MUSCLE (3.8) multiple sequence alignment

CAGL0L12298g       --------MGAVETDKENNVV----GT--------LREKGPATPTQ-LLKRTRSTL----
KNAG0H03230        ---------MQDNEDKENAVA------------------VPQTPASNILDGSGVVL-KPV
KAFR0B05510        ---------MSNQSDKENNLS------T-------IPVLALQTPNTNFVKKNTTST----
TBLA0E04460        -----------MNSNKENIFT------------------APRTPSP-QLKRDSSNILKFN
KLLA0F19206g       ----------MPNEGKENIIS---VQDP-------DNDLGLRTPLN-QMKRTDSLV----
AGR083W            ---------MKKHEDKENLVT----SAG-------RGAMMPRTPIH-QLKRSSSNL----
Ecym_4305          ---------MKKHEDKENIPT---GSEP-------SGSIVPRTPMH-QLKRSTSNV----
NDAI0J01350        MSSTNGNNKVNPDEDKENASTFYDHHQHFRSG---KPILFPQTPAH-LLKRSSSILSKQK
NCAS0B03830        -------MSLDTNEDKENKTT-YESHVH-STK---QSHLMPETPAHLLLKRSLSTVLKPN
TPHA0A01780        ---MPNRDTLNVNSDKENDIA-YKNNDPLFVKDAISNRTVPQTPMDKLLKRTHSKTLSTA
Kpol_543.41        -----------MDQNKENNIF----RHA-------MLKDMPQTPNN-LLKRTHSKLKTGI
TDEL0F03920        ---------MPINENKENDLV-LNLPES-------GGVSFPQTPAH-LLKRSQSAMMKPS
ZYRO0C01584g       -------MVGKVQDNKENNVV-LDPGEN-------GSLALPQTPIH-LLKRSQPNVLKPE
Suva_2.273         ---------MPANEDKENNIV-YTGNES-------SSTSFPQTPAH-LLKRSHSNVLKPP
Skud_4.374         ---------MPANEDKENNIV-YTGNES-------SGINFPQTPAH-LLKRSHSNVLKPP
YDR113C            --------MMPANEDKENNIV-YTGNES-------SGINFPQTPAH-LLKRSHSNILKPP
Smik_4.358         ---------MPANEDKENNIV-YSGNGS-------SNLNFPQTPAH-LLKRSHSNVLKPP
SAKL0H16962g       ---------MRTHENKENVIF--------------SSENLPTTPSH-LLKRSQSFM----
KLTH0G13618g       ---------MGRHEDKENSIW--------------SESNVPVTPRH-LLSRSQSFM----
Kwal_56.23781      ---------MGARENKENAIW--------------SERSVPVTPTH-LLSRSQSFM----
                                 .***                        **    :.          

CAGL0L12298g       ---------------------------LPK-------KNGQRQPLASKDKNYN-RSSSYL
KNAG0H03230        GSRGK---------------QSFSVRKSPT--------RGGRLPLASKDNN-----ASGL
KAFR0B05510        -------------------------RISPLKRL----QQQGKLPLQSKNGN---KSNSIL
TBLA0E04460        STTH-----------------TNVLKSKITDVPSNASGITARRPLASKDKN---VRRTAL
KLLA0F19206g       --------------------------------------RGNRRPLASKDNN---RTQSIL
AGR083W            -----------------------------------AGRNSTRMPLASKDRN---QSQGVF
Ecym_4305          -----------------------------------HLKNNSRLPLASKDRN---RSQSGF
NDAI0J01350        PDIKPGNLELQLