MUSCLE (3.8) multiple sequence alignment

NDAI0J01340        MSLSILQKIGRYSKACSLLSLRSMANQSFNNIGLRSFSSFSSTTTSTISSLI---NQSYM
AGR081C            MLTAPSDEHTVLHYTIVAHRTMFSMYRSMLQWSSRRTIM---------TVVS---PVRKM
CAGL0B01793g       ------------------------MLSSSFGVLRPMNLT----------------PGNGM
Kpol_543.42        ----------------------MFLVKRLNAVPTGTIMT------SLTSGMNRSISSSIF
KNAG0H03220        ---------------------MSLLLSTVAGIARTRAVG---------ASAL---LTGGI
TPHA0A01770        ---------------------MSFLTRSFNQLMTGRVIP----------------NNTLV
TBLA0E04470        ----------------------MGIFNSLTRIACFSKST----------------ALNSM
NCAS0B03820        ----------------------MSLFNRISSHLRPVTLGAGTRWFSM-GTSS---SLGLI
KAFR0B05490        ---------------------MLPIIKTNRNTSIFKSVI-------L-NTVQ---STNVF
Skud_4.375         ----------------------MTLLTSLYQLQSKRMLS------SI-SSFS---ALSVL
Smik_4.359         ----------------------MTLFARLYQLQSRRMIS------SI-SSFS---ALTVL
YDR115W            ----------------------MPLFARLCQPQSRRMFS------SI-SSFS---ALSVL
Suva_2.274         ----------------------MSLFGRLYQFQSRRMFS------SI-SPIS---ALSVL
TDEL0F03940        ---------------------MSFLARKPLQLNARRTLT------SL-SSFS---PLRSL
ZYRO0C01540g       ---------------------MWSFARNIFQVGARRSLF------TM-GNWT---PTTV-
SAKL0H16918g       ---------------------MSFLSKHLFHFSARRTFT------TF-SSFS---PLRSL
KLTH0G13574g       ---------------------MSFIYNRLFQFSARRSLS------SL-SSFS---PLNAV
Kwal_56.23776      ---MIRHIVTLRGWSFPILETMSFLSSRLFQFSARRSLT------TM-SSFS---PLNVC
KLLA0F19250g       ---------------------MSFITRNLLQWTSKRTLT------SF-SSFS---PLRTL
Ecym_4303          ---------------------MLYKSRSLLQWFPRRSLV------TLVSSFS---PMKSL
                                                                               

NDAI0J01340        -----TNTFSSGLTTTPLAS-SSSSSSSLILPSTSPFMINQKRWKSRGNTYQPSTLKRKR
AGR081C            -----APVPQIQYGAIGAFT-PAAAPKPSMLSMLLGL--TQKRWKSRGNTYQPSTLKRKR
CAGL0B01793g       -----IGKNSVSLIRNEISS------GTSFSSILTLF-PLQRRWKSRGNTYQPSTLKRKR
Kpol_543.42        -----RPFAGLNSVGLFPGT-----ATNTFGSAITGLLGLQRRWKSRGNTYQPSTLKRKR
KNAG0H03220        -----RPTTGVV--------------------------TLTRRWKSRGNTYQPSTLKRKR
TPHA0A01770        -----DSIKNSILGGNAIGS---RTGLASILGLNLDL-GLQRRWKSRGNTYQPSTLKRKR
TBLA0E04470        -----SLLNKSLLIN------------NNIIGNNKLM-IDSRRWKSRGNTYQPSTLKRKR
NCAS0B03820        -------RQGITGLGSPMGS--NVLSQSPMMGSLLPFGILQRRWKSRGNTYQPSTLKRKR
KAFR0B05490        --------------------------------FILPF-FGQKRWKSRGNTYQPSTLKRKR
Skud_4.375         -----RPQSSMLLNSPPMKT-------MSLTALGFGF-IGQRRWKSRGNTYQPSTLKRKR
Smik_4.359         -----RPQTSMIMNSSPLKT-------MSLTTFGFGF-IDQRRWKSRGNTYQPSTLKRKR
YDR115W            -----RPQTGMLLNSSPLKT-------PSFTPLGFGL-IGQRRWKSRGNTYQPSTLKRKR
Suva_2.274         -----RPQTSMLLNSSPLKT-------MSLTPFGFGF-IGQRRWKSRGNTYQPSTLKRKR
TDEL0F03940        -----FAQNKSQGLLGVPET----HSPLSSISLLFPFGIMQRRWKSRGNTFQPSTLKRKR
ZYRO0C01540g       -----SPLQRLLG--------------PSPLSSGFGM--GQRRWKSRGNTFQPSTLKRKR
SAKL0H16918g       -----NSQALVNH-NNPLLSQSQSQQPSSIMNILLGL--TQRRWKSRGNTYQPSTLKRKR
KLTH0G13574g       -----SCRPSVFQAAAPMAAERSSQGSSPLFSALFGF--TQRRWKSRGNTYQPSTLKRKR
Kwal_56.23776      -----MFRSPVSQVNNSIATGSSSSAMPSYLSSLFGL--TQKRWKSRGNTYQPSTLKRKR
KLLA0F19250g       DSRLHRPLAQVNPMEITLQS-QTQANGSSIFGMLFDL--TQRRWKSRGNTFQPSTLKRKR
Ecym_4303          -----VQPLATSAANTSVST----FQRPSVISLVFGL--NQRRWKSRGNTFQPSTLKRKR
                                                            .********:*********

