS----LFL
TDEL0F03990        IILHLKLPSKRATRNQDNS-------------IKRKLLAIDWLGASTLVIFLV----LFL
                   :   .                                                       

KAFR0B05450        IACS-SFDFPITYSSLSLWFTYLAVVFY-----------AAKES-------RNKGIYDAE
KNAG0H03180        NAM---------YDNVGHWTIFV--FISGLV--------VGTD--LSKRY-------GSF
NCAS0B03780        ---------------------------------------ISRKNLLDL------------
NDAI0J01280        VITT-GNSNGFSITSPYSATLVISIILVGILLLLSETT-TNKNPIIPLDFIENKVIFFKS
Suva_2.279         QVTS-LDITRLEHSAVIQGVLFFVIITCGILFWWIETNETYANSIISMSLRGDKHLMWTI
Smik_4.363         QATS-LDSTRLEHSTMIQEIIFSVIIICGVLFFVIEKSDVRMNSVFSLSLQGDKHLIWTM
Skud_4.379         QVTT-LDLTELEHRTMIQWVLFSVILICGVLFWLIEANDTYMNSVISMSLQGDKRLIWTV
YDR119W            QVTS-LDLTGLKNNTMIQALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTM
Ecym_4298          LTCS-L----VDLNFNFLLLLILLMFVSGYYFVYHELN-IAADPILSVHLLTDRNVLASS
TBLA0F03040        LITTMMGGISLDIDSDQFHYLIMFSSVSAIIFVLTELF-VASDPVLPLRFLSNRSVLGAS
AGR076C            LVCS-LYGEDLPH----LYLIFVVILLSGSYFIYHELY-VATDPILPIRFLENRSVLAAS
KLTH0G13464g       LTSS-MGGSSVAYGSRLFAAMCAATLVFGAVFVYVELR-VAADPVLPVTFLRDRSVLGSS
Kwal_56.23754      LVSS-LGGKEIAYDSVLFALLCVTTLVLGSIFAYVELY-VAVDPVLPIAFLKYRSVLGSS
TPHA0A01750        ILSS-AGGSDISVKSNTFLYLTLISVTSFISFIYIELK-FAKDPILPLVFLKDRSVLGSS
Kpol_543.44        ITAS-LGGKEIPYTSHKFIGLCVVTVIGALIFGYTELK-IAKDPILPLRFLKDRSVLGSS
KLLA0A04631g       LASS-LGGKEIPYNSNIFKLLVVATILSGTAFIYVELY-ISDDPILPIRFLTNRSILGAS
SAKL0H16808g       LASS-LGGKELPFQSNGFYALCVAIVVGGATFVYVETY-VSKDPILPVAFLKNRTILGSS
ZYRO0C01430g       VTAS-LGGKEIAFNSKTFVALCIGSSLACAFFIGVELY-GAKDPILPLSFLRNRSVLGSS
TDEL0F03990        LTAS-LGGKEIAYGSRTFALMLISSLLSCLVFIYVELR-VAADPILPLRFLAIRSVLGSS
                                                             .                 

KAFR0B05450        ISCWFLTGAYVSTTSFIFM-----LMEIQDLNTKSLYLSLTLSTFLGAVVAKKFLEDHI-
KNAG0H03180        IEKWIISIISNALTFLLFVCYYKDIVGNAALF--------LLAFVWTVCFTTHYILQQRK
NCAS0B03780        LPNMFSMLALIATLIYLPV-YSTIVWNESYLQLSIRVLPIYLSMFAVVLIQARYAK----
NDAI0J01280        LTVFFASMSLITFIHYFPF-YLEKTLNISLFDIYKRTSPMFLTILFIIITVSRRISTQNT
Suva_2.279         MGISFCFAALMCIIPFGTT-YFTIVLNISTLQIAERLLPLSVAIVVGYFSVCYFWKPQMK
Smik_4.363         MGIFFCFAALMCIIPFGTT-YFMIVLNLDTLEIAERLLPFFFSIVVGYFSVCYFWNSERQ
Skud_4.379         TGISFCFSALMCIIPFGTT-YFTIVLNLNTLQIAERLLPFFFSIVIGYFSVCYFWKSKKQ
YDR119W            IGISFCFAALMCIIPFGTT-YFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQ
Ecym_4298          LANFFCMLNDVLTIFYVPM-YFASVLYMGPKEIGKRTIISFLGTSIGSFGTGYYIKRRGK
TBLA0F03040        LGNFFCVMGFMTICFYLPI-YFASVLDISPTGIGKRMAPNFLCTALGSLGAGVYMKQTGK
AGR076C            LSNWFCMMGMMTTGFYIPV-YYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGK
KLTH0G13464g       LANWFCMMSMMTTNFYLPV-YWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGK
Kwal_56.23754      LANWFAMMSMLTTNYYLPV-YWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGK
TPHA0A01750        LSNWFTMMLLMTISYYLPI-YFTSVMGIGAYDVGKRTLPNFFSVAFGSLGAGYYMKKTGK
Kpol_543.44        LSNWFCMMALMTVSYYLPI-YFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGK
KLLA0A04631g       FANWFCMMSGVTLAFYVPV-YWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGR
SAKL0H16808g       LANWFSMMGMMTTSYFLPV-YWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGK
ZYRO0C01430g       FSNWFCMMAMMTTSYYLPI-YYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGK
TDEL0F03990        LSNWFCMMATMTTSYYLPI-YFSGVLNMSPTDVGKRLMPNFFSVAFGSLGAGYYMKKTRK
                       :                                    .                  

