MUSCLE (3.8) multiple sequence alignment

KLLA0F19316g       MSFSIDSELLLQKYACGYSATVSDDQSLVCLWN--------VHNNIEIYRTNG-GYLINR
AGR078C            --MTQWKVKLTKQW----------DGKLEPFWN--------DRLSLWGVLEKE-VLSIFR
Ecym_4300          --MTQWKVKLTKQW----------DGLVDPFWN--------DRLSLWGIHEKG-NVNIFR
SAKL0H16852g       --MVKWEVHSVKTF----------PGEQRIVWN--------PVLSLFLVPTVK-GIAVNR
KLTH0G13508g       -MFDKWQFKRLIKL----------PKHRGVVWN--------PRLSLYLVLGDK-TVSVNR
Kwal_56.23766      -MTSNWKLKGVVTL----------PKGHKVVWN--------PRLSLYLVLTDK-KIAVNR
TBLA0C04570        -----MSSVSFIEN---------------PKSN--------PTLPLTLCKSDS-GLKVIR
NDAI0J01270        MNHQQSQYPHQKGH-------------RDEQWNFAPISYINPSFPLYLTKTSN-SIIARR
NCAS0B03790        ------MSNLTEEL---------------VSYN--------PSYPAKLYKTSY-GFAVRR
KNAG0H03190        --MTEDALYARQFY---------------TEVN--------NVLPLYVTRGTK-QLVVNR
CAGL0B01859g       ----MGEDIVLDRF---------------LKYN--------PKYGLFGMNEDNHSLVIRR
KAFR0B05460        ---MNELNPKERSY---------------CVYN--------KKLPLYTEKGPK-GLMVYR
TPHA0J00790        ---MTEHSDSQLYY---------------YKLN--------PIYQLYTFKSDK-GLAICT
Kpol_392.1         ---MVIDSGIRLYY---------------SKYN--------PCFQLYVTRSDQ-GLAVYR
Suva_2.277         ---------MNDYF---------------IDYN--------PRFPIFAIRVVK-GLAIHR
Skud_4.378         -----MSPPINDYF---------------IDYN--------PRFPIFATRITK-GLAIHR
Smik_4.362         -----MPPPGNDYF---------------IDYN--------PRFPIFATRTAK-GLAINR
YDR118W            -----MSSPINDYF---------------IDYN--------PLFPIFATRIAK-GLAIYR
ZYRO0C01474g       ---------MDQDY---------------VDYN--------PVYPLYVKQFTR-GFSVHR
TDEL0F03970        ------MVVTELDY---------------RCYN--------PLYSLYAKKFNK-GLSICR
                                                   *                           

KLLA0F19316g       LNDEI----------QNHRLIDVVWH---GNDLFCCYNSGTVSIYR--------EGRELV
AGR078C            YIDGRRVGAIPLRLRQNEELLRCQWEPDDGELFAVALRSGSVKIYRGRLDPEGTEGSEGA
Ecym_4300          YIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSGSVKVYKGRQDVDSSDPTDGA
SAKL0H16852g       PVDGQRIATVSVK--DHGTIVDYQWEQSEGRIFAVCHSNGIIRLY---------DSSLAG
KLTH0G13508g       AIDGQRIAAVNLR--GDGQLIGAQWELAEGKLFALFFGNGAVRIY---------DCATGG
Kwal_56.23766      VIDGQQIAAVNLR--DEHEIVGIQWEKNESKLFAVFQSNGVVRIY---------DCSIGG
TBLA0C04570        TADKSIIINYKIR--NKNDIIYYQWENNIGNYVAIFFQRGTVMIY---------DGIKTS
NDAI0J01270        TLDGFQISNIIIR--NMQNVIAIDWDSKTGKYLTINFDDGTFRIY---------DIFQDG
NCAS0B03790        TRDDTQIVKIVIR--NMDAVIATCWNSFGSNYLTVMFNDGSARIH---------DIFREG
KNAG0H03190        DTDDSTIASTFIR--DPSQVVSYQWDTIGGEIISVMFQDGSIRIN---------DVMYDA
CAGL0B01859g       TSDNVGIVKINVR--NIVLLLDYFWDPIDGKYLALFLKDGSVRIY---------DIFNGG
KAFR0B05460        RSDNTAIAHTIIK--KWELVAGIYWDKISGKYLSIFFRDGSIRII---------DVFKDG
TPHA0J00790        ISDHSILATIFIK--DFSLVVDFFWDSITGKFLLFAFNDGSIRVY---------DIFKLG
Kpol_392.1         IKDSSQLAHIFIK--DFDTVAGYEWDNYSGRFISVFLTDGTIRIY---------DIFKNG
Suva_2.277         VSDHARLAVIPVR--NIALVANYNWDVSTGKFLSIFFKDGTIRIH---------DIFKDG
Skud_4.378         VSDHARIAIIPVR--NIALVANYSWDRTSGKFLSIFFKDGTVRIH---------DIFKDG
Smik_4.362         VSDHARLAAIPIR--NINLVANYNWDTVTGKFLSIFFKDGTIRIH---------DIFKDG
YDR118W            VSDHARLAVIPIR--NINLVANYDWDTTTGKFLSIFFKDGTIRIH---------DIFKDG
ZYRO0C01474g       MADDARIATIIVR--DMSQVAGYQWDPITGKFLSIFYKDGTVRIY---------DGFRSG
TDEL0F03970        VADNAKIATVAVR--DLNVLAQFQWDPITGKRMTVFYKDGNARIY---------DAFQAG
                     *                :         .  .      *   :          :     

KLLA0F19316g       KQLTFI---------PKGAKTKCILCDNLVPS-DDRYSL----SDGN-LLNSMPKLNKW-
AGR078C            ELVGTVVLGR-----GDAFQMEQFVWNRIKWRVREPFCGE---FDSP-LVQWLPRLTEMS
Ecym_4300          DMVGTIVLGR-----GEWFNMEQFVWNRIKWKSRGAFKGD---FDTV-LTQWLPKLTEMN
SAKL0H16852g       KSVGSVILGD-----SDCD-VLKFCWSQDSWTFGSKFSNV---FDHE-ITSLMPRLVKF-
KLTH0G13508g       SLREVVDLVDEGQS-ADVT-VDTAVWSGAQWA-QFRQEYK--GLNIE-ITKQLPGMVRL-
Kwal_56.23766      SLREMVNLVEEGQA-AEVK-VDAVVWMTVEWA-KFPESYR--GLDFD-ITTLMPGMVRL-
TBLA0C04570        RLLAMLN--------GGKPNVDAGIWDRYYFPNDNEKDI----FDSD-ITLYMPTLIQI-
NDAI0J01270        KLITLVRPQRNLLDIHRKTKVDNAIWDRLIIL-NSIQELE---FNHD-ITKLMPTLIKF-
NCAS0B03790        KLMTLLRLQD-----GFQKCMDTGIWSKLEVR-QKPNEGE---FDRD-ISGLMPSPIKF-
KNAG0H03190        KLVALLRT-------QRTG-LDCVLWDRIRLP-SRAQSME---WDPDIITQSLPRLVKF-
CAGL0B01859g       KLISFLRVLPVVLG-SNKPSLDCCLWDRIIIPKSGSSELR--IPNND-LTESMPTLVKF-
KAFR0B05460        KLVAFLRT-------QFKN-VDCTYWDRIEE--QTTNEMK--QFNKN-IVDLMPSLIQF-
TPHA0J00790        RLVSFFRS-------PLKQ-IKCVYWDRIIITETLDQQLK--IFDYD-LTNSMPTLVKF-
Kpol_392.1         RLVSYIRS-------SSQKNVDSCLWDRAEF--SIPSKLQ--LFDSN-IIECLPTLIKF-
Suva_2.277         RLVSFLRI-------PRTK-ISRGIWDRIPLK-YESSNRN---FANN-VIDVLPKLIRF-
Skud_4.378         RLVSFLRV-------PSTK-ISRGIWDRIPL--KREYDSE--TFAYN-VIDILPKLIRF-
Smik_4.362         RLVSFLRI-------PSTK-ISKGTWDRIPLE-SESGNGN---LAYN-IIDYLPKLIRY-
YDR118W            RLVSFLRI-------PSTK-ISKGIWDRIPLR-YEPNNRD---FACN-IIDDLPKLIRF-
ZYRO0C01474g       RLVSLLRA-------SSNG-AVSGIWDRIELL-HSEENIKDWSIDHD-VTEMMPKMVKF-
TDEL0F03970        KLLALLRI-------SKTR-VDGAIWDRIELS-RQEVTFK---FDHF-VLNSMPKMIRF-
                        .                                          :   :*      