NDAI0J01340        KYGFLSRMRDRQASKILKRRKLKGRWFLSH
AGR081C            RVGFLARARSRTGRNILKRRREKGRWYLTH
CAGL0B01793g       KFGFLARMTNKRTAKIIKRRKEKGRWYLTH
Kpol_543.42        KFGFLARARSRSGSKILERRKAKGRWYLSH
KNAG0H03220        KFGFLARVRASFRSKVLKRRKEKGRWYLSH
TPHA0A01770        RIGFLARARSKQGNKILERRKAKGRWYLTH
TBLA0E04470        KHGFLSRAKSYTMNKILKRRKAKGRWFLSH
NCAS0B03820        KFGFLAKARDSQKCKILKRRRLKGRWYLTH
KAFR0B05490        KFGFLSRAKSKQKSKILKDRKEKGRWYLSH
Skud_4.375         TFGFLARAKSKQGSKILKRRKLKGRWFLSH
Smik_4.359         TFGFLARAKSKQGSKILKRRKLKGRWFLSH
YDR115W            TFGFLARAKSKQGSKILKRRKLKGRWFLSH
Suva_2.274         TFGFLARAKSKQGSKILKRRKLKGRWFLSH
TDEL0F03940        RIGFLARARSKTGSRVLQRRKAKGRWYLTY
ZYRO0C01540g       RVGFLARARSKQGSKILQRRKHKGRWFLTH
SAKL0H16918g       RVGFLARAKNKQASKILKSRKEKGRWYLTH
KLTH0G13574g       RVGFLARAKSKQGYKVLKRRREKGRWYLTH
Kwal_56.23776      RVGFLARVKSKQGSKILKRRREKGRWYLTH
KLLA0F19250g       RVGFLARARSRSGQQILKRRKNKGRWYLTY
Ecym_4303          RVGFLARARSKTGQKILKRRKEKGRWYLTY
                     ***:.       .::: *. ****:*::