KAFR0B05450        -YINMVIQLILLVLQGKVIDVHSF---VTSKTIYL-------TALTSTLMFSFGV--ALG
KNAG0H03180        ---------------------------DLQRSMWRNNYWKEVTAAGVAI-----------
NCAS0B03780        -KYNTSLLGSLVGLIG-YYQLYSL---DKSTPDWFHFVAGCIPLIGVTSVIMAN------
NDAI0J01280        LSYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIGILPILGSTFLVIATLMDVTD
Suva_2.279         -NYLLEVVLGGVTLIL-YIALMGA---SLSLPVWKQYVCLSLPLLGSAMILT-----LLS
Smik_4.363         -NYLFKFVLSGVTLLL-YVALMGM---NLSLSVWKQYTCLSLPLLGSSMILT-----LLS
Skud_4.379         -NYLLKFVLSGVTLIL-YITLMGV---GLSLPVWKQYVCLSLPFLGSSMLLT-----LLS
YDR119W            -NFLLKFVLSGATLLL-YVALMGV---SLNLPVWKQYICLSLPFLGSSMILT-----LLS
Ecym_4298          -YRTFICLACIIGILG-QLQIALI---KPSISTWRQYLLLLIPILYTTTVRTSLLISLIA
TBLA0F03040        -YYWFVVLFALVSTLG-HYYLTLI---PLTVSITVQYLLVVLPGVGSSIIIVVALLAMIA
AGR076C            -YYWFLLAFCLVGVLG-QVQISYV---TPSISTWRQYCLYMIPGFGSAVLLTVTLLALIV
KLTH0G13464g       -YYYFLLAFCVLAIAG-QVQIVLI---TPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIA
Kwal_56.23754      -YYWFLLAFCGIGILG-QLKINLL---TPATPVWQQYLLLVVPSFGLSVLITVTLLAMIS
TPHA0A01750        -YYWFVTFFCLVVVIG-CLQIYLI---NDGISVWRQYLLSFVPGLGAAVLITIALLSMIV
Kpol_543.44        -YYWFVISFCVLASIG-CLQIVWI---QPDISVFKQYTLMFIPGLGASVLITVALLAMIA
KLLA0A04631g       -YYGFLLKFTGLMVLG-QLQVLLM---KPDISTWRQYILLPLPHFGSSVLITVTLLAMIA
SAKL0H16808g       -YKWLLMAFCALAVVG-QLQISLI---EPNIAVWRQYILLVIPGFGLSVLITVTLLAMIA
ZYRO0C01430g       -YYWLTVGFCTLSLLG-HLQINLM---KPDIATWRQFILLVIPGFGYSVLITVALLAMIA
TDEL0F03990        -YYWFSLIFCAVAVLG-QLQILLI---DPKIPTWRQYILLLVPGVGTSVLITVALLAMIA
                                                             .    :            

KAFR0B05450        SYFSKLNK-----EKNIITILGEGTTSALFAIIVSGVPFKGIVQENLKRELSQYLPG--D
KNAG0H03180        -------------------------TGASI-------LFNVALRKSLWTALEQLVSE--E
NCAS0B03780        -------------TKNMRDFAVGILVGGSATIILCQGLFTRTLHDTLRDNLLKLQSE--G
NDAI0J01280        DKKLP--------IISTSSFAVST-LGSILGICISGFIFNQGLYDELWVH---------S
Suva_2.279         SLYHEYHQPKKSPISGSIVYCFSA-MGGTIGISLGGYVFHKTLLKAVHDGVMKFSKH--G
Smik_4.363         TLYHEYHVQRKSPISGSIAYCFAA-MGGTIGVSSAGYVFHKTLVRTMNEEVMKFSKQ--G
Skud_4.379         SLYHEYHEQRKSLNSGSIVYCFGA-IGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQ--G
YDR119W            NLYHEYHEQRKSPISGSIVYCFGA-VGGTVGISLGGYVFHKTLIKLMHEKVMPFSKQ--G
Ecym_4298          AVPYKNQT-----AAASISYTFRS-TGAILGASLGGGIFRSSLKSLLNTNIMPLESE--I
TBLA0F03040        AVPHKHQA-----ATTSISYAFRS-TGGTLGVALGSSVFHRTLIKRLHTDVLEYVSP--E
AGR076C            AVPQRHQA-----ATTSISYAFRS-TGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSP--E
KLTH0G13464g       AVPHEHHA-----ATTSISYAFRS-TGATLGVSVGAAVFRSSLTSLLDAKVMRFASD--G
Kwal_56.23754      AVPHEHHA-----ATTSISYAFRS-TGATLGVSIGAAIFRSTLNTLLQNKVLQFASD--E
TPHA0A01750        AVPHEYQA-----VTTSISYAFRS-TGCTLGVSIGAALFRDSLNKYLRAKILELGSQNGN
Kpol_543.44        AVPHNHQA-----VTTSISYAFRS-TGCTLGVSIGGAIFRESLDNLLKSKVLKFKSP--E
KLLA0A04631g       AVPHEHQA-----ATTSISYAFRS-TGSTLGVSVGAALFRNKLSGSLFDSVMKFESD--K
SAKL0H16808g       AVPHEHQA-----ATTSISYAFRS-TGCTLGVSIGGAIFRKSLGSLLERNVMKLASD--K
ZYRO0C01430g       AVPHNHHA-----ATTSISYAFRS-TGSTLGVSIGGAIFRQSLNGLLSRKVLKFADK---
TDEL0F03990        AVPHEHQA-----ATTSISYAFRS-AGCTLGVSIGGAIFRESLSKLTTRYVLRYISK--E
                                             .           *   :                 

KAFR0B05450        HSVDELKYAIKKALSSVEWIREDSPDLISTSIFSCYLDSIRYVFIFNLFCTCIGISF-FH
KNAG0H03180        HPQEQLQQILHRALESSHWIQHSAPEFAQETIYASFRHNFTTLFLAAITLLTTSLFC-MT
NCAS0B03780        LKKKELLKILEKTIKNPQWALIDAPAITRGAITNSFALAIHQIFLSLLVISIFIIIS-SC