KLLA0F19316g       -------DMIKNELDNEL--ILNSELG-----------------------KKKPIDIFMA
AGR078C            ISAQGKLLCTPLGYEGPE--WNAGLAA-------------------------DESNMFLT
Ecym_4300          VSPQGKLTCTPLEFEGPE--WNASLSE-------------------------NESNMFLT
SAKL0H16852g       VKDSRQLTMLPTDVGDGVPRWSKLDGN--------------------------KSFIFLG
KLTH0G13508g       VRDAKQLSVVPLETGKLR--WLADPGK--------------------------DAAIFLG
Kwal_56.23766      VRDSKQLSLAPLDLGKLS--WLDGKYG--------------------------DAAIFLA
TBLA0C04570        IRDKEKICPGTYFPPHST--WRAKKEE---------------------SLKNEFLDIHLL
NDAI0J01270        VKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYLDLHII
NCAS0B03790        VNNAGQLEVVPYVVTQTQ--WRNVDKP---------------------LEVNDIIDIHMA
KNAG0H03190        MGSDASPSMSPYLPTNHS--WRFPNSG----------------------AAGGILDVHFL
CAGL0B01859g       VQDAKQIDIIPNRSITKL--WRSIGNN-----------------------EKKVVDVHLG
KAFR0B05460        VSSANKLSLIPYTPSNAN--WRELDAK---------------------WKKNRVIDMHCL
TPHA0J00790        VKDPQGLQLVPVLKNTQA--WRQIDVDLNLKLENSKTE----------VSTDDVLDIHLL
Kpol_392.1         VKDSRNINIIDYYPPNHS--WRHVDKE--------------SQDTDKEIDFRNLLDVHIQ
Suva_2.277         VKDSKRVTIAPYTPPNSL--WRGPDED--------------------DPENCENLDIHVI
Skud_4.378         VKDSKRVSIVPYTPPNGL--WRGPDED--------------------DPESGEILDVHVI
Smik_4.362         VKDSKRINIVPYTPPNSL--WRGPDED--------------------EPENNEKLDIHII
YDR118W            VKDSKRINIVPYTQPNSL--WRGPDED--------------------DLDSNEKLDVHVV
ZYRO0C01474g       ARDSRQLCVVPYTLPSDV--WRPQAAD----------------------DTNALLDAHVI
TDEL0F03970        ARDTRQIFILPYEPPNKT--WRLATEE----EDGVKRE-------------KEILDVHLV
                                                                            .  

KLLA0F19316g       IDS-KTNKLILSIEGTLNIKV------------GEKLKLPKDIKRIIKVS-SGK---YMC
AGR078C            FDN-NTRKVVLSIDGTFNFRY------------GEKSKFPTKVTSILPGN-ENH---YVF
Ecym_4300          YDN-ATRKVMVSIDGTFNFRY------------GEKNKFPTKVTNILSGN-ANN---YVF
SAKL0H16852g       YDS-KRQKILMAIDGAFKLSFSVAALVAAGERLDEGDSVPNNVRDILKYD-NGE---YLV
KLTH0G13508g       HDE-KSGDYLMTVDGLLSVRV--------------PSGIKKMHKILRQGE-DGT---FVG
Kwal_56.23766      HDC-ESTEYMVAIDGQLSLRF--------------PSGIRNVHKILPQGG-SGS---FLA
TBLA0C04570        HHS-VDDSFTFILNGELKLPF-------------PSNSTSGRAIGIIKGE-NNC---FIC
NDAI0J01270        HVI-DPDCFTIAINGTYQINL---------VRKTINTTNRNKIVRILKSTVHGV---YHC
NCAS0B03790        HNS-NTDEYLLMINGVYKLTI---------QPNSTDENASNQLHKIIHLEKTAI---FHC
KNAG0H03190        HQK-LGDTLVALLNGEYQLQL-----------TGPHQEDQSELRKIIART-DSKRHVYNC
CAGL0B01859g       YSC-SSAQVTILINGEYLIEK----------SVSDINQIQKKIPISLNKK-EFCEAIYEI
KAFR0B05460        HQS-ETDSFLMVLNGDYYLTL---------KTPETDLSEKVPACSLIKSA-NSL---YQC
TPHA0J00790        YTESGMDNFAVLVNGVYDLSD-----------IHVPNRSPNKVIKLVKAS-QGK---YLG
Kpol_392.1         HNP-NEDNFTIILNGVYEING-----------IVMPDISKSEVYQLLKLH-NGE---YMS
Suva_2.277         FNE-GNDKITVFFNGDYAILL-----------PVSDIENEKILKSVVKVQ-NGF---YHC
Skud_4.378         FNE-GNDKITIFFNGDYTILL-----------PMDDIENERILESVVKVQ-DGF---YHC
Smik_4.362         FNE-GHDKITVFFNGDYAIFV-----------PVGADENERFVKSIVKIQ-DGF---YHC
YDR118W            FNE-GNDKITVFFNGDYAVFL-----------SVDNIENENSLKSIIKVQ-DGF---YQC
ZYRO0C01474g       R---CHDSLSVMFDGEFTISI-------------QLAAIPSPLVKFVSAQ--HQ---YLA
TDEL0F03970        HQE--DNGLVLMLDGDFILRL-------------AAGPSGPALKDIVVAD-RGL---YHC
                               .:*   .                                      :  

KLLA0F19316g       LG-KDWSYQVLDL-TFLQDPNIYKLIKTTQEYSALLRYLKQLHRHLRMKLTEPYFEFV-E
AGR078C            INDEDWQLQVIRL-EFTEYHQVHELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFT-G
Ecym_4300          LNDEDWQLQIIKL-EFTESHQMHELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFI-N
SAKL0H16852g       IT-DDWYIQKIKF-DFLNCNLTREMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFI-E
KLTH0G13508g       VG-ADGTVQWVVL-RFLNSALMRELIRYSGQIRFLCSYLTENINMCKTDLIEPYRQFL-T
Kwal_56.23766      VG-KDGTLQWVTL-KFLECALMRELVKSSGQIRFLCRYLAENVSLCHTELIEPYRVFL-T
TBLA0C04570        FY-QDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEHIMFIKDNMSTPFNEFL-T
NDAI0J01270        FH-ENGSIRSLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYP
NCAS0B03790        FY-KDRKTSTIDLTTLMESTPHVSLLNVLTEMKQLHRYIVDHLDIIDNDLKKPLDDFL-E
KNAG0H03190        YY-KTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYLGYFLAHLEPIQTECVEPYQEFI-E
CAGL0B01859g       HF-DDYSRLQIDLTGILLNDDKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFL-E
KAFR0B05460        IY-KDGSARKIDTSSFLSSKSCIDLLECILSLKDMSKYTRNHLDLLERVIIKPYLDFL-E
TPHA0J00790        FY-ENASYRLIDVTPFSSNDIRVNLLNNSIDLRNSVSLLKEQIEIIKKELISPFESFI-N
Kpol_392.1         FY-KNGHYRKINFNNLLSCNVSNGLLSNILEIRNLNRYVNDHLDLIKRELIIPYSDFV-K
Suva_2.277         FY-NDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIGYLLAHIEFINRELTTPYMDFV-K
Skud_4.378         FY-NDGSVRTLNLQPLLRSKPSVDLLHYIMVIKELIGYLLAHVELINRELITPYLDFV-K
Smik_4.362         FY-DDGTVRTLNLGPLLRSEPSMNILKYIMAIKELIGYLLNHIEFINRELVTPYLEFV-N
YDR118W            FY-EDGTVQTLNLGPLLQSKSSVNLLNYIMVIKELIGYMLTHLEFINRELATPYLDFV-K
ZYRO0C01474g       FY-QDGSVERFDLANLVKDPFSLRLLKNVITMRQLHRYLQDHIELIQRDLLQPYDEFL-E
TDEL0F03970        FY-EDATVESLSLDQLIQCDATIQLIQHFIAIKQLNHYLQDHLDLIKRDLVAPYTEFL-T
                             .    :        ::                          .   *   

KLLA0F19316g       TLLKEEH-------KNALQELFYIGVTKLEVMEELHEVQLQTFRLDKWSALSNDLCSNSI
AGR078C            SLFPEE---QFTKFMKGLKDVFYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQ
Ecym_4300          SLFPDE---QASRLLKGLKDVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQ
SAKL0H16852g       RVL-GAY---EGDLIGDLTELLFTGSVPPE-LEDWLSNTIGDKNLRRWKKLSSVMYENAV
KLTH0G13508g       RIA-DAY--EGGELASRFRDIILSGYIPED-LEDWLCNSIGDKNYKRWKQLSTRMYGDLN
Kwal_56.23766      RLM-GAY--EGDDLATRLRDILLTGYIPDD-LEEWLCNSVGDKNYKRWKQLSTRMYGDLN
TBLA0C04570        SVKGEA---TQEMMMENLITMLVSGYISTE-LEEWIRNTIGIKNLTRWATLGGIFYEKGV
NDAI0J01270        TIFEEKQNGGGNSMLQQLKLSLLSGEMSEE-LIEWLTLSIGEKNLKKWKRLSEELYSKSI
NCAS0B03790        --VTNIL--NIKDLSKSLKSFILYGLMAKS-LNHWLCNVVGEKNLKKWKRLSETKYQKII
KNAG0H03190        RLCEDAF--GKEKLQESLTDHFLVGSMDEE-LRDWLVYSLGERNLEEWKSLMNTAYRRTS
CAGL0B01859g       SI-------GGINDLDVLERLFLIGELDTK-LGNWFKETINEKNLKKWSRLGNEFYSNFK
KAFR0B05460        KICDGAF--GREKLINELKITFLLGTISDE-LQDWLHYSVGDKNVTQWRTLCHDAYQQTT
TPHA0J00790        LVCVDAYE-GYDNLYRSMTNLLLTGEISEE-FEDWLINTIGERNLRKWKNLGIELLDKLV
Kpol_392.1         KICIDAYAGGMTKLNDELESLLLTGEINNE-FKDWLVNIIGDRNGKKWRKLGMDMFEKIV
Suva_2.277         RICDEAY--GYSKLKSELKCLFLLGEVPSD-LDDWLCNAVGEKNFKRWKVLGCEAYQKTV
Skud_4.378         RICDEAY--GYNKLKSELECLFLLGEVSCD-LEDWLCNSVGEKNLKKWKFLGCEAYQKTT
Smik_4.362         RLCDEAY--GYDKLISELECLFLLGEVSCD-LEDWLCNSVGEKNFKRWKCLGCEAYQKTT
YDR118W            RLCDEAY--GYGKLKSELEALFLLGEISCD-LEDWLCNSVGEKNFKRWKYLGCEAYQKTV
ZYRO0C01474g       RCCQGAFG-GYDLLREQLIDLMLVGDVTPE-LEDWLVNSMGEKNLKRWRKLGTDAYHKTL
TDEL0F03970        KICDAAF--GYEILHEELESLLLGGGLSVE-LENWFCYTVGEKNFKKWKKMGLEMYQKTI
                                    :   :  *    . .       :       *            

KLLA0F19316g       GLMVACTIPLLERMIVLAASIEALCEAITWIKFPNE------------------------
AGR078C            GVLVTCMIPACERLIVSAKRLLGLVKSLKLNVFGLDDDNELT------------------
Ecym_4300          GILVTCMIPACERLIVAVKRLQGLIKSLKLNIFGLDDDEELI------------------
SAKL0H16852g       KIMVLTMVPVCERLILCGERLHGIIKGLKLIGLKELEDNLE-------------------
KLTH0G13508g       NVLALAVIPACERLILAAEQLQGIHKGLKLQEFGLASPQEFE------------------
Kwal_56.23766      NVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKDYAGELT------------------
TBLA0C04570        DIITLMVIPACERFMILVARLQGLIEYVIVRNRCDNRGVNLN------------------
NDAI0J01270        QIFSLALIPACELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKI
NCAS0B03790        QIISLAVLPALEKLSLLSIRCEALVVAIALPASGHMQE----------------------
KNAG0H03190        QVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDSLE--------------------
CAGL0B01859g       QVLIIVFVPICERLMVLTNRINGMIKGIDLQESQETS-----------------------
KAFR0B05460        ELFTIALMCACERMILLSERCFGLIMAFQFESGADDNSR---------------------
TPHA0J00790        QILSLIFIPITEKFIITAERIQNYITAMRLSDNSKILEN---------------------
Kpol_392.1         KILTLAIIPSCERFMIYLERTDGYLNGYMKTDTD--------------------------
Suva_2.277         QVFTLAFVPTCERIIIFVQKLKGILEAFSIQXXXXXXXD---------------------
Skud_4.378         QILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNNTSD---------------------
Smik_4.362         QILTLIFVPACERIIIFVEKLRGILEAFSIQNKFNDSSD---------------------
YDR118W            QILTLIFVPACERIIIYVEKLRAILQAFSIQNKLSYTSD---------------------
ZYRO0C01474g       QVLTLACLPACERLISLGQRCTGNLLSRQLTLQLPL------------------------
TDEL0F03970        QILTLSFIPACERVILLSERCRACLKALQLIESSTTTD----------------------
                    :.    :   *                                                

KLLA0F19316g       ----IWVGSKLRERTVETLKSVRSQTDSIMKNKKTQ-ELGLMWIRSLSDSLSKMERNRDQ
AGR078C            ----AVEVQDLLQMSLGLLKGLVEQVEQFHVGENVS-KDGLAWIEYMMDSLLHNEDED--
Ecym_4300          ----APEVDELLQMGLDTLTEIVKQVEKFHIGENMS-IDGLTWIEYMIDSLLRGEEDD--
SAKL0H16852g       ----VLEAQKLVCLSQEALENIIVSIKQINVDSNLH-EAFIDWFHDMVMEAVDEDYKR--
KLTH0G13508g       ----SAEVTELITGCQALLHASLELVVDLNRDTRLH-AIFADWFYDVVMETVDEDYKR--
Kwal_56.23766      ----TVELQTLISECQTLLEFTLNLITELNRDAALH-QVFAEWFYDVVMETVDEDYKR--
TBLA0C04570        ----SSYIENVKHAAKRFMKEALRMLEQLQLQKQLF-EKFLHWFSENVRGVVQDEAVS--
NDAI0J01270        LTEFSPSFLELIEILQKFGSRCLQNLRKISYIEKQS-SLFLKWLQEMIFHALDEDHVP--
NCAS0B03790        ----LEYFDSLKRTTAALCNQALNITQKTSEEEKKC-SVFILWIQDLIFECVDEDYVP--
KNAG0H03190        ----ISEFTDLLENCQELLQLVLQTVKQLAKDIKDI-KVFLLWLENVLKTTINKDYPP--
CAGL0B01859g       ----LLDISEL----QSFLNLVLKLLAELNEDETYFKQDFLPWLTDKVYESINNEYKS--
KAFR0B05460        ----LHELNELMSNLQDMLKSIIYTAEESANKFEML-KIFLSWLNDRVHEELDDDYKP--
TPHA0J00790        ----DSEINDLILNLSNILKTSIKQIPILNNDKMAF-EIFIDWIRNTIYLIIDENYKS--
Kpol_392.1         ----FYDIISLREYFSKLIRNSITIINSLNNQLKYF-EIFSEWINDKINEITDEDYKN--
Suva_2.277         ----LTAVELLLKQSQELLNITLKSIIDLGKDETLF-EKFLMWFNDRIHEVLDEDYKP--
Skud_4.378         ----LTAVELLLKNSQELLNNTLKSIIALGRNETLF-EKFFIWFNDRIHEGLDEDYKL--
Smik_4.362         ----LTAVDTLLKNSQELLTITLKSIVDLGKDETLF-ETFFIWLNDRIHEVLDEDYKL--
YDR118W            ----LTAVEVLLKSSQKLLTMTLNSIIGLGRDETLF-EKFFIWFNDRLHEALDEDYKL--
ZYRO0C01474g       ----LPPIDCL----QFFLKNVLEAIASLSSQQRLL-GSFLDWFDDRVRESIDEDYKL--
TDEL0F03970        ----SSEFANLTSLSQTYLRSTVETIQGVSAQEVLF-QTFLQWFDDRLHEALDEDYKQ--
                             :                               *:          :     

KLLA0F19316g       ISPPEPETTNGSNNFSFFGSSTGITGEDSKTLQKRADINTVEKFLAKDLLPEKQ------
AGR078C            -------------AHNLNGQDGLFSSDLDPHEVYPKEHYSVQLFLNEYIIPKKP------
Ecym_4300          -------------GNNSNGQDCALSNDVDALDTYPKEHYSTQLFLNNFVLPTQT------
SAKL0H16852g       -------------K-----------------TSYNCDPLKIQQFMSGSLTGVHT------
KLTH0G13508g       -------------PQNRD----------SHQDCYGDRALALDQYISHCWENSEV------
Kwal_56.23766      ----------------------------PSRDGIPLDSYGLDQYLSYCWQSSET------
TBLA0C04570        -------------GNILV------------KNVNNC--RDIVEYLEWSMGGGPN------
NDAI0J01270        -------------KLDTY----------S--NPIIC--LDLSNFLNKLIVLSTDKNKEDR
NCAS0B03790        -------------KLNIC----------EDGSVVPTLMEIIDQFFQDTTKEKST------
KNAG0H03190        -------------NFNV--------------SECGKFGFLFTSGLALTLEPAKK------
CAGL0B01859g       -------------VFFKA----------EYGNNKRI--LNIIKYFEATVIE---------
KAFR0B05460        -------------QLSIT----------Q--NSNTC--YKLGKSFEYLLQEGKKDSEDI-
TPHA0J00790        -------------KLSL--------------SSSNSYPFDIQKYINLQFKDHNKA-----
Kpol_392.1         -------------RVL--------------------------------------------
Suva_2.277         -------------KFEFE----------D--DPYFG--YDLLNFFEKFLSDRNTESS---
Skud_4.378         -------------KFEFE------------DDPYFG--YDLLTYFDKILSYRSTESS---
Smik_4.362         -------------KVQF--------------EDDPYFGYDLLTYFHNISNRGAETS----
YDR118W            -------------KFQF--------------EDDLYFGYDLLSYFDRILSKKGTEPS---
ZYRO0C01474g       -------------RFNL--------------HDNSSLGPDTASYLQLRLRNSSP------
TDEL0F03970        -------------KLSI--------------DSNCKIGYQIATYLDLRINPDKQSEYDN-
                                                                               