FASTA FORMAT for MUSCLE Version 3.6

>NDAI0J01340
MSLSILQKIGRYSKACSLLSLRSMANQSFNNIGLRSFSSFSSTTTSTISSLI---NQSYM
-----TNTFSSGLTTTPLAS-SSSSSSSLILPSTSPFMINQKRWKSRGNTYQPSTLKRKR
KYGFLSRMRDRQASKILKRRKLKGRWFLSH
>AGR081C
MLTAPSDEHTVLHYTIVAHRTMFSMYRSMLQWSSRRTIM---------TVVS---PVRKM
-----APVPQIQYGAIGAFT-PAAAPKPSMLSMLLGL--TQKRWKSRGNTYQPSTLKRKR
RVGFLARARSRTGRNILKRRREKGRWYLTH
>CAGL0B01793g
------------------------MLSSSFGVLRPMNLT----------------PGNGM
-----IGKNSVSLIRNEISS------GTSFSSILTLF-PLQRRWKSRGNTYQPSTLKRKR
KFGFLARMTNKRTAKIIKRRKEKGRWYLTH
>Kpol_543.42
----------------------MFLVKRLNAVPTGTIMT------SLTSGMNRSISSSIF
-----RPFAGLNSVGLFPGT-----ATNTFGSAITGLLGLQRRWKSRGNTYQPSTLKRKR
KFGFLARARSRSGSKILERRKAKGRWYLSH
>KNAG0H03220
---------------------MSLLLSTVAGIARTRAVG---------ASAL---LTGGI
-----RPTTGVV--------------------------TLTRRWKSRGNTYQPSTLKRKR
KFGFLARVRASFRSKVLKRRKEKGRWYLSH
>TPHA0A01770
---------------------MSFLTRSFNQLMTGRVIP----------------NNTLV
-----DSIKNSILGGNAIGS---RTGLASILGLNLDL-GLQRRWKSRGNTYQPSTLKRKR
RIGFLARARSKQGNKILERRKAKGRWYLTH
>TBLA0E04470
----------------------MGIFNSLTRIACFSKST----------------ALNSM
-----SLLNKSLLIN------------NNIIGNNKLM-IDSRRWKSRGNTYQPSTLKRKR
KHGFLSRAKSYTMNKILKRRKAKGRWFLSH
>NCAS0B03820
----------------------MSLFNRISSHLRPVTLGAGTRWFSM-GTSS---SLGLI
-------RQGITGLGSPMGS--NVLSQSPMMGSLLPFGILQRRWKSRGNTYQPSTLKRKR
KFGFLAKARDSQKCKILKRRRLKGRWYLTH
>KAFR0B05490
---------------------MLPIIKTNRNTSIFKSVI-------L-NTVQ---STNVF
--------------------------------FILPF-FGQKRWKSRGNTYQPSTLKRKR
KFGFLSRAKSKQKSKILKDRKEKGRWYLSH
>Skud_4.375
----------------------MTLLTSLYQLQSKRMLS------SI-SSFS---ALSVL
-----RPQSSMLLNSPPMKT-------MSLTALGFGF-IGQRRWKSRGNTYQPSTLKRKR
TFGFLARAKSKQGSKILKRRKLKGRWFLSH
>Smik_4.359
----------------------MTLFARLYQLQSRRMIS------SI-SSFS---ALTVL
-----RPQTSMIMNSSPLKT-------MSLTTFGFGF-IDQRRWKSRGNTYQPSTLKRKR
TFGFLARAKSKQGSKILKRRKLKGRWFLSH
>YDR115W
----------------------MPLFARLCQPQSRRMFS------SI-SSFS---ALSVL
-----RPQTGMLLNSSPLKT-------PSFTPLGFGL-IGQRRWKSRGNTYQPSTLKRKR
TFGFLARAKSKQGSKILKRRKLKGRWFLSH
>Suva_2.274
----------------------MSLFGRLYQFQSRRMFS------SI-SPIS---ALSVL
-----RPQTSMLLNSSPLKT-------MSLTPFGFGF-IGQRRWKSRGNTYQPSTLKRKR
TFGFLARAKSKQGSKILKRRKLKGRWFLSH
>TDEL0F03940
---------------------MSFLARKPLQLNARRTLT------SL-SSFS---PLRSL
-----FAQNKSQGLLGVPET----HSPLSSISLLFPFGIMQRRWKSRGNTFQPSTLKRKR
RIGFLARARSKTGSRVLQRRKAKGRWYLTY
>ZYRO0C01540g
---------------------MWSFARNIFQVGARRSLF------TM-GNWT---PTTV-
-----SPLQRLLG--------------PSPLSSGFGM--GQRRWKSRGNTFQPSTLKRKR
RVGFLARARSKQGSKILQRRKHKGRWFLTH
>SAKL0H16918g
---------------------MSFLSKHLFHFSARRTFT------TF-SSFS---PLRSL
-----NSQALVNH-NNPLLSQSQSQQPSSIMNILLGL--TQRRWKSRGNTYQPSTLKRKR
RVGFLARAKNKQASKILKSRKEKGRWYLTH
>KLTH0G13574g
---------------------MSFIYNRLFQFSARRSLS------SL-SSFS---PLNAV
-----SCRPSVFQAAAPMAAERSSQGSSPLFSALFGF--TQRRWKSRGNTYQPSTLKRKR
RVGFLARAKSKQGYKVLKRRREKGRWYLTH
>Kwal_56.23776
---MIRHIVTLRGWSFPILETMSFLSSRLFQFSARRSLT------TM-SSFS---PLNVC
-----MFRSPVSQVNNSIATGSSSSAMPSYLSSLFGL--TQKRWKSRGNTYQPSTLKRKR
RVGFLARVKSKQGSKILKRRREKGRWYLTH
>KLLA0F19250g
---------------------MSFITRNLLQWTSKRTLT------SF-SSFS---PLRTL
DSRLHRPLAQVNPMEITLQS-QTQANGSSIFGMLFDL--TQRRWKSRGNTFQPSTLKRKR
RVGFLARARSRSGQQILKRRKNKGRWYLTY
>Ecym_4303
---------------------MLYKSRSLLQWFPRRSLV------TLVSSFS---PMKSL
-----VQPLATSAANTSVST----FQRPSVISLVFGL--NQRRWKSRGNTFQPSTLKRKR
RVGFLARARSKTGQKILKRRKEKGRWYLTY