NDAI0J01280        TEEKGLGKIIRKMINNSEY--ESSSRYYCYEILESYFIVSGYVFLFSAICLLVAVISFCF
Suva_2.279         YHEKDLLKIIEHATQSSDWVHESAPKFIFQTLIECYLQACRNVFKLSAILFTITVMT-MF
Smik_4.363         YLKKDLFKIIKHATQSSNWVHKSAPKFIFRTLIECYLQACRNVFKLSALFFTITVVT-LF
Skud_4.379         YLKKDLLKIIKHATESSDWVHESAPKFIFKTLIECYLQACRNVFKLSAVFFTIMVIS-MF
YDR119W            YLKKDLLKIIKHATESSDWVHESAPKFVFQTLIECYLQACRNVFKLSTLFFTITVVA-IF
Ecym_4298          HPKSQLLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSIS-CY
TBLA0F03040        HPRKELLRIIKKASHSTEWVHRKAPTFIRDTLITCYDVACHDVFVFCTACALLAAIS-LA
AGR076C            HPASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVA-CC
KLTH0G13464g       HSERELRGIIASAARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVS-CS
Kwal_56.23754      HPREELLRIINNAAHSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAGAS-CS
TPHA0A01750        YSEKELLQIIDHASKSIDWVHNEAPRFFKRTILECYHYACKKVFLFCLICSVLALLS-IS
Kpol_543.44        HSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFS-MA
KLLA0A04631g       YSKEYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISIFAWIS-CG
SAKL0H16808g       HPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFCALLS-CI
ZYRO0C01430g       HPRKELLEIIEKASKSSEWVHDSAPEFIRPTLIGCYHFACKDTFLFCTLCSIGTLAS-IS
TDEL0F03990        HPKEELLKIIDKASESSEWVHHSAPDFIRQTLLECYHKACKNTFLFCFICSILTLVS-FS
                        *   :     .  :   .:.      :  .:       :                

KAFR0B05450        LARTHKQSSI---------------------------------------
KNAG0H03180        SNSAENV------------------------------------------
NCAS0B03780        LVSTHSDDNEAQ-------------------------------------
NDAI0J01280        TIKNKRHH-----------------------------------------
Suva_2.279         FFN--RVN-----------------------------------------
Smik_4.363         FFN--RIH-----------------------------------------
Skud_4.379         FFN--KIN-----------------------------------------
YDR119W            IFN--RIHCRSQNCLSLS-------------------------------
Ecym_4298          FLKEYPVHASQPQEYISQDSMDTYNDQTPK-------------------
TBLA0F03040        LIREERLATGLRAT-----------------------------------
AGR076C            FIVEYKLHAGNTAPRPQRERTLNLSTLFVPKDYILIINVFTYSLYAPHF
KLTH0G13464g       IIKEHKLHTSIKRGS----------------------------------
Kwal_56.23754      IIQEHTLHTTLKRDK----------------------------------
TPHA0A01750        MIKEHKLHSSLDRKEDDTPGSEEIQDSMN--------------------
Kpol_543.44        IIKEHRLHNTLDRDNENEE------------------------------
KLLA0A04631g       VIKEYKLHTSMERK-----------------------------------
SAKL0H16808g       AVKEYKLHTSMDRQAEEEEEEEEANST----------------------
ZYRO0C01430g       IIKEYKLHASLDRKN----------------------------------
TDEL0F03990        IIKEKKLHSSLDRKEDQEDLEDL--------------------------
                                                                    

FASTA FORMAT for MUSCLE Version 3.6

>KAFR0B05450
-----MGKKDKQRKRLRKFVQLK----EAQRLFDDPTTPIAKETILANAIPI--------
------------------------------------------------------------
------------KLETKLNAT---------LPTAKKEPDHELQRIKKG------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------TESCLFSPKLTTSNPLRETDL-----
------SLSTNE----RIIDKSVAITTSLRESHSLELG----------------------
---SEYGSIDFENSVAKDGNFNVCQ----------AHQIKISATR------------LHF
IIACIC-ISM-LSLGADFSFTLVSSPSISSEFDHLADFFI-IFGIYLLAI----PIAFYV
TSLTIKKYFISSTILSNLLALISS-LSCTYFKGLNMLVLSRILFGAA-CGSCCYIDLTLC
EKLVPTNTKNKYSNIALAHFGLGTIIPALL----LNRNILTEW--SSMETTITVIFAPLI
VSFWLALPKTDKNT------------------FEYSLHGMKMRHYLILLLTLFTTSALYI
IACS-SFDFPITYSSLSLWFTYLAVVFY-----------AAKES-------RNKGIYDAE
ISCWFLTGAYVSTTSFIFM-----LMEIQDLNTKSLYLSLTLSTFLGAVVAKKFLEDHI-
-YINMVIQLILLVLQGKVIDVHSF---VTSKTIYL-------TALTSTLMFSFGV--ALG
SYFSKLNK-----EKNIITILGEGTTSALFAIIVSGVPFKGIVQENLKRELSQYLPG--D
HSVDELKYAIKKALSSVEWIREDSPDLISTSIFSCYLDSIRYVFIFNLFCTCIGISF-FH
LARTHKQSSI---------------------------------------
>KNAG0H03180
-----MGKKDRQRHKVKKFVEKKKIVVDRSPSPLNELVAMEGTSSDGKLSVGNPEQCA--
--------------SQEVTVTGSSTGSGDKTSGRDMETSCSKDGTENALTEGVSNSDYTS
DRLLRKDSVPMDKDESVDHSR-------FVLERGGTDATTDVASAQDS------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------AKLAAVPSLRHETGTIRSVGS-----
-----SSEANQQRHKKNKKGADTVDLPVKRITSNFQMTPALCESTPILDSASEAPERPNS
DEFDGYAFSAESNRTSLRANYGSIHEFLP---E--SPTHPLSPVQSSTVRTVERSNLRQS
IGSTIF-SGMSFITGLDLMMIWSRSALISSDYNKFLSYFL-FPALYLFPIATSHFL--RS
RISL---SIRSNMLMSQLLSIVGF-LITALGRHFSVILLGRFFIGLGVSSHLITAPSTIE
SMRLPLPNFIFLQS-----FALGLLCGSLIPVNWQ-------WAQGIFA----CVYILMF
LTTVVAVPRGSHRRRNSVHDVRDHEDYV----WSVAFRLLNIMGISIMLNAVL----VYA
NAM---------YDNVGHWTIFV--FISGLV--------VGTD--LSKRY-------GSF
IEKWIISIISNALTFLLFVCYYKDIVGNAALF--------LLAFVWTVCFTTHYILQQRK
---------------------------DLQRSMWRNNYWKEVTAAGVAI-----------
-------------------------TGASI-------LFNVALRKSLWTALEQLVSE--E
HPQEQLQQILHRALESSHWIQHSAPEFAQETIYASFRHNFTTLFLAAITLLTTSLFC-MT
SNSAENV------------------------------------------
>NCAS0B03780
-----MGRKDKQRKKLREFAKLK----EKQRLLENKI-----------------------
------------------------------------------------------------
------------HHATPNGTQ------------KPTSELNTVQQLEPE------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------ESTPLLKTSNHETSTPAEKEMPDKRD
LKFPAPSFSTQYRNMALNIQDASAAQDPVPLPTEELRQQITSSDTTTIYTDNNTTSSLYA
RTTDGYGSIHGQSSNTSDIDLHVDTESSA------PQADLMTCVK------------SKL
LLTVLS-LGL-FMIFFEFSAMIELSSFILSGFDRFSQLALSLGSSFALIGLTLSALIEYP
KLC----TLKSSIIAGNVAFVVGS-LLIFNSKLYFSFGLGRCINAIG-AALIIYTTFTTN
LMAHELCKKYVYYLISM----LGAVCGTIT-SGVF-CDL---WRKIYIIPTILAIIQ--I
VLLFLYFPLDDITNKDEIS-----------------------------------------
---------------------------------------ISRKNLLDL------------
LPNMFSMLALIATLIYLPV-YSTIVWNESYLQLSIRVLPIYLSMFAVVLIQARYAK----
-KYNTSLLGSLVGLIG-YYQLYSL---DKSTPDWFHFVAGCIPLIGVTSVIMAN------
-------------TKNMRDFAVGILVGGSATIILCQGLFTRTLHDTLRDNLLKLQSE--G
LKKKELLKILEKTIKNPQWALIDAPAITRGAITNSFALAIHQIFLSLLVISIFIIIS-SC
LVSTHSDDNEAQ-------------------------------------
>NDAI0J01280
-----MGRKDKQRKRLRDFAKLK----EKQRQLHLDQFIATSDNLKNKLIA---------
-------------------------------------------------TSQNSVPQTID
EQPTGNIEDNDSTELTPLLLK------------------KQSENHIAV------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------AESSGIDALKSDTVEEPIEEE-----
-----VTSLAHQKQKNISDDNQLIEEPSRPQSSREEISSS-------ASTNEAPIVPHKK
IHSPSYGSIEQRLSHEEPAFTEEVVDLET---NN-RDISLLNEPQ------------LTA
GMIFLFSLLL-FTIIFDFTLAMMLSTTSGSHVKQSSNSSW-IIASYLITMYISQLL--TA
QVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMARFILGLA-SGSLIYVMLTII
NKCI-LNKR--FSRPSMKIFTIPIV-GGLS-LAYATAIFITSWQNVYFLLAIFSFFTLFL
IMFYFPSNESYKTNNTNLS-------------SIVATLDIDLIGCTILSVFLL----LIA
VITT-GNSNGFSITSPYSATLVISIILVGILLLLSETT-TNKNPIIPLDFIENKVIFFKS
LTVFFASMSLITFIHYFPF-YLEKTLNISLFDIYKRTSPMFLTILFIIITVSRRISTQNT
LSYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIGILPILGSTFLVIATLMDVTD
DKKLP--------IISTSSFAVST-LGSILGICISGFIFNQGLYDELWVH---------S
TEEKGLGKIIRKMINNSEY--ESSSRYYCYEILESYFIVSGYVFLFSAICLLVAVISFCF
TIKNKRHH-----------------------------------------
>Suva_2.279
-----MGKKDRQRKKLREFAKLK----NRQQNLRKSVQSLKKEVQRKSVAPENLNRIVFG
NLK-------REEASENSPLLPAPSEPREGSGPKTLNINANDTRSLPELPENSTSVETES
DDIEGKLAENANEEPPKFLSQEEPPKFLSREEPGKKSPSQNSVSDFSD------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------RSVSPLQSITSDNTPMSVHEV-----
-----PESLANA----LEGNGDIVVAQLDSCVPAINALPTSDLSPTSATSAPEVLVDRPQ
MRAYEYGSISRTVKDVENGTTSSYARVAS------SDKFVHDLTR------------RRI
FSSCMC-TYL-FFIAMDSTILMSIVSKIASEFHELWRLSL-IISIYLLSNAIGQLV--FL
KLSIVT-SVKLLLCVAQFSFILGS-YLSWSAFHFWTFVFARSITGFG-SGALMALKSTIM
NRFSDKKKNGYSLSASVIVFSLGVAIGPFL-VYLFDNSRGSGWKNAFLIPVPFCLVNASI
MLADIYSIKDNLHHGGSAPISWKR--------IKKILMSPDLYEILTLALLLL----CFV
QVTS-LDITRLEHSAVIQGVLFFVIITCGILFWWIETNETYANSIISMSLRGDKHLMWTI
MGISFCFAALMCIIPFGTT-YFTIVLNISTLQIAERLLPLSVAIVVGYFSVCYFWKPQMK
-NYLLEVVLGGVTLIL-YIALMGA---SLSLPVWKQYVCLSLPLLGSAMILT-----LLS
SLYHEYHQPKKSPISGSIVYCFSA-MGGTIGISLGGYVFHKTLLKAVHDGVMKFSKH--G
YHEKDLLKIIEHATQSSDWVHESAPKFIFQTLIECYLQACRNVFKLSAILFTITVMT-MF
FFN--RVN-----------------------------------------
>Smik_4.363
-----MGKKDRQRKKLREFAKLK----NRQRNLKESVQNLKKEVQQKAVCSEHLDLVQLE
NDKSEEINDESEEINENVPLLSTHGGQKEEKVSKVPDVDTINTHPLHS-SKNDDSHQTEA
DCAERKSGNKTDHDYPKSLSQ---------DEPGIKLPLQSSMTDFTD------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------RSISPLQSITSNNTPMSEHEL-----
-----PASSTNS----LERGDNMPIVQPSSQIPTGQILSM-------AASPPEVPGGRAQ
MDPYGYGSISRTIEDVESGANPTYVANSS------SDELVHDLTR------------KRI
FSSCMC-TYL-FFIAMDSSIILVIASKIASEFHELWRLSL-VISVYLLGNAIGQLM--FL
KLSLVS-GVKLLLCVAQFSFILGS-YLSWSSIHFWTFILARSVTGFG-SGSLIALKSTIM
NRFSQKNENQYPLSTSMTVFSLGVAVGPFL-VSFFDSSHGSGWKNAFLIPVPFCLVNASI
MLADIYSVKNTIHHEGPTTTLQKR--------FKKVLWSPDLYEILTLALFLL----CFV
QATS-LDSTRLEHSTMIQEIIFSVIIICGVLFFVIEKSDVRMNSVFSLSLQGDKHLIWTM
MGIFFCFAALMCIIPFGTT-YFMIVLNLDTLEIAERLLPFFFSIVVGYFSVCYFWNSERQ
-NYLFKFVLSGVTLLL-YVALMGM---NLSLSVWKQYTCLSLPLLGSSMILT-----LLS
TLYHEYHVQRKSPISGSIAYCFAA-MGGTIGVSSAGYVFHKTLVRTMNEEVMKFSKQ--G
YLKKDLFKIIKHATQSSNWVHKSAPKFIFRTLIECYLQACRNVFKLSALFFTITVVT-LF
FFN--RIH-----------------------------------------
>Skud_4.379
-----MGKKDRQRKKLREFAKLK----NRQQKLQNSVQNLKNEVQREVGESENPNPIAIE
NDK-------SEENKENTPLLLTSSERREDDGSKPLDIDTFDTRPFQERSKSGNPVQAEG
DDMEGKSEDKADQDHHKFLSQ---------DESGTKSPLQNSMIDFSD------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------RSISPLQSITSDHTQMSEREL-----
-----PGSSTNS----LEGNGDIHVAQSESERPTSKTLAT-------ATSAPAVPVSRAE
ISPYGYGSISQTIEDVEDETDPSYIASTS------SDAFVHQETR------------RRI
FSSCMC-TYL-FFIAMDSSILLVIVSKIASEFHELWRLSL-IVSVYLLSNAIGQLL--FL
KLSIIS-SVKLLLCMAQFSFILGS-YLSWSSSHFWTFIFARFVAGFG-SGSLIALKSTIM
NRFSQKNESRYSLSASVIIFSLGVAIGPFV-VGLFDSSHGSGWKNAFLIPVPFCLVNASI
MLADIYSVKDNLHHEGSTFTLWKR--------VKKILLSPDLYEILTLTLFLL----CFV
QVTT-LDLTELEHRTMIQWVLFSVILICGVLFWLIEANDTYMNSVISMSLQGDKRLIWTV
TGISFCFSALMCIIPFGTT-YFTIVLNLNTLQIAERLLPFFFSIVIGYFSVCYFWKSKKQ
-NYLLKFVLSGVTLIL-YITLMGV---GLSLPVWKQYVCLSLPFLGSSMLLT-----LLS
SLYHEYHEQRKSLNSGSIVYCFGA-IGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQ--G
YLKKDLLKIIKHATESSDWVHESAPKFIFKTLIECYLQACRNVFKLSAVFFTIMVIS-MF
FFN--KIN-----------------------------------------
>YDR119W
-----MGKKDRQRKKLREFAKLK----NRQRNLRKSVQTLKNEVQREAKVPRTSNQIALG
NDK-------IEEINENSPLLSAPSKQEEVSIPKAVDIDTIDAQPLHEGPKIDDSPQDEV
NSIKGKPADKANEDDLKPPSQ---------HEACGNSALQSSITDFSD------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------RSVSPLQSITSCNTPMSEHEL-----
-----PVSSSNS----FERADDMPVVQADNQTSSSKSLHI-------VAPSPEVPVSGDE
ITSYGYGSIPQSIGDVENGLNPPYVENTS------SDELVHDLTR------------RRI
FSSCMC-TYL-FFIAMDSSIILVIASKIASEFHELWRLSL-VISAYLLSNAIGQLV--FL
KLSLIS-SVKLLLCIAQFSFILGG-YLSWSSAHFWTFIFARCVTGFG-GGSLIALKSTIM
NRFSQKNDSRYSLSASMITFAMGVVIGPFM-MNLFDSSHGSGWRNAFLIPVPFCLVNASI
MLADMYSVKSTL-YGRPTPTLWKR--------FKNTLLSPDLYEILTLTLFLL----CFV
QVTS-LDLTGLKNNTMIQALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTM
IGISFCFAALMCIIPFGTT-YFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQ
-NFLLKFVLSGATLLL-YVALMGV---SLNLPVWKQYICLSLPFLGSSMILT-----LLS
NLYHEYHEQRKSPISGSIVYCFGA-VGGTVGISLGGYVFHKTLIKLMHEKVMPFSKQ--G
YLKKDLLKIIKHATESSDWVHESAPKFVFQTLIECYLQACRNVFKLSTLFFTITVVA-IF
IFN--RIHCRSQNCLSLS-------------------------------
>Ecym_4298
MGRKRSGIKTKERNRLKEFAKLK----GRQRTLKSDEAGETYLGDK--------------
------------------------------------------------------------
------------------------------SNTISFGPYSRSSDESQG------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------ETIPFLTRIDKNVIQDTSSGR-----
-----PGFVINK----LEVQELSLGSAGSQSTTILNS-----------------------
----SYGSTSTTVTPDSNKNGNVFIRSSSVEVGNIGDSQNISQIR------------FAA
IVSSLV-VGV-FLGSLDGTILSTLLDYIASEFEALPYISW-IAASYLLSACIFQPL--YG
KLSDIF-GRKAILLFSNLMFGLGC-LVCGTAPTVWWLLAGRFVAGIG-GGGLTSMPSIII
SDIVPLRSRASYQDLFNICYVLGITLGGSM-GGWL-AEY-GGWRLVFLLQVVAALISGCF
IQAFLILPKVHHGNGIALANKES---------LKTKLYMMDWLGTFCLVIFLA----SLT
LTCS-L----VDLNFNFLLLLILLMFVSGYYFVYHELN-IAADPILSVHLLTDRNVLASS
LANFFCMLNDVLTIFYVPM-YFASVLYMGPKEIGKRTIISFLGTSIGSFGTGYYIKRRGK
-YRTFICLACIIGILG-QLQIALI---KPSISTWRQYLLLLIPILYTTTVRTSLLISLIA
AVPYKNQT-----AAASISYTFRS-TGAILGASLGGGIFRSSLKSLLNTNIMPLESE--I
HPKSQLLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSIS-CY
FLKEYPVHASQPQEYISQDSMDTYNDQTPK-------------------
>TBLA0F03040
-----MSKKQKQRKKVRSKKRKQ----QKSKGPVQETTPDKSLSNELLTENNKIEQQDVP
EVHENRQDETDWVKSDKVETVKVFNDKPSKTTEPAIQLSNTATSIIEESTPSNPITEDTE
STPDSNITLKASEPVPDDTPKANKIIIQPVNTTASIIEDQLPSMPMEGTPNAKATQQVLG
DTPKVNIATFPPSNATTSVIEASNSLTNDTTNTTDIVITDFSKSTESATITDTPKTNESG
TAIPESNPLKSLTKKDSISTTDGNGTLEANESSVINETIGASINNLSLGNEEMISIITGS
SCNRSLNHTTETIYNPSTSQDYASVATGTTNNNLDSSQILKPIRDEFIQDASTDI-----
-----AGFVAGE----LEEIEEEAREAREGEEGEALITST--------------------
---ASYGTLPI------------------------EPSVEMSNMK------------MNI
IMCSMY-LGV-FLAALDNTVVSTLMAHIGSEFNQIPKVPW-VATSYLLSSAVFQPL--YG
KLSDIF-GRKALLIFSNLIFFFGC-IICGMSNSLNMLVWGRFVAGIG-GGGITSMTTITV
SDIVPLRSRAVYQGICNFFFGLGTAFGGVI-GGIF-VDHQYGWRMVFWSQVPVSGLSTLL
ICSFLVVPRIKNYEVS----------------LGRKLMRVDWLGSISMILWLT----SFL
LITTMMGGISLDIDSDQFHYLIMFSSVSAIIFVLTELF-VASDPVLPLRFLSNRSVLGAS
LGNFFCVMGFMTICFYLPI-YFASVLDISPTGIGKRMAPNFLCTALGSLGAGVYMKQTGK
-YYWFVVLFALVSTLG-HYYLTLI---PLTVSITVQYLLVVLPGVGSSIIIVVALLAMIA
AVPHKHQA-----ATTSISYAFRS-TGGTLGVALGSSVFHRTLIKRLHTDVLEYVSP--E
HPRKELLRIIKKASHSTEWVHRKAPTFIRDTLITCYDVACHDVFVFCTACALLAAIS-LA
LIREERLATGLRAT-----------------------------------
>AGR076C
MGKRRKGLKTKQRDRLREFAKRK----ERQRALAGQNQAGVGQDAQ--------------
------------------------------------------------------------
-------------------------------------PARRQHRPRAG------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------EQSGLLEASRGTLVSDPSSGL-----
-----SGLVASE--LEVQRQQEVCAAVTAESMATSGSGS---------------------
----SYGSTQKPTEVYLTATAVEAAK---------EDAGGLGATR------------RRV
VMASMC-LGV-FLAALDGTIVTTLLDHIASEFNELPRISW-IATAYLLSSATFQPL--YG
KLSDIF-GRRPLLVFSNLVFCLGA-LICGMSKNLWVLVLGRFVAGIG-GGGLTSMCSITT
TDIVPLRSRALYQGICNVFFGLGTACGGLV-GGLF-ADRAVGWRMAFLVQVPLTLLSTTA
IQLFLTLPKPVDAHKGAGQRSIP---------WTTKLRMVDWTGTVTLVVFLF----CFT
LVCS-LYGEDLPH----LYLIFVVILLSGSYFIYHELY-VATDPILPIRFLENRSVLAAS
LSNWFCMMGMMTTGFYIPV-YYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYYMKRTGK
-YYWFLLAFCLVGVLG-QVQISYV---TPSISTWRQYCLYMIPGFGSAVLLTVTLLALIV
AVPQRHQA-----ATTSISYAFRS-TGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSP--E
HPASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVA-CC
FIVEYKLHAGNTAPRPQRERTLNLSTLFVPKDYILIINVFTYSLYAPHF
>KLTH0G13464g
-----MVQS---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------EHSPLLTPVDRDAMQDPSTDL-----
-----PGFVANQ----IEQQDHLLDIEQGR------------------------------
----AYGSTTKSSISSENEREDAGGATVA---GCGSAEFYLPSSR------------ILI
IMFSMF-LGI-FLAALDGTIVSTLLTHIGSEFNSLDKASW-IATSYLLSSSTCQPL--YG
KLSDRL-GRKPLLVFSNAVFAIGC-LICGLSNSIWAVVAGRFISGIG-GCGLTSLATMIM
SDLVPLRDRAVYQGLCNFVFGLGTASGGLV-GAYF-RD----WRLAFILQCPISVLSGIL
IVVYLELPPRASASNKDC--------------WSARLRRLDWAGATSLIAFLF----LFM
LTSS-MGGSSVAYGSRLFAAMCAATLVFGAVFVYVELR-VAADPVLPVTFLRDRSVLGSS
LANWFCMMSMMTTNFYLPV-YWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTGK
-YYYFLLAFCVLAIAG-QVQIVLI---TPQMPVWRQYLLQVVPGFGVSVLITVTLLAMIA
AVPHEHHA-----ATTSISYAFRS-TGATLGVSVGAAVFRSSLTSLLDAKVMRFASD--G
HSERELRGIIASAARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVS-CS
IIKEHKLHTSIKRGS----------------------------------
>Kwal_56.23754
-----MSPG---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------ERTSFLAPIDKDVIQDPSTGL-----
-----AGFVANE----VEQQDYNSRTGHD-------------------------------
----SYGATAVDDRTATSARCDLTFPPSE------TPEFALSSSR------------IRI
IMISMF-LGI-FLAALDGTIVSTLLTRIGSEFNSLDKVSW-IATSYLLSSSTCQPL--YG
KLSDQL-GRKPLLVFSNVVFSIGC-LICGMSTSIWWVVVGRFVSGIG-GCGLTCLASMVI
SDLVPLRERAVYQGLCNFIFGLGTASGGLV-GAAF-QD----WRMAFTIQCPISLASCAL
IVSYLELPPRHEDDKDRH--------------WTSKLRDLDWAGVVTLVCFLF----LFM
LVSS-LGGKEIAYDSVLFALLCVTTLVLGSIFAYVELY-VAVDPVLPIAFLKYRSVLGSS
LANWFAMMSMLTTNYYLPV-YWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGK
-YYWFLLAFCGIGILG-QLKINLL---TPATPVWQQYLLLVVPSFGLSVLITVTLLAMIS
AVPHEHHA-----ATTSISYAFRS-TGATLGVSIGAAIFRSTLNTLLQNKVLQFASD--E
HPREELLRIINNAAHSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAGAS-CS
IIQEHTLHTTLKRDK----------------------------------
>TPHA0A01750
-----MVENDVIS--------------NIGDDSLSHVPPRVQE-----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------DKSPLLHAIRGELLQDSSFSL-----
-----PGFVAAE----IEEREELYREASIASNQHH-------------------------
----DYGSVANSIILD-------------------NDKNNLSPTR------------LRL
AMSSMY-LGI-FLSALDNTIVSTLLARIGSEFNELPRISW-IATAYLLSSATFQPL--YG
KISDIF-GRKIVLTFCNVNFFIGC-LICGTAKSFWVLVIGRFISGVG-GGGITSMSTITV
SDIIPLRNRALYQGVCNFYYGLGIALGGII-GGWF-TEKLGSWRGAFLFQVPLSVISTVT
VMVWLQLPKDSKSYGLEITMSNNSSNNGTESIIMKKLKTIDWYGAMSLVIFLL----SFM
ILSS-AGGSDISVKSNTFLYLTLISVTSFISFIYIELK-FAKDPILPLVFLKDRSVLGSS
LSNWFTMMLLMTISYYLPI-YFTSVMGIGAYDVGKRTLPNFFSVAFGSLGAGYYMKKTGK
-YYWFVTFFCLVVVIG-CLQIYLI---NDGISVWRQYLLSFVPGLGAAVLITIALLSMIV
AVPHEYQA-----VTTSISYAFRS-TGCTLGVSIGAALFRDSLNKYLRAKILELGSQNGN
YSEKELLQIIDHASKSIDWVHNEAPRFFKRTILECYHYACKKVFLFCLICSVLALLS-IS
MIKEHKLHSSLDRKEDDTPGSEEIQDSMN--------------------
>Kpol_543.44
-----MGKKDKQRKKLRNFTKAKVKQVQEDQEPMVPDPPEFDGTESFVQTLAETSQLTKE
D-----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------DENSVLLPIRDELLQDPSTEL-----
-----PGFIAAE----IEEGEQEYEETRSG------------------------------
----HYGAIESRRIS--------------------SKGTELSTAR------------LKI
IMLSMY-LGI-FLAALDNTIVSTLLAHIASEFNELPRISW-VATAYLLSSATFQPI--YG
KISDIF-GRKVVLIFCNITFFVGS-LICGLSPSFEWLVAGRFIAGIG-GGGITSMSSITT
SDIVPLRNRALYQGICNFYFGLGTALGGVV-GGWF-SDRSVGWRMSFLIQLPIAFFSTIL
IILFLRLPKESKGRGLQVDGNYFST-------IKVRLSAVDWIGATTLVLFLF----SFM
ITAS-LGGKEIPYTSHKFIGLCVVTVIGALIFGYTELK-IAKDPILPLRFLKDRSVLGSS
LSNWFCMMALMTVSYYLPI-YFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGK
-YYWFVISFCVLASIG-CLQIVWI---QPDISVFKQYTLMFIPGLGASVLITVALLAMIA
AVPHNHQA-----VTTSISYAFRS-TGCTLGVSIGGAIFRESLDNLLKSKVLKFKSP--E
HSEDELMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFS-MA
IIKEHRLHNTLDRDNENEE------------------------------