KLLA0F19316g       ---------------YEWVKTSFPNLILETQAEFDKIIKDYTLKWLKRQMSVEFDQTRN-
AGR078C            ---------------YSWIKSDFPSQLEVLMRQFDLVQKNYTAKWIKKLIK--VPGPVR-
Ecym_4300          ---------------YKWIKNDFPNKLESLIRQFDLVQKNYTAKWIKKMIK--VSGPIR-
SAKL0H16852g       ---------------YEWCQYSFPAVTNRLGKQFETVEQLYVANWVVQRVK--FGEPIC-
KLTH0G13508g       ---------------WTRFERLLPQLAADADISATKLDHIYTRAWVLEQVH--VTSPVR-
Kwal_56.23766      ---------------IQRFETSLPELAARPGVSAALLDRKYTREWLLADIH--VTETVH-
TBLA0C04570        ---------------RVTELTQFEKELEVVQENLNLLNQDFVEPALSVAIS--IGDRKN-
NDAI0J01270        EEDQNPLVNDDDENELFCSMEETTTMLQRINYLSRSIDEKGIQPTLQQCLY--LGPNIQ-
NCAS0B03790        -----------------DGTDLSKNLLKSISDTLENIDSSYVRNMLLKTMK--IRGTAR-
KNAG0H03190        ---------------TVTFFDESRRIVRECGDLLLQVDNLYVRDLLLSKVI--VGDPIP-
CAGL0B01859g       ---------------IDYSLRTHLNKLKDENEKIINLFQKFSKSSLKTCLS---------
KAFR0B05460        ---------------LN--FDIIKHTLEKIEANISRMNTKYIEPILENKIA--IDTKIP-
TPHA0J00790        ---------------ILTVVDEFETYANKILIDLDMIDEKLIKPHLKTSII--ISDIIDN
Kpol_392.1         ------------------------------------------------------------
Suva_2.277         ---------------SVIDMKLYRDLINSMTAMEKDIAKNNVNPHIQRQVL--VQSRAD-
Skud_4.378         ---------------SVINMKLYRELINNMSDMEKDIAKNNVSQHIQQQLL--INIRKD-
Smik_4.362         ---------------PVLNMKLYRDLINSMSDMEKEIAESNVNSHIQQHIL--VESRTD-
YDR118W            ---------------SIIDVKLYRDLINSMSDMEKDIAQSNVNSHIQQHIL--VDLKTD-
ZYRO0C01474g       ---------------EFSSVSDLTHSLASTTDCVSSLDSILIDA-LTSKIN--ISHEAH-
TDEL0F03970        ---------------KFLKLQTFQEILDTMSQNLQLIRDREIEPKVLQKIT--RVNRHN-
                                                                               

KLLA0F19316g       -IQTGDNVDQICDIRILRH-EDSSKRALLVTPTELILLNLQTQKIDVRSPL------PLP
AGR078C            -KLKS-----LVGHRLEDA-LVDGETIYMICSK--------RSPKRPDLDE----EVECS
Ecym_4300          -KLRS-----ITGQRLKDA-IMDGDVIYMICSKSSSTTSQGTDQDQSREQIQEQDDHQEV
SAKL0H16852g       -IKKG-----LEKTRVKDVGVDTGKQLLFLY------------QDNDSKEL----VVSKY
KLTH0G13508g       -------ACDVDSVEVLD--VQACNKVIMVCRVQTKEGSGATVVTVEPPIADAEPVLQSM
Kwal_56.23766      -VDND---IRAGFDEVLDA-VASDFRAAIAYRTTTPQQPSAAECLTIASVEPPRDGFSCS
TBLA0C04570        -IGAILGVCNPEGELLSMEKVMSLESTLVIYII----------KYEMQGEM----KYEIG
NDAI0J01270        -FITEREFDPSKEITVKDV-VKVLNGSILLYLL---------QVKSLDSRD----LFYVG
NCAS0B03790        -SFTE---NFDEDVTILDI-FYCAKYPFLVYLV----------EKRSNTQDVKASVKYIG
KNAG0H03190        -LLNS--YYIEHFVTLLDIAQVAAHPAYLIYL-----------CRNMSNRS----EVLLG
CAGL0B01859g       -EFETKLFEPKKAVKLLAC-EKICNDVCNYVQV----------LMSKDYIL----EILLV
KAFR0B05460        -FFKA-NYSPELTVTVRDI-VKISQIPYVLYVVQL-------SSVTPTPIN----EVRVG
TPHA0J00790        TLQNSNKIFESSNLKVLDV-LRIEEKSCFLFVV--------KELPLNHNSEIATHNYKII
Kpol_392.1         ------------------------------------------------------------
Suva_2.277         -VFSQ--RYPSSKINLLDA-IKLSKQNYIVYLIQVTEKKDIQEASLERNTQ----KLYIG
Skud_4.378         -VYSQ--MYPSSQVRLLDA-IKLPNQSYIVYLIEVTKLMNTKEVSSGENTP----KLYVG
Smik_4.362         -VYSK--EYPSSQIYVFDA-VKLPKHNYILYLIQVTEQKHTQEAPSEGSIE----KLYIG
YDR118W            -VFAQ--KYPSSQINLLDA-IKLPKHNYIVYLIQVTKHNSAQEPFSEENKK----KLYIG
ZYRO0C01474g       -NKMNDIFCDLMDLTVIKTNNPTGTATGL-----------------ENGLILLATKSQVI
TDEL0F03970        -LPNS------ENQILLAV-APIPSQSNIISFF---------SSSNAAQQP----TFYTR
                                                                               

KLLA0F19316g       SHKVAMTLTRH-----------------------NTDPAALPLK-------KQQYKNPRL
AGR078C            PSRESELQQSM-----------------------GKLSEETPVDGYSRIFTLVQYDVSSK
Ecym_4300          DQEQDQL---------------------------QDQDEEFTII---------QYDSTSK
SAKL0H16852g       SLDLDPTTNHI-----------------------AQESITLTIEDVSSVKDAKFSADYKS
KLTH0G13508g       KLGMDHV---------------------------IKAALVLPEG-------AADNTAVVV
Kwal_56.23766      PASQPVLPTITHARLEQPHHVTGTLIFLHEGPCACDEHLPFPPASTVKSPAAEPTPEVTT
TBLA0C04570        LLNCNMENIF------------------------CQNEVKLGSR-------RQEVVETKI
NDAI0J01270        TINVVDLKPIC-----------------------HPKLIQFPLTSNEIINITDVQLLTDI
NCAS0B03790        TANSINLRTIS-----------------------AAKKVNYPLS-------IDSASIQKV
KNAG0H03190        AIDCQSNKVAT--------------------------DIKLPYN----------HAEMDI
CAGL0B01859g       DAVTGTVLLSE-----------------------KYNSIQNPFG----------YEIT--
KAFR0B05460        TANIDGTSTNE-----------------------KILPLSVVQM----------------
TPHA0J00790        LSSEPRIGNNH-----------------------SGKPLMIPEK-------YQNLLFKEM
Kpol_392.1         ------------------------------------------------------------
Suva_2.277         TLKDESLDIVS-----------------------RESSIKMPEL-------FKSYDLNSA
Skud_4.378         TLKDESLDIIS-----------------------RESSIRIPEA-------FKNYSFSNA
Smik_4.362         TLKDDNLDVIS-----------------------RESSIKIPEL-------FEFYSFSGA
YDR118W            TLKDENLGIIS-----------------------KESSVKIPAL-------FKSYRLSST
ZYRO0C01474g       LLDPQSLMIL------------------------AQLPLQIPLT----------YLEKER
TDEL0F03970        TLDKSSLAQIS-----------------------SEVPIELPFS------QQDHHQIKAG
                                                                               

KLLA0F19316g       QLVPISAGQPSLSTAPVQNI--------------TEEVFFLLPLCQTVTVFIETA-----
AGR078C            ELTRQSIPPPTNRAIIASIKFVPGESSRFLMLTEDGQVRRYLVGYSGATDVKNSARITIY
Ecym_4300          ELTKQLIPLPETLSSIVSIKFVPGEPGRFLMLTEDGYLRRYLVNYSSSLGIKDPSRITIY
SAKL0H16852g       IFVLHENGSSLSQVELQVNP--------------EGRLLAFGRNSTLVDDLQNCD-----
KLTH0G13508g       ALQHSGQQNASVRASCVQFG--------------AHVMHSEHSWEELAPKNEAHEPVAFL
Kwal_56.23766      TTTTTVTATATATATATVTPIPATTNSGLPLSCTVLLLHSTPSQLSSTDISHGLHPTTVS
TBLA0C04570        NVEKRQFENDSNLFVIEKED-----------------------EFDVQVEFRNND-----
NDAI0J01270        KLVSTNSNNNDDDSMIDEIG--------------PFFNLFIMFDTVSSMNNREVNSKIWY
NCAS0B03790        KFLFEKQNNCLTLISTIQSL--------------DQKV----------------------
KNAG0H03190        EGVRIMGDASQIAPESHQTT--------------KITLPIIVQYKSGDITLRTHES----
CAGL0B01859g       --LDNIISCTLVGTEKVNKD--------------DTYMQDILAGGNSLVQENDNK-IEIY
KAFR0B05460        -------SNDIAVIKIIEEP--------------SKKSKEYEIICSGAKEM---------
TPHA0J00790        IIIEHLFQRNGNTTYLDSST--------------MLRSQLALNKFNDDEFNQNRNNTTKI
Kpol_392.1         ------------------------------------------------------------
Suva_2.277         RFAPKMVPNFIRESEQLNSD--------------YNYSHNTNFGGEEDDDEEDDGTITIP
Skud_4.378         RFALKMVPNFIREVELSRSN--------------YTVSRNSEYTEEENDNGEDDGSITIP
Smik_4.362         RFVLKKVPNLIREIELSDGN--------------YDCEHNVEYKEGDDENGEDDGAITIP
YDR118W            RFVPNRVHSLLRDIGLSDSN--------------YHSSHVTDYRGENYENEEDDGTIAIP
ZYRO0C01474g       EFVSSTTTMATSTTTTQDMI-----------------TRAYWQHTTLQLELQGSQQGP--
TDEL0F03970        --IARLTSPLEKPQDHSNHP--------------YNAEIVLWVSNNNAATCEEQF-----
                                                                               

KLLA0F19316g       ----------------------------------VASNTDSILSPDGRSHSLAVDHLPHS
AGR078C            NDFKVIMEPTALDIT-------------------NKKYCKNQMIVHSDMAVTILSPIPVE
Ecym_4300          NDLKILMEPSTLELL-------------------NKNAAENRMIVHSDMAVTILSSFTNE
SAKL0H16852g       -----------FDSI-------------------QINRHQIALVSSNRNRFGIASPPRQI
KLTH0G13508g       PV--------------------------------HVSATRDGVAVHSDTDVAVFENIT--
Kwal_56.23766      PVTIPINLPAQSSPPPPPLQSLSGTTRVAARCSSHGTTTTHIASVHSDSTMSVFEMSRET
TBLA0C04570        ----------------------------------SVFTKKFVLNIKEKSIEGC-------
NDAI0J01270        RIRKSNE---------------------------HYGVVSTELIPDLSNVFAN-------
NCAS0B03790        ----------------------------------SYIMTEVSINRTGDEISLNFLRNDTT
KNAG0H03190        ----------------------------------HYCKLDCQLILHRESVSVTIARLK--
CAGL0B01859g       AVFGTALDVDIENII-------------------QVKLHPPKISLKLRTA----------
KAFR0B05460        ----------------------------------ITVYKTTLHIRDGRIEMALGPSN---
TPHA0J00790        CLLLKFQKNDLSK---------------------EFDYVYGKVCIEVDQHFNIIQSPAPF
Kpol_392.1         ------------------------------------------------------------
Suva_2.277         TYITENEKTE------------------------GFIACTTKISVDGRGASLVFPKETSS
Skud_4.378         TYLTENEKNE------------------------VYIACTSKISVDGRSASLVFPKGRKF
Smik_4.362         TYITYNEKSE------------------------DFIACTAKISVDGRSASLVFPKGK--
YDR118W            AYIRENREND------------------------DFIACTAKVSVDGRSASLVFPKEKQN
ZYRO0C01474g       ----------------------------------IKTAIDYQVTPNGDQWSLAVL-----
TDEL0F03970        -------------------------------------TVHCQITPAGMPIPGEFNRKSEQ
                                                                               

KLLA0F19316g       ADLTGESHDLHRHTIRIV
AGR078C            A-PADANSGHCQLVVQIM
Ecym_4300          QGVLEPHTSYCQLAVHLM
SAKL0H16852g       ------------------
KLTH0G13508g       ------------------
Kwal_56.23766      SLPHPNLGVSSYPM----
TBLA0C04570        ------------------
NDAI0J01270        ------------------
NCAS0B03790        ------------------
KNAG0H03190        ------------------
CAGL0B01859g       ------------------
KAFR0B05460        ------------------
TPHA0J00790        QNQDVLMSLEVQFETTN-
Kpol_392.1         ------------------
Suva_2.277         IK----------------
Skud_4.378         G-----------------
Smik_4.362         ------------------
YDR118W            V-----------------
ZYRO0C01474g       ------------------
TDEL0F03970        ------------------
                                     

