MUSCLE (3.8) multiple sequence alignment

TBLA0I03190        -----------------------MLTKLNFTL-----------ARQFHC---SSTCF---
KNAG0H03210        -----------------------MLANHWRPV-----LLRMPLRALHTR---FGPLAQEA
KAFR0B05480        ----------------------MNFLRVRGPT---LPNLLFGTRSLQ-----TSRLWLEE
CAGL0B01815g       ------------------------MLRIGSKV-----RYCNANRVIFNSALFGRRLLATE
NDAI0J01330        ---------MMLHSLKITRNTRMCALRLPSNN--YGVITRMLNTRSFHI---SRTSSLAA
NCAS0B03810        MKGTRYSISSTMNILRIPARATVAFNRVPIRGGLLAQCTSSSQSRGIHS---TSNVGAEE
AGR080W            ----------------------MLFSRVGLLS----------FRRGLHL---TAVQLSQE
Ecym_4302          -----------------------MFPRCLKLV--------TVRRGLNFT---SVRCAANN
TPHA0J00770        -----------------------MLKANFLQV---------TRKNAFHV---SRIIREEI
Suva_2.275         -----------------------MLPTTAIPK---ICIASPIRRYLSHT---ARQLYAEE
YDR116C            -----------------------MLSVVAIPK---ICVTGPARRCFFHT---AKKLYADD
Skud_4.376         -----------------------MLSVIATPK---ICVVSSTRRCLSHT---ASKLYAEE
Smik_4.360         -----------------------MLSVVAIPK---ICIASSTRRCLSHT---AKKLYAEE
Kpol_392.3         -----------------------MLSRSFGIL---------SRRCEYHS---GRVLLAEA
ZYRO0C01518g       -----------------------MIGLIPSLR---SQLLGSTSRCLFHT---AALLRAEE
KLLA0F19272g       -----------------------MFPRIFTRQ--------------FQI---TSFRLAEE
TDEL0F03950        ---------------------MLNFSCIGRSV---------LRRSFLHT---GNVLRAEE
SAKL0H16896g       ---------------------MSLLTKLSSSYGIITLPISCTRTSLFHT---FTALKSEE
KLTH0G13552g       -----------------------MFSGLSSRF---LPLVRASPVRRLHV---SASLRAEE
Kwal_56.23775      -----------------------MLSRLSKRI---VPLVQFPYARNLHA---FSALRAEE
                                                                               

TBLA0I03190        ---------------------------------------------KARILSKNHPLKMEV
KNAG0H03210        VTGAAVA------------AAPAQPKLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSV
KAFR0B05480        -------------------ASVAPSKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKV
CAGL0B01815g       AAPI---------------PQAAAPTLTKEQAKKREMKRLALKKAEAKKPANIHPLYMPI
NDAI0J01330        VAATEDASESKSTTSGTNMPPANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEV
NCAS0B03810        AASTTTSA-----------TIPVVPTLSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPV
AGR080W            -------------------AAATSSKLSKDQLKKRELRRLAQRKAAARRPASASPLYMPV
Ecym_4302          -------------------SPSSTTKLSKEQMKKKELRALLQKRAAAKKSPFEHPLYMPV
TPHA0J00770        TGAEG--------------PIAQVSKLSKDQLKKRELRRFTIRKREAKMPATSHPLYMQV
Suva_2.275         YKTAA--------------MSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPV
YDR116C            YKPAA--------------MSSNAPSLTKDQAKKRELKRLVQRKAEAKRPATASPLYMPV
Skud_4.376         YKSTA--------------MSSNAPSLTKEQAKKRELKRLAQRRAEAKRPAATNPLYMPV
Smik_4.360         YKPTA--------------MSSNAPSLTKDQAKKRELKRLAQRKAEAKRPAATNPLYMPV
Kpol_392.3         VAASETA------------SAKPVSKSVKDKLKRRELRRHSKRKADARKPASSYPLYMPI