>KLLA0A04631g
-----MVES---------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------DRTSLLQPVRNALNPELSEGL-----
-----PAYVGAE----VAETEHL-------------------------------------
--------LESEDEAREG-----------------LQVSEMSRAR------------LHI
IISSMC-LGS-FLAALDNTIVTTLLSHIASEFNELSHISW-IATAYLLSSATFQPL--YG
KISDIF-GRRPLIIISNLFFILGC-LICGLSKNLWTLVAGRFIAGIG-GGGVTSLGSITA
SDIVPLRSRALYQGIFNFFFGLGIAIGGLI-GGWF-SESKNGWRMAFLVQVPLCAISLVL
IIIFLKLPPGCKGLGLVSNDKDGKVD------IKDKLKRIDWLGSLSLVTFLF----AFM
LASS-LGGKEIPYNSNIFKLLVVATILSGTAFIYVELY-ISDDPILPIRFLTNRSILGAS
FANWFCMMSGVTLAFYVPV-YWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGR
-YYGFLLKFTGLMVLG-QLQVLLM---KPDISTWRQYILLPLPHFGSSVLITVTLLAMIA
AVPHEHQA-----ATTSISYAFRS-TGSTLGVSVGAALFRNKLSGSLFDSVMKFESD--K
YSKEYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISIFAWIS-CG
VIKEYKLHTSMERK-----------------------------------
>SAKL0H16808g
-MARKKNSKNKQRKKLQAFVKLK----ERQRQLLNDEPKVVIQQNPAHSIEPT-------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------ETTPFLQPIRRELVLDPTSDL-----
-----PGFVAGE----LEEQEERCAEEQTNAS----------------------------
----GYDSIKKNTVATAKTIDLETSSIEA------KNNTGLSPAR------------IKI
IMGSMY-LGI-FLASLDNTIVSTLLAHIASEFNEMPHISW-IATAYLLSSATFQPL--YG
KISDIF-GRKPLLIFSNVMFALGC-LICGLSPGLWCLVAGRFIAGIG-GGGLTSMSSITT
SDIVPLRNRALYQGICNFFFGLGTACGGLV-GGWF-SEHGGGWRVAFLIQIPLCAISCSL
IVAYLELPKGCKGSGIQSDEDNQ---------ISEKLRRIDWFGALSLVVFLL----LFM
LASS-LGGKELPFQSNGFYALCVAIVVGGATFVYVETY-VSKDPILPVAFLKNRTILGSS
LANWFSMMGMMTTSYFLPV-YWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGK
-YKWLLMAFCALAVVG-QLQISLI---EPNIAVWRQYILLVIPGFGLSVLITVTLLAMIA
AVPHEHQA-----ATTSISYAFRS-TGCTLGVSIGGAIFRKSLGSLLERNVMKLASD--K
HPREELAKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFCALLS-CI
AVKEYKLHTSMDRQAEEEEEEEEANST----------------------
>ZYRO0C01430g
-----METNNSKNDLT--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------SRTNFLNPVRDDILQDASTDI-----
-----PGFVAEE----LEEREELYRECQGT------------------------------
----DYGSIDNEDDSRDG-----------------VASSPVPPDK------------LLV
ITLSMY-LGI-FLAAADGTLVSTIMAHIASEFNELPRISW-IATAYLLSSATFQPL--YG
KLSDIF-GRKPLLMLNNIVFLVGC-LMCGLTPSFWGLVGARFISGIG-GGGVTSMCSITI
SDIVPLRDRALYQGMCNFFFGLGTACGGVV-GGWF-SDHGGGWRMAFLIQVPLSALSSLL
IAVFMKLPPRSKRVNSPAS-------------IKNKLLSVDWIGASALVVFLS----LFL
VTAS-LGGKEIAFNSKTFVALCIGSSLACAFFIGVELY-GAKDPILPLSFLRNRSVLGSS
FSNWFCMMAMMTTSYYLPI-YYSGVLNMNPTRVGKRLMPNFFSTALGSLGAGYYMKRTGK
-YYWLTVGFCTLSLLG-HLQINLM---KPDIATWRQFILLVIPGFGYSVLITVALLAMIA
AVPHNHHA-----ATTSISYAFRS-TGSTLGVSIGGAIFRQSLNGLLSRKVLKFADK---
HPRKELLEIIEKASKSSEWVHDSAPEFIRPTLIGCYHFACKDTFLFCTLCSIGTLAS-IS
IIKEYKLHASLDRKN----------------------------------
>TDEL0F03990
-----MGKKDKQRNKLREFTRQKQLQQAKKNDMLEETRPLVAPSSAEP------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------IEASLLLPIKPEILQDPSTDL-----
-----PGFVAEE----IGQQEEVAN-----------------------------------
----GYGSITDPHDGDNKSERPV------------STAEEISGAR------------LRV
IMLSMY-LGI-FLAAIDNTIVSTTSAHVASEFNQLSKVSW-IATSYLLSSATFQPL--YG
KVSDIF-GRKCLLVFTNVAFLIGC-LMCGLSKSFWWLVIARFVAGVG-GGGLTSMSSITI
TDLVPLRERAMYQGICNVFYGLGTACGGIV-GGWF-SDNKGGWRMAFLIQVPLSAISLLV
IILHLKLPSKRATRNQDNS-------------IKRKLLAIDWLGASTLVIFLV----LFL
LTAS-LGGKEIAYGSRTFALMLISSLLSCLVFIYVELR-VAADPILPLRFLAIRSVLGSS
LSNWFCMMATMTTSYYLPI-YFSGVLNMSPTDVGKRLMPNFFSVAFGSLGAGYYMKKTRK
-YYWFSLIFCAVAVLG-QLQILLI---DPKIPTWRQYILLLVPGVGTSVLITVALLAMIA
AVPHEHQA-----ATTSISYAFRS-AGCTLGVSIGGAIFRESLSKLTTRYVLRYISK--E
HPKEELLKIIDKASESSEWVHHSAPDFIRQTLLECYHKACKNTFLFCFICSILTLVS-FS
IIKEKKLHSSLDRKEDQEDLEDL--------------------------