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0F19316g
MSFSIDSELLLQKYACGYSATVSDDQSLVCLWN--------VHNNIEIYRTNG-GYLINR
LNDEI----------QNHRLIDVVWH---GNDLFCCYNSGTVSIYR--------EGRELV
KQLTFI---------PKGAKTKCILCDNLVPS-DDRYSL----SDGN-LLNSMPKLNKW-
-------DMIKNELDNEL--ILNSELG-----------------------KKKPIDIFMA
IDS-KTNKLILSIEGTLNIKV------------GEKLKLPKDIKRIIKVS-SGK---YMC
LG-KDWSYQVLDL-TFLQDPNIYKLIKTTQEYSALLRYLKQLHRHLRMKLTEPYFEFV-E
TLLKEEH-------KNALQELFYIGVTKLEVMEELHEVQLQTFRLDKWSALSNDLCSNSI
GLMVACTIPLLERMIVLAASIEALCEAITWIKFPNE------------------------
----IWVGSKLRERTVETLKSVRSQTDSIMKNKKTQ-ELGLMWIRSLSDSLSKMERNRDQ
ISPPEPETTNGSNNFSFFGSSTGITGEDSKTLQKRADINTVEKFLAKDLLPEKQ------
---------------YEWVKTSFPNLILETQAEFDKIIKDYTLKWLKRQMSVEFDQTRN-
-IQTGDNVDQICDIRILRH-EDSSKRALLVTPTELILLNLQTQKIDVRSPL------PLP
SHKVAMTLTRH-----------------------NTDPAALPLK-------KQQYKNPRL
QLVPISAGQPSLSTAPVQNI--------------TEEVFFLLPLCQTVTVFIETA-----
----------------------------------VASNTDSILSPDGRSHSLAVDHLPHS
ADLTGESHDLHRHTIRIV
>AGR078C
--MTQWKVKLTKQW----------DGKLEPFWN--------DRLSLWGVLEKE-VLSIFR
YIDGRRVGAIPLRLRQNEELLRCQWEPDDGELFAVALRSGSVKIYRGRLDPEGTEGSEGA
ELVGTVVLGR-----GDAFQMEQFVWNRIKWRVREPFCGE---FDSP-LVQWLPRLTEMS
ISAQGKLLCTPLGYEGPE--WNAGLAA-------------------------DESNMFLT
FDN-NTRKVVLSIDGTFNFRY------------GEKSKFPTKVTSILPGN-ENH---YVF
INDEDWQLQVIRL-EFTEYHQVHELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFT-G
SLFPEE---QFTKFMKGLKDVFYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQ
GVLVTCMIPACERLIVSAKRLLGLVKSLKLNVFGLDDDNELT------------------
----AVEVQDLLQMSLGLLKGLVEQVEQFHVGENVS-KDGLAWIEYMMDSLLHNEDED--
-------------AHNLNGQDGLFSSDLDPHEVYPKEHYSVQLFLNEYIIPKKP------
---------------YSWIKSDFPSQLEVLMRQFDLVQKNYTAKWIKKLIK--VPGPVR-
-KLKS-----LVGHRLEDA-LVDGETIYMICSK--------RSPKRPDLDE----EVECS
PSRESELQQSM-----------------------GKLSEETPVDGYSRIFTLVQYDVSSK
ELTRQSIPPPTNRAIIASIKFVPGESSRFLMLTEDGQVRRYLVGYSGATDVKNSARITIY
NDFKVIMEPTALDIT-------------------NKKYCKNQMIVHSDMAVTILSPIPVE
A-PADANSGHCQLVVQIM
>Ecym_4300
--MTQWKVKLTKQW----------DGLVDPFWN--------DRLSLWGIHEKG-NVNIFR
YIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSGSVKVYKGRQDVDSSDPTDGA
DMVGTIVLGR-----GEWFNMEQFVWNRIKWKSRGAFKGD---FDTV-LTQWLPKLTEMN
VSPQGKLTCTPLEFEGPE--WNASLSE-------------------------NESNMFLT
YDN-ATRKVMVSIDGTFNFRY------------GEKNKFPTKVTNILSGN-ANN---YVF
LNDEDWQLQIIKL-EFTESHQMHELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFI-N
SLFPDE---QASRLLKGLKDVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQ
GILVTCMIPACERLIVAVKRLQGLIKSLKLNIFGLDDDEELI------------------
----APEVDELLQMGLDTLTEIVKQVEKFHIGENMS-IDGLTWIEYMIDSLLRGEEDD--
-------------GNNSNGQDCALSNDVDALDTYPKEHYSTQLFLNNFVLPTQT------
---------------YKWIKNDFPNKLESLIRQFDLVQKNYTAKWIKKMIK--VSGPIR-
-KLRS-----ITGQRLKDA-IMDGDVIYMICSKSSSTTSQGTDQDQSREQIQEQDDHQEV
DQEQDQL---------------------------QDQDEEFTII---------QYDSTSK
ELTKQLIPLPETLSSIVSIKFVPGEPGRFLMLTEDGYLRRYLVNYSSSLGIKDPSRITIY
NDLKILMEPSTLELL-------------------NKNAAENRMIVHSDMAVTILSSFTNE
QGVLEPHTSYCQLAVHLM
>SAKL0H16852g
--MVKWEVHSVKTF----------PGEQRIVWN--------PVLSLFLVPTVK-GIAVNR
PVDGQRIATVSVK--DHGTIVDYQWEQSEGRIFAVCHSNGIIRLY---------DSSLAG
KSVGSVILGD-----SDCD-VLKFCWSQDSWTFGSKFSNV---FDHE-ITSLMPRLVKF-
VKDSRQLTMLPTDVGDGVPRWSKLDGN--------------------------KSFIFLG
YDS-KRQKILMAIDGAFKLSFSVAALVAAGERLDEGDSVPNNVRDILKYD-NGE---YLV
IT-DDWYIQKIKF-DFLNCNLTREMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFI-E
RVL-GAY---EGDLIGDLTELLFTGSVPPE-LEDWLSNTIGDKNLRRWKKLSSVMYENAV
KIMVLTMVPVCERLILCGERLHGIIKGLKLIGLKELEDNLE-------------------
----VLEAQKLVCLSQEALENIIVSIKQINVDSNLH-EAFIDWFHDMVMEAVDEDYKR--
-------------K-----------------TSYNCDPLKIQQFMSGSLTGVHT------
---------------YEWCQYSFPAVTNRLGKQFETVEQLYVANWVVQRVK--FGEPIC-
-IKKG-----LEKTRVKDVGVDTGKQLLFLY------------QDNDSKEL----VVSKY
SLDLDPTTNHI-----------------------AQESITLTIEDVSSVKDAKFSADYKS
IFVLHENGSSLSQVELQVNP--------------EGRLLAFGRNSTLVDDLQNCD-----
-----------FDSI-------------------QINRHQIALVSSNRNRFGIASPPRQI
------------------
>KLTH0G13508g
-MFDKWQFKRLIKL----------PKHRGVVWN--------PRLSLYLVLGDK-TVSVNR
AIDGQRIAAVNLR--GDGQLIGAQWELAEGKLFALFFGNGAVRIY---------DCATGG
SLREVVDLVDEGQS-ADVT-VDTAVWSGAQWA-QFRQEYK--GLNIE-ITKQLPGMVRL-
VRDAKQLSVVPLETGKLR--WLADPGK--------------------------DAAIFLG
HDE-KSGDYLMTVDGLLSVRV--------------PSGIKKMHKILRQGE-DGT---FVG
VG-ADGTVQWVVL-RFLNSALMRELIRYSGQIRFLCSYLTENINMCKTDLIEPYRQFL-T
RIA-DAY--EGGELASRFRDIILSGYIPED-LEDWLCNSIGDKNYKRWKQLSTRMYGDLN
NVLALAVIPACERLILAAEQLQGIHKGLKLQEFGLASPQEFE------------------
----SAEVTELITGCQALLHASLELVVDLNRDTRLH-AIFADWFYDVVMETVDEDYKR--
-------------PQNRD----------SHQDCYGDRALALDQYISHCWENSEV------
---------------WTRFERLLPQLAADADISATKLDHIYTRAWVLEQVH--VTSPVR-
-------ACDVDSVEVLD--VQACNKVIMVCRVQTKEGSGATVVTVEPPIADAEPVLQSM
KLGMDHV---------------------------IKAALVLPEG-------AADNTAVVV
ALQHSGQQNASVRASCVQFG--------------AHVMHSEHSWEELAPKNEAHEPVAFL
PV--------------------------------HVSATRDGVAVHSDTDVAVFENIT--
------------------
>Kwal_56.23766
-MTSNWKLKGVVTL----------PKGHKVVWN--------PRLSLYLVLTDK-KIAVNR
VIDGQQIAAVNLR--DEHEIVGIQWEKNESKLFAVFQSNGVVRIY---------DCSIGG
SLREMVNLVEEGQA-AEVK-VDAVVWMTVEWA-KFPESYR--GLDFD-ITTLMPGMVRL-
VRDSKQLSLAPLDLGKLS--WLDGKYG--------------------------DAAIFLA
HDC-ESTEYMVAIDGQLSLRF--------------PSGIRNVHKILPQGG-SGS---FLA
VG-KDGTLQWVTL-KFLECALMRELVKSSGQIRFLCRYLAENVSLCHTELIEPYRVFL-T
RLM-GAY--EGDDLATRLRDILLTGYIPDD-LEEWLCNSVGDKNYKRWKQLSTRMYGDLN
NVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKDYAGELT------------------
----TVELQTLISECQTLLEFTLNLITELNRDAALH-QVFAEWFYDVVMETVDEDYKR--
----------------------------PSRDGIPLDSYGLDQYLSYCWQSSET------
---------------IQRFETSLPELAARPGVSAALLDRKYTREWLLADIH--VTETVH-
-VDND---IRAGFDEVLDA-VASDFRAAIAYRTTTPQQPSAAECLTIASVEPPRDGFSCS
PASQPVLPTITHARLEQPHHVTGTLIFLHEGPCACDEHLPFPPASTVKSPAAEPTPEVTT
TTTTTVTATATATATATVTPIPATTNSGLPLSCTVLLLHSTPSQLSSTDISHGLHPTTVS
PVTIPINLPAQSSPPPPPLQSLSGTTRVAARCSSHGTTTTHIASVHSDSTMSVFEMSRET
SLPHPNLGVSSYPM----
>TBLA0C04570
-----MSSVSFIEN---------------PKSN--------PTLPLTLCKSDS-GLKVIR
TADKSIIINYKIR--NKNDIIYYQWENNIGNYVAIFFQRGTVMIY---------DGIKTS
RLLAMLN--------GGKPNVDAGIWDRYYFPNDNEKDI----FDSD-ITLYMPTLIQI-
IRDKEKICPGTYFPPHST--WRAKKEE---------------------SLKNEFLDIHLL
HHS-VDDSFTFILNGELKLPF-------------PSNSTSGRAIGIIKGE-NNC---FIC
FY-QDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEHIMFIKDNMSTPFNEFL-T
SVKGEA---TQEMMMENLITMLVSGYISTE-LEEWIRNTIGIKNLTRWATLGGIFYEKGV