ZYRO0C01518g       ----------------------AGSKLTKEQLRKREVRRAARRKVEAKKPAHTHPLYMPT
KLLA0F19272g       ----------------------TGTKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPV
TDEL0F03950        -------------------AAANVSKLSKDQLKKREIRRLAQRKAAAKKSPSDHPLYMSI
SAKL0H16896g       -------------------PSTIATKLSKDQLKRRELRRLVQRKAAARKPAADHPLYMPV
KLTH0G13552g       P------------------VGNATSKLSKDQLKKREVRRFAQKKAAARRPASEHPLYMPV
Kwal_56.23775      T------------------PSPVVSKLSKDQLRKREIRKLAQKKAAARRPATDHPLYMPV
                                                                 *.  .    : :  

TBLA0I03190        PLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAVFTEDPEQ
KNAG0H03210        PEAMRILRAVEVGQPTSQQTITLTTMVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPEL
KAFR0B05480        PDALRFLRAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKK
CAGL0B01815g       PLALRYLRSAEVGRPTQHQTITVTTLVVADKGNAALAGNILFPHPLKQMKIAIFSSNKEK
NDAI0J01330        VDALRFIRAAEVGRPEGQQTITLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKEL
NCAS0B03810        VEALRYIRAAEVGRPSGQQTITLTSLVVNEKGVAPLNGHISLPRPLKALKVAVFSQNEEL
AGR080W            QQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTNDPEQ
Ecym_4302          QQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVFTNNKEQ
TPHA0J00770        PQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDETQ
Suva_2.275         TMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFTNDEVK
YDR116C            TKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFTNDESK
Skud_4.376         TVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFTNDENK
Smik_4.360         TMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFTNDENK
Kpol_392.3         SQALRYLRAAEVGQPISQQIITITTDVVSERGNLNLNGNISYNTPIKDVKIAVFSNDPEK
ZYRO0C01518g       PLALRYLRAVEVGYPASQQVITVTTSVVADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQ
KLLA0F19272g       SRALRYLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQ
TDEL0F03950        PMALRFLRAAEVGQPQTQQTITLTTAVVAERGVPALAGSVSFPKPLKEVKIAVFSGDEDQ
SAKL0H16896g       TQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFTNDEDK
KLTH0G13552g       DKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQ
Kwal_56.23775      DKALRFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQ
                     *:* :*: * *     * :.: : :   .*   : * :     :.   :. :: :   

TBLA0I03190        HKIAKE-MG--IDIIGGSELIDKIASGEQKIT-FQTAFATTDMVQDLA-RVAQKLGKQKV
KNAG0H03210        LKRLQEEVE--LEIVGGAELIDQLKSGEVPVQ-FDKAFATPDIAPQLNSKLGALLGRRGL
KAFR0B05480        LEEVQDNFKN-VHLVGGRELVDKFKNEDIEID-FDKVVATPDILNYTNQNLGKMFGPKGL
CAGL0B01815g       LDELKSKYSKQVKIAGGEDMIADIKSGKIKVDGVNKVFATPEIFPTIASQLGRVLGPKGL
NDAI0J01330        LEEVKSQFN--CQLVGGNETVEGIKDGTIRAN-FDVAFATPEIVPFINSQLGKQLGRRGI
NCAS0B03810        LTRMKEKYH--CHLVGGVELINKIKNGEVKTD-FDKAFASSDMANILSAQLGKTLGRRGL
AGR080W            AETARTKYG--CYLVGGAELVEQLKSGEVKVD-FDKAFATPDIAPLMAAKLGRVLGPKGL
Ecym_4302          EEVAREQFK--CHLVGGTELIEAIKNGDTPID-FDKALATPDVVAQLTSQLASVLGPRRL
TPHA0J00770        MKIAKEKFN--CYVVGGSELISKIKNGEIEVD-FDKAFATPDIVQELGS-VARILGPRGV
Suva_2.275         LKELREKYP--NLIVGGTDLVAKIKNNESPVD-FDKAFATPDIVPTLQSQVARILGPRGV
YDR116C            LEELREKYP--NHLIGGADLVAKIKSGEISVD-FDKAFATPDIVPALQSQVARILGPRGV
Skud_4.376         LKELREKYP--NHLIGGADLVSRIKNGEIPVD-FDKAYATADIVPALQSQVARILGPRGV
Smik_4.360         LEELRKKYP--NHLIGGADLVARIKSGEIPVD-FDKAFATPDIVPTLQSQVARILGPRGV
Kpol_392.3         LAKIKEEHN--CHLIGGTDLVEKIKSGKQPVD-FDKAFATPDISPMLTSQLARVLGPRGV
ZYRO0C01518g       LSMARDKFR--CHLVGGSDIIAKIKQGEIPVD-FDKAFATPDIAQELTSQVARILGPKQV
KLLA0F19272g       AALMKDKYS--VHLVGGSDLVSQIKAGEVSID-FDKAFATPDIVPQLASQVGRILGPRGL
TDEL0F03950        LKVAREKFN--CHLVGGTEIIEKIKSGEIPVD-FDKAFATPDIAPALTSQLARILGPRGV
SAKL0H16896g       LKIARDQFN--CHLVGGSELIEKIKKGEVPLD-FDKAFATPDIAISLTSQLGRILGPRGL
KLTH0G13552g       AQIAREKFN--CHVVGGSELVEKIKQGQVPLD-FDKSFATPEIATLLASQLGRILGPRGL
Kwal_56.23775      AQIAREKFG--CHLVGGSDLVEKIKEGAVSLD-FDKSFATPEITTLLASQLGRILGPRGL
                       .        : ** : :  :         .:   *:.::       :.  :* . :

TBLA0I03190        LPQLKK---KTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKAREG
KNAG0H03210        LPNIKK---GTVGPDLLAMIRSKVGAMPFRQRAANLAFGIAKCHFSDRQVLGNLIAAREA
KAFR0B05480        LPNVKK---GTVSENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATREA
CAGL0B01815g       MPNLKKQHQNTVGEDLDSLIEENLGQVSFRQRGNSLSVSVGRCNFSDRDILENIIAVRNA
NDAI0J01330        LPNTKK---GTVSDDLVTLMNAKMGNIPFKQTGNNISIPIGKCYFSDKDILLNIIAARDA
NCAS0B03810        LPNAKK---GTVSDDLESLLADKIGSLPFRQTGNCISIGIGKCHFSDEEILRNIIAARSA
AGR080W            LPSVKK---GTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAA
Ecym_4302          LPAVKK---GTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKA
TPHA0J00770        FPSIKK---GTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLISVRKA
Suva_2.275         LPSVKK---GTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTA
YDR116C            LPSVKK---GTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQNIISARAA
Skud_4.376         LPSVKK---GTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIAARAA
Smik_4.360         LPSLKK---GTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSA
Kpol_392.3         LPTIKK---GTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILENIIAVRSA
ZYRO0C01518g       LPMAKR---GTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTA
KLLA0F19272g       LPTAKK---GTVAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKA
TDEL0F03950        LPTVKK---GTVATDVSRLVQDSMGSMPFRQRGNAISIAVGKSSFSDRQILENAIATHDA
SAKL0H16896g       LPNAKK---GTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKS
KLTH0G13552g       LPAAKK---GTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKS
Kwal_56.23775      LPAAKK---GTVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKG
                   :*  *.    **  ::  ::  ..   .* :    ::. :..  *:* ::: * : .. .

TBLA0I03190        LQKALREQNNKKPSTIIKATLTSTHGPGIDIDLF-
KNAG0H03210        FQLAIQNQKSKKRSILGRSTLSSTHGPGIVIDLA-
KAFR0B05480        FLNTLSNQKTKKQSTLGKTTLTSTHGPGIVIDFI-
CAGL0B01815g       FKQSVSSQVAKKPSILGKTTISTTAGPGIVIDFQ-
NDAI0J01330        FKEALANQKAKRPSILSKTTLSSTHGPGIVIDFV-
NCAS0B03810        VMKALSEQKSKKPSILGKTTLSSTHGPGIVIDFI-
AGR080W            FRAAMTSQKTKKTSLFGTTTLTSTHGPGIVIDFLK
Ecym_4302          FKQALADQQGKKSSILGKTTVTSTHGPGIVIDFR-
TPHA0J00770        FKDSVSTQKTKKPSILGKTILSTTHGPGIVIDFS-
Suva_2.275         FRAAVDNQKAKKPSLLSKTTLSSTHGPGIVIDFA-
YDR116C            FKTAVDNQKSKKPNILSKTTLSSTHGPGIVIDFA-
Skud_4.376         FKAAVSDQKSKKPNILSKTTLSSTHGPGIVIDFA-
Smik_4.360         FKAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDFA-
Kpol_392.3         YNTTLSSQKSKKPSLLGKTTITSTHGPGITIDFA-
ZYRO0C01518g       FKEAVSNQKAKRPSILGRTTLTTTHGPGIVIDLV-
KLLA0F19272g       FKQSITNQQTKKPSILSQTTLTSTHGPGIVIDFA-
TDEL0F03950        VKEALANQVSKKTSLLGKTTLSSTHGPGIVIDFA-
SAKL0H16896g       FKLALANQKAKKPSILGQTTLTTTHGPGLVIDFA-
KLTH0G13552g       VKEALANQKAKKPSLLGQTTLTSTRGPGIVIDFA-
Kwal_56.23775      LKEALATQKTKKPSLLGQTTLTSTHGPGIVIDFA-
                      ::  *  *. . :  : :::* ***: **:  

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0I03190
-----------------------MLTKLNFTL-----------ARQFHC---SSTCF---
---------------------------------------------KARILSKNHPLKMEV
PLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAVFTEDPEQ
HKIAKE-MG--IDIIGGSELIDKIASGEQKIT-FQTAFATTDMVQDLA-RVAQKLGKQKV
LPQLKK---KTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKAREG
LQKALREQNNKKPSTIIKATLTSTHGPGIDIDLF-
>KNAG0H03210
-----------------------MLANHWRPV-----LLRMPLRALHTR---FGPLAQEA
VTGAAVA------------AAPAQPKLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSV
PEAMRILRAVEVGQPTSQQTITLTTMVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPEL
LKRLQEEVE--LEIVGGAELIDQLKSGEVPVQ-FDKAFATPDIAPQLNSKLGALLGRRGL
LPNIKK---GTVGPDLLAMIRSKVGAMPFRQRAANLAFGIAKCHFSDRQVLGNLIAAREA
FQLAIQNQKSKKRSILGRSTLSSTHGPGIVIDLA-
>KAFR0B05480
----------------------MNFLRVRGPT---LPNLLFGTRSLQ-----TSRLWLEE
-------------------ASVAPSKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKV
PDALRFLRAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKK
LEEVQDNFKN-VHLVGGRELVDKFKNEDIEID-FDKVVATPDILNYTNQNLGKMFGPKGL
LPNVKK---GTVSENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATREA
FLNTLSNQKTKKQSTLGKTTLTSTHGPGIVIDFI-
>CAGL0B01815g
------------------------MLRIGSKV-----RYCNANRVIFNSALFGRRLLATE
AAPI---------------PQAAAPTLTKEQAKKREMKRLALKKAEAKKPANIHPLYMPI
PLALRYLRSAEVGRPTQHQTITVTTLVVADKGNAALAGNILFPHPLKQMKIAIFSSNKEK
LDELKSKYSKQVKIAGGEDMIADIKSGKIKVDGVNKVFATPEIFPTIASQLGRVLGPKGL
MPNLKKQHQNTVGEDLDSLIEENLGQVSFRQRGNSLSVSVGRCNFSDRDILENIIAVRNA
FKQSVSSQVAKKPSILGKTTISTTAGPGIVIDFQ-
>NDAI0J01330
---------MMLHSLKITRNTRMCALRLPSNN--YGVITRMLNTRSFHI---SRTSSLAA
VAATEDASESKSTTSGTNMPPANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEV
VDALRFIRAAEVGRPEGQQTITLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKEL
LEEVKSQFN--CQLVGGNETVEGIKDGTIRAN-FDVAFATPEIVPFINSQLGKQLGRRGI
LPNTKK---GTVSDDLVTLMNAKMGNIPFKQTGNNISIPIGKCYFSDKDILLNIIAARDA
FKEALANQKAKRPSILSKTTLSSTHGPGIVIDFV-
>NCAS0B03810
MKGTRYSISSTMNILRIPARATVAFNRVPIRGGLLAQCTSSSQSRGIHS---TSNVGAEE
AASTTTSA-----------TIPVVPTLSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPV
VEALRYIRAAEVGRPSGQQTITLTSLVVNEKGVAPLNGHISLPRPLKALKVAVFSQNEEL
LTRMKEKYH--CHLVGGVELINKIKNGEVKTD-FDKAFASSDMANILSAQLGKTLGRRGL
LPNAKK---GTVSDDLESLLADKIGSLPFRQTGNCISIGIGKCHFSDEEILRNIIAARSA
VMKALSEQKSKKPSILGKTTLSSTHGPGIVIDFI-
>AGR080W
----------------------MLFSRVGLLS----------FRRGLHL---TAVQLSQE
-------------------AAATSSKLSKDQLKKRELRRLAQRKAAARRPASASPLYMPV
QQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTNDPEQ
AETARTKYG--CYLVGGAELVEQLKSGEVKVD-FDKAFATPDIAPLMAAKLGRVLGPKGL
LPSVKK---GTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAA
FRAAMTSQKTKKTSLFGTTTLTSTHGPGIVIDFLK
>Ecym_4302
-----------------------MFPRCLKLV--------TVRRGLNFT---SVRCAANN
-------------------SPSSTTKLSKEQMKKKELRALLQKRAAAKKSPFEHPLYMPV
QQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVFTNNKEQ
EEVAREQFK--CHLVGGTELIEAIKNGDTPID-FDKALATPDVVAQLTSQLASVLGPRRL
LPAVKK---GTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKA
FKQALADQQGKKSSILGKTTVTSTHGPGIVIDFR-
>TPHA0J00770
-----------------------MLKANFLQV---------TRKNAFHV---SRIIREEI
TGAEG--------------PIAQVSKLSKDQLKKRELRRFTIRKREAKMPATSHPLYMQV
PQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDETQ
MKIAKEKFN--CYVVGGSELISKIKNGEIEVD-FDKAFATPDIVQELGS-VARILGPRGV
FPSIKK---GTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLISVRKA
FKDSVSTQKTKKPSILGKTILSTTHGPGIVIDFS-
>Suva_2.275
-----------------------MLPTTAIPK---ICIASPIRRYLSHT---ARQLYAEE
YKTAA--------------MSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPV
TMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFTNDEVK
LKELREKYP--NLIVGGTDLVAKIKNNESPVD-FDKAFATPDIVPTLQSQVARILGPRGV
LPSVKK---GTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTA
FRAAVDNQKAKKPSLLSKTTLSSTHGPGIVIDFA-
>YDR116C
-----------------------MLSVVAIPK---ICVTGPARRCFFHT---AKKLYADD
YKPAA--------------MSSNAPSLTKDQAKKRELKRLVQRKAEAKRPATASPLYMPV
TKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFTNDESK
LEELREKYP--NHLIGGADLVAKIKSGEISVD-FDKAFATPDIVPALQSQVARILGPRGV
LPSVKK---GTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQNIISARAA
FKTAVDNQKSKKPNILSKTTLSSTHGPGIVIDFA-
>Skud_4.376
-----------------------MLSVIATPK---ICVVSSTRRCLSHT---ASKLYAEE
YKSTA--------------MSSNAPSLTKEQAKKRELKRLAQRRAEAKRPAATNPLYMPV
TVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFTNDENK
LKELREKYP--NHLIGGADLVSRIKNGEIPVD-FDKAYATADIVPALQSQVARILGPRGV
LPSVKK---GTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIAARAA
FKAAVSDQKSKKPNILSKTTLSSTHGPGIVIDFA-
>Smik_4.360
-----------------------MLSVVAIPK---ICIASSTRRCLSHT---AKKLYAEE
YKPTA--------------MSSNAPSLTKDQAKKRELKRLAQRKAEAKRPAATNPLYMPV
TMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFTNDENK
LEELRKKYP--NHLIGGADLVARIKSGEIPVD-FDKAFATPDIVPTLQSQVARILGPRGV
LPSLKK---GTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSA
FKAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDFA-
>Kpol_392.3
-----------------------MLSRSFGIL---------SRRCEYHS---GRVLLAEA
VAASETA------------SAKPVSKSVKDKLKRRELRRHSKRKADARKPASSYPLYMPI
SQALRYLRAAEVGQPISQQIITITTDVVSERGNLNLNGNISYNTPIKDVKIAVFSNDPEK
LAKIKEEHN--CHLIGGTDLVEKIKSGKQPVD-FDKAFATPDISPMLTSQLARVLGPRGV
LPTIKK---GTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILENIIAVRSA
YNTTLSSQKSKKPSLLGKTTITSTHGPGITIDFA-
>ZYRO0C01518g
-----------------------MIGLIPSLR---SQLLGSTSRCLFHT---AALLRAEE
----------------------AGSKLTKEQLRKREVRRAARRKVEAKKPAHTHPLYMPT
PLALRYLRAVEVGYPASQQVITVTTSVVADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQ
LSMARDKFR--CHLVGGSDIIAKIKQGEIPVD-FDKAFATPDIAQELTSQVARILGPKQV
LPMAKR---GTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTA
FKEAVSNQKAKRPSILGRTTLTTTHGPGIVIDLV-
>KLLA0F19272g
-----------------------MFPRIFTRQ--------------FQI---TSFRLAEE
----------------------TGTKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPV
SRALRYLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQ
AALMKDKYS--VHLVGGSDLVSQIKAGEVSID-FDKAFATPDIVPQLASQVGRILGPRGL
LPTAKK---GTVAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKA
FKQSITNQQTKKPSILSQTTLTSTHGPGIVIDFA-
>TDEL0F03950
---------------------MLNFSCIGRSV---------LRRSFLHT---GNVLRAEE
-------------------AAANVSKLSKDQLKKREIRRLAQRKAAAKKSPSDHPLYMSI
PMALRFLRAAEVGQPQTQQTITLTTAVVAERGVPALAGSVSFPKPLKEVKIAVFSGDEDQ
LKVAREKFN--CHLVGGTEIIEKIKSGEIPVD-FDKAFATPDIAPALTSQLARILGPRGV
LPTVKK---GTVATDVSRLVQDSMGSMPFRQRGNAISIAVGKSSFSDRQILENAIATHDA
VKEALANQVSKKTSLLGKTTLSSTHGPGIVIDFA-
>SAKL0H16896g
---------------------MSLLTKLSSSYGIITLPISCTRTSLFHT---FTALKSEE
-------------------PSTIATKLSKDQLKRRELRRLVQRKAAARKPAADHPLYMPV
TQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFTNDEDK
LKIARDQFN--CHLVGGSELIEKIKKGEVPLD-FDKAFATPDIAISLTSQLGRILGPRGL
LPNAKK---GTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKS
FKLALANQKAKKPSILGQTTLTTTHGPGLVIDFA-
>KLTH0G13552g
-----------------------MFSGLSSRF---LPLVRASPVRRLHV---SASLRAEE
P------------------VGNATSKLSKDQLKKREVRRFAQKKAAARRPASEHPLYMPV
DKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQ
AQIAREKFN--CHVVGGSELVEKIKQGQVPLD-FDKSFATPEIATLLASQLGRILGPRGL
LPAAKK---GTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKS
VKEALANQKAKKPSLLGQTTLTSTRGPGIVIDFA-
>Kwal_56.23775
-----------------------MLSRLSKRI---VPLVQFPYARNLHA---FSALRAEE
T------------------PSPVVSKLSKDQLRKREIRKLAQKKAAARRPATDHPLYMPV
DKALRFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQ
AQIAREKFG--CHLVGGSDLVEKIKEGAVSLD-FDKSFATPEITTLLASQLGRILGPRGL
LPAAKK---GTVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKG
LKEALATQKTKKPSLLGQTTLTSTHGPGIVIDFA-