DIITLMVIPACERFMILVARLQGLIEYVIVRNRCDNRGVNLN------------------
----SSYIENVKHAAKRFMKEALRMLEQLQLQKQLF-EKFLHWFSENVRGVVQDEAVS--
-------------GNILV------------KNVNNC--RDIVEYLEWSMGGGPN------
---------------RVTELTQFEKELEVVQENLNLLNQDFVEPALSVAIS--IGDRKN-
-IGAILGVCNPEGELLSMEKVMSLESTLVIYII----------KYEMQGEM----KYEIG
LLNCNMENIF------------------------CQNEVKLGSR-------RQEVVETKI
NVEKRQFENDSNLFVIEKED-----------------------EFDVQVEFRNND-----
----------------------------------SVFTKKFVLNIKEKSIEGC-------
------------------
>NDAI0J01270
MNHQQSQYPHQKGH-------------RDEQWNFAPISYINPSFPLYLTKTSN-SIIARR
TLDGFQISNIIIR--NMQNVIAIDWDSKTGKYLTINFDDGTFRIY---------DIFQDG
KLITLVRPQRNLLDIHRKTKVDNAIWDRLIIL-NSIQELE---FNHD-ITKLMPTLIKF-
VKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYLDLHII
HVI-DPDCFTIAINGTYQINL---------VRKTINTTNRNKIVRILKSTVHGV---YHC
FH-ENGSIRSLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYP
TIFEEKQNGGGNSMLQQLKLSLLSGEMSEE-LIEWLTLSIGEKNLKKWKRLSEELYSKSI
QIFSLALIPACELTLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKI
LTEFSPSFLELIEILQKFGSRCLQNLRKISYIEKQS-SLFLKWLQEMIFHALDEDHVP--
-------------KLDTY----------S--NPIIC--LDLSNFLNKLIVLSTDKNKEDR
EEDQNPLVNDDDENELFCSMEETTTMLQRINYLSRSIDEKGIQPTLQQCLY--LGPNIQ-
-FITEREFDPSKEITVKDV-VKVLNGSILLYLL---------QVKSLDSRD----LFYVG
TINVVDLKPIC-----------------------HPKLIQFPLTSNEIINITDVQLLTDI
KLVSTNSNNNDDDSMIDEIG--------------PFFNLFIMFDTVSSMNNREVNSKIWY
RIRKSNE---------------------------HYGVVSTELIPDLSNVFAN-------
------------------
>NCAS0B03790
------MSNLTEEL---------------VSYN--------PSYPAKLYKTSY-GFAVRR
TRDDTQIVKIVIR--NMDAVIATCWNSFGSNYLTVMFNDGSARIH---------DIFREG
KLMTLLRLQD-----GFQKCMDTGIWSKLEVR-QKPNEGE---FDRD-ISGLMPSPIKF-
VNNAGQLEVVPYVVTQTQ--WRNVDKP---------------------LEVNDIIDIHMA
HNS-NTDEYLLMINGVYKLTI---------QPNSTDENASNQLHKIIHLEKTAI---FHC
FY-KDRKTSTIDLTTLMESTPHVSLLNVLTEMKQLHRYIVDHLDIIDNDLKKPLDDFL-E
--VTNIL--NIKDLSKSLKSFILYGLMAKS-LNHWLCNVVGEKNLKKWKRLSETKYQKII
QIISLAVLPALEKLSLLSIRCEALVVAIALPASGHMQE----------------------
----LEYFDSLKRTTAALCNQALNITQKTSEEEKKC-SVFILWIQDLIFECVDEDYVP--
-------------KLNIC----------EDGSVVPTLMEIIDQFFQDTTKEKST------
-----------------DGTDLSKNLLKSISDTLENIDSSYVRNMLLKTMK--IRGTAR-
-SFTE---NFDEDVTILDI-FYCAKYPFLVYLV----------EKRSNTQDVKASVKYIG
TANSINLRTIS-----------------------AAKKVNYPLS-------IDSASIQKV
KFLFEKQNNCLTLISTIQSL--------------DQKV----------------------
----------------------------------SYIMTEVSINRTGDEISLNFLRNDTT
------------------
>KNAG0H03190
--MTEDALYARQFY---------------TEVN--------NVLPLYVTRGTK-QLVVNR
DTDDSTIASTFIR--DPSQVVSYQWDTIGGEIISVMFQDGSIRIN---------DVMYDA
KLVALLRT-------QRTG-LDCVLWDRIRLP-SRAQSME---WDPDIITQSLPRLVKF-
MGSDASPSMSPYLPTNHS--WRFPNSG----------------------AAGGILDVHFL
HQK-LGDTLVALLNGEYQLQL-----------TGPHQEDQSELRKIIART-DSKRHVYNC
YY-KTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYLGYFLAHLEPIQTECVEPYQEFI-E
RLCEDAF--GKEKLQESLTDHFLVGSMDEE-LRDWLVYSLGERNLEEWKSLMNTAYRRTS
QVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDSLE--------------------
----ISEFTDLLENCQELLQLVLQTVKQLAKDIKDI-KVFLLWLENVLKTTINKDYPP--
-------------NFNV--------------SECGKFGFLFTSGLALTLEPAKK------
---------------TVTFFDESRRIVRECGDLLLQVDNLYVRDLLLSKVI--VGDPIP-
-LLNS--YYIEHFVTLLDIAQVAAHPAYLIYL-----------CRNMSNRS----EVLLG
AIDCQSNKVAT--------------------------DIKLPYN----------HAEMDI
EGVRIMGDASQIAPESHQTT--------------KITLPIIVQYKSGDITLRTHES----
----------------------------------HYCKLDCQLILHRESVSVTIARLK--
------------------
>CAGL0B01859g
----MGEDIVLDRF---------------LKYN--------PKYGLFGMNEDNHSLVIRR
TSDNVGIVKINVR--NIVLLLDYFWDPIDGKYLALFLKDGSVRIY---------DIFNGG
KLISFLRVLPVVLG-SNKPSLDCCLWDRIIIPKSGSSELR--IPNND-LTESMPTLVKF-
VQDAKQIDIIPNRSITKL--WRSIGNN-----------------------EKKVVDVHLG
YSC-SSAQVTILINGEYLIEK----------SVSDINQIQKKIPISLNKK-EFCEAIYEI
HF-DDYSRLQIDLTGILLNDDKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFL-E
SI-------GGINDLDVLERLFLIGELDTK-LGNWFKETINEKNLKKWSRLGNEFYSNFK
QVLIIVFVPICERLMVLTNRINGMIKGIDLQESQETS-----------------------
----LLDISEL----QSFLNLVLKLLAELNEDETYFKQDFLPWLTDKVYESINNEYKS--
-------------VFFKA----------EYGNNKRI--LNIIKYFEATVIE---------
---------------IDYSLRTHLNKLKDENEKIINLFQKFSKSSLKTCLS---------
-EFETKLFEPKKAVKLLAC-EKICNDVCNYVQV----------LMSKDYIL----EILLV
DAVTGTVLLSE-----------------------KYNSIQNPFG----------YEIT--
--LDNIISCTLVGTEKVNKD--------------DTYMQDILAGGNSLVQENDNK-IEIY
AVFGTALDVDIENII-------------------QVKLHPPKISLKLRTA----------
------------------
>KAFR0B05460
---MNELNPKERSY---------------CVYN--------KKLPLYTEKGPK-GLMVYR
RSDNTAIAHTIIK--KWELVAGIYWDKISGKYLSIFFRDGSIRII---------DVFKDG
KLVAFLRT-------QFKN-VDCTYWDRIEE--QTTNEMK--QFNKN-IVDLMPSLIQF-
VSSANKLSLIPYTPSNAN--WRELDAK---------------------WKKNRVIDMHCL
HQS-ETDSFLMVLNGDYYLTL---------KTPETDLSEKVPACSLIKSA-NSL---YQC
IY-KDGSARKIDTSSFLSSKSCIDLLECILSLKDMSKYTRNHLDLLERVIIKPYLDFL-E
KICDGAF--GREKLINELKITFLLGTISDE-LQDWLHYSVGDKNVTQWRTLCHDAYQQTT
ELFTIALMCACERMILLSERCFGLIMAFQFESGADDNSR---------------------
----LHELNELMSNLQDMLKSIIYTAEESANKFEML-KIFLSWLNDRVHEELDDDYKP--
-------------QLSIT----------Q--NSNTC--YKLGKSFEYLLQEGKKDSEDI-
---------------LN--FDIIKHTLEKIEANISRMNTKYIEPILENKIA--IDTKIP-
-FFKA-NYSPELTVTVRDI-VKISQIPYVLYVVQL-------SSVTPTPIN----EVRVG
TANIDGTSTNE-----------------------KILPLSVVQM----------------
-------SNDIAVIKIIEEP--------------SKKSKEYEIICSGAKEM---------
----------------------------------ITVYKTTLHIRDGRIEMALGPSN---
------------------
>TPHA0J00790
---MTEHSDSQLYY---------------YKLN--------PIYQLYTFKSDK-GLAICT
ISDHSILATIFIK--DFSLVVDFFWDSITGKFLLFAFNDGSIRVY---------DIFKLG
RLVSFFRS-------PLKQ-IKCVYWDRIIITETLDQQLK--IFDYD-LTNSMPTLVKF-
VKDPQGLQLVPVLKNTQA--WRQIDVDLNLKLENSKTE----------VSTDDVLDIHLL
YTESGMDNFAVLVNGVYDLSD-----------IHVPNRSPNKVIKLVKAS-QGK---YLG
FY-ENASYRLIDVTPFSSNDIRVNLLNNSIDLRNSVSLLKEQIEIIKKELISPFESFI-N
LVCVDAYE-GYDNLYRSMTNLLLTGEISEE-FEDWLINTIGERNLRKWKNLGIELLDKLV
QILSLIFIPITEKFIITAERIQNYITAMRLSDNSKILEN---------------------
----DSEINDLILNLSNILKTSIKQIPILNNDKMAF-EIFIDWIRNTIYLIIDENYKS--
-------------KLSL--------------SSSNSYPFDIQKYINLQFKDHNKA-----
---------------ILTVVDEFETYANKILIDLDMIDEKLIKPHLKTSII--ISDIIDN
TLQNSNKIFESSNLKVLDV-LRIEEKSCFLFVV--------KELPLNHNSEIATHNYKII
LSSEPRIGNNH-----------------------SGKPLMIPEK-------YQNLLFKEM
IIIEHLFQRNGNTTYLDSST--------------MLRSQLALNKFNDDEFNQNRNNTTKI
CLLLKFQKNDLSK---------------------EFDYVYGKVCIEVDQHFNIIQSPAPF
QNQDVLMSLEVQFETTN-
>Kpol_392.1
---MVIDSGIRLYY---------------SKYN--------PCFQLYVTRSDQ-GLAVYR
IKDSSQLAHIFIK--DFDTVAGYEWDNYSGRFISVFLTDGTIRIY---------DIFKNG
RLVSYIRS-------SSQKNVDSCLWDRAEF--SIPSKLQ--LFDSN-IIECLPTLIKF-
VKDSRNINIIDYYPPNHS--WRHVDKE--------------SQDTDKEIDFRNLLDVHIQ
HNP-NEDNFTIILNGVYEING-----------IVMPDISKSEVYQLLKLH-NGE---YMS
FY-KNGHYRKINFNNLLSCNVSNGLLSNILEIRNLNRYVNDHLDLIKRELIIPYSDFV-K
KICIDAYAGGMTKLNDELESLLLTGEINNE-FKDWLVNIIGDRNGKKWRKLGMDMFEKIV
KILTLAIIPSCERFMIYLERTDGYLNGYMKTDTD--------------------------
----FYDIISLREYFSKLIRNSITIINSLNNQLKYF-EIFSEWINDKINEITDEDYKN--
-------------RVL--------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------
>Suva_2.277
---------MNDYF---------------IDYN--------PRFPIFAIRVVK-GLAIHR
VSDHARLAVIPVR--NIALVANYNWDVSTGKFLSIFFKDGTIRIH---------DIFKDG
RLVSFLRI-------PRTK-ISRGIWDRIPLK-YESSNRN---FANN-VIDVLPKLIRF-
VKDSKRVTIAPYTPPNSL--WRGPDED--------------------DPENCENLDIHVI
FNE-GNDKITVFFNGDYAILL-----------PVSDIENEKILKSVVKVQ-NGF---YHC
FY-NDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIGYLLAHIEFINRELTTPYMDFV-K
RICDEAY--GYSKLKSELKCLFLLGEVPSD-LDDWLCNAVGEKNFKRWKVLGCEAYQKTV
QVFTLAFVPTCERIIIFVQKLKGILEAFSIQXXXXXXXD---------------------
----LTAVELLLKQSQELLNITLKSIIDLGKDETLF-EKFLMWFNDRIHEVLDEDYKP--
-------------KFEFE----------D--DPYFG--YDLLNFFEKFLSDRNTESS---
---------------SVIDMKLYRDLINSMTAMEKDIAKNNVNPHIQRQVL--VQSRAD-
-VFSQ--RYPSSKINLLDA-IKLSKQNYIVYLIQVTEKKDIQEASLERNTQ----KLYIG
TLKDESLDIVS-----------------------RESSIKMPEL-------FKSYDLNSA
RFAPKMVPNFIRESEQLNSD--------------YNYSHNTNFGGEEDDDEEDDGTITIP
TYITENEKTE------------------------GFIACTTKISVDGRGASLVFPKETSS
IK----------------
>Skud_4.378
-----MSPPINDYF---------------IDYN--------PRFPIFATRITK-GLAIHR
VSDHARIAIIPVR--NIALVANYSWDRTSGKFLSIFFKDGTVRIH---------DIFKDG
RLVSFLRV-------PSTK-ISRGIWDRIPL--KREYDSE--TFAYN-VIDILPKLIRF-
VKDSKRVSIVPYTPPNGL--WRGPDED--------------------DPESGEILDVHVI
FNE-GNDKITIFFNGDYTILL-----------PMDDIENERILESVVKVQ-DGF---YHC
FY-NDGSVRTLNLQPLLRSKPSVDLLHYIMVIKELIGYLLAHVELINRELITPYLDFV-K
RICDEAY--GYNKLKSELECLFLLGEVSCD-LEDWLCNSVGEKNLKKWKFLGCEAYQKTT
QILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNNTSD---------------------
----LTAVELLLKNSQELLNNTLKSIIALGRNETLF-EKFFIWFNDRIHEGLDEDYKL--
-------------KFEFE------------DDPYFG--YDLLTYFDKILSYRSTESS---
---------------SVINMKLYRELINNMSDMEKDIAKNNVSQHIQQQLL--INIRKD-
-VYSQ--MYPSSQVRLLDA-IKLPNQSYIVYLIEVTKLMNTKEVSSGENTP----KLYVG
TLKDESLDIIS-----------------------RESSIRIPEA-------FKNYSFSNA
RFALKMVPNFIREVELSRSN--------------YTVSRNSEYTEEENDNGEDDGSITIP
TYLTENEKNE------------------------VYIACTSKISVDGRSASLVFPKGRKF
G-----------------
>Smik_4.362
-----MPPPGNDYF---------------IDYN--------PRFPIFATRTAK-GLAINR
VSDHARLAAIPIR--NINLVANYNWDTVTGKFLSIFFKDGTIRIH---------DIFKDG
RLVSFLRI-------PSTK-ISKGTWDRIPLE-SESGNGN---LAYN-IIDYLPKLIRY-
VKDSKRINIVPYTPPNSL--WRGPDED--------------------EPENNEKLDIHII
FNE-GHDKITVFFNGDYAIFV-----------PVGADENERFVKSIVKIQ-DGF---YHC
FY-DDGTVRTLNLGPLLRSEPSMNILKYIMAIKELIGYLLNHIEFINRELVTPYLEFV-N
RLCDEAY--GYDKLISELECLFLLGEVSCD-LEDWLCNSVGEKNFKRWKCLGCEAYQKTT
QILTLIFVPACERIIIFVEKLRGILEAFSIQNKFNDSSD---------------------
----LTAVDTLLKNSQELLTITLKSIVDLGKDETLF-ETFFIWLNDRIHEVLDEDYKL--
-------------KVQF--------------EDDPYFGYDLLTYFHNISNRGAETS----
---------------PVLNMKLYRDLINSMSDMEKEIAESNVNSHIQQHIL--VESRTD-
-VYSK--EYPSSQIYVFDA-VKLPKHNYILYLIQVTEQKHTQEAPSEGSIE----KLYIG
TLKDDNLDVIS-----------------------RESSIKIPEL-------FEFYSFSGA
RFVLKKVPNLIREIELSDGN--------------YDCEHNVEYKEGDDENGEDDGAITIP
TYITYNEKSE------------------------DFIACTAKISVDGRSASLVFPKGK--
------------------
>YDR118W
-----MSSPINDYF---------------IDYN--------PLFPIFATRIAK-GLAIYR
VSDHARLAVIPIR--NINLVANYDWDTTTGKFLSIFFKDGTIRIH---------DIFKDG
RLVSFLRI-------PSTK-ISKGIWDRIPLR-YEPNNRD---FACN-IIDDLPKLIRF-
VKDSKRINIVPYTQPNSL--WRGPDED--------------------DLDSNEKLDVHVV
FNE-GNDKITVFFNGDYAVFL-----------SVDNIENENSLKSIIKVQ-DGF---YQC
FY-EDGTVQTLNLGPLLQSKSSVNLLNYIMVIKELIGYMLTHLEFINRELATPYLDFV-K
RLCDEAY--GYGKLKSELEALFLLGEISCD-LEDWLCNSVGEKNFKRWKYLGCEAYQKTV
QILTLIFVPACERIIIYVEKLRAILQAFSIQNKLSYTSD---------------------
----LTAVEVLLKSSQKLLTMTLNSIIGLGRDETLF-EKFFIWFNDRLHEALDEDYKL--
-------------KFQF--------------EDDLYFGYDLLSYFDRILSKKGTEPS---
---------------SIIDVKLYRDLINSMSDMEKDIAQSNVNSHIQQHIL--VDLKTD-
-VFAQ--KYPSSQINLLDA-IKLPKHNYIVYLIQVTKHNSAQEPFSEENKK----KLYIG
TLKDENLGIIS-----------------------KESSVKIPAL-------FKSYRLSST
RFVPNRVHSLLRDIGLSDSN--------------YHSSHVTDYRGENYENEEDDGTIAIP
AYIRENREND------------------------DFIACTAKVSVDGRSASLVFPKEKQN
V-----------------
>ZYRO0C01474g
---------MDQDY---------------VDYN--------PVYPLYVKQFTR-GFSVHR
MADDARIATIIVR--DMSQVAGYQWDPITGKFLSIFYKDGTVRIY---------DGFRSG
RLVSLLRA-------SSNG-AVSGIWDRIELL-HSEENIKDWSIDHD-VTEMMPKMVKF-
ARDSRQLCVVPYTLPSDV--WRPQAAD----------------------DTNALLDAHVI
R---CHDSLSVMFDGEFTISI-------------QLAAIPSPLVKFVSAQ--HQ---YLA
FY-QDGSVERFDLANLVKDPFSLRLLKNVITMRQLHRYLQDHIELIQRDLLQPYDEFL-E
RCCQGAFG-GYDLLREQLIDLMLVGDVTPE-LEDWLVNSMGEKNLKRWRKLGTDAYHKTL
QVLTLACLPACERLISLGQRCTGNLLSRQLTLQLPL------------------------
----LPPIDCL----QFFLKNVLEAIASLSSQQRLL-GSFLDWFDDRVRESIDEDYKL--
-------------RFNL--------------HDNSSLGPDTASYLQLRLRNSSP------
---------------EFSSVSDLTHSLASTTDCVSSLDSILIDA-LTSKIN--ISHEAH-
-NKMNDIFCDLMDLTVIKTNNPTGTATGL-----------------ENGLILLATKSQVI
LLDPQSLMIL------------------------AQLPLQIPLT----------YLEKER
EFVSSTTTMATSTTTTQDMI-----------------TRAYWQHTTLQLELQGSQQGP--
----------------------------------IKTAIDYQVTPNGDQWSLAVL-----
------------------
>TDEL0F03970
------MVVTELDY---------------RCYN--------PLYSLYAKKFNK-GLSICR
VADNAKIATVAVR--DLNVLAQFQWDPITGKRMTVFYKDGNARIY---------DAFQAG
KLLALLRI-------SKTR-VDGAIWDRIELS-RQEVTFK---FDHF-VLNSMPKMIRF-
ARDTRQIFILPYEPPNKT--WRLATEE----EDGVKRE-------------KEILDVHLV
HQE--DNGLVLMLDGDFILRL-------------AAGPSGPALKDIVVAD-RGL---YHC
FY-EDATVESLSLDQLIQCDATIQLIQHFIAIKQLNHYLQDHLDLIKRDLVAPYTEFL-T
KICDAAF--GYEILHEELESLLLGGGLSVE-LENWFCYTVGEKNFKKWKKMGLEMYQKTI
QILTLSFIPACERVILLSERCRACLKALQLIESSTTTD----------------------
----SSEFANLTSLSQTYLRSTVETIQGVSAQEVLF-QTFLQWFDDRLHEALDEDYKQ--
-------------KLSI--------------DSNCKIGYQIATYLDLRINPDKQSEYDN-
---------------KFLKLQTFQEILDTMSQNLQLIRDREIEPKVLQKIT--RVNRHN-
-LPNS------ENQILLAV-APIPSQSNIISFF---------SSSNAAQQP----TFYTR
TLDKSSLAQIS-----------------------SEVPIELPFS------QQDHHQIKAG
--IARLTSPLEKPQDHSNHP--------------YNAEIVLWVSNNNAATCEEQF-----
-------------------------------------TVHCQITPAGMPIPGEFNRKSEQ
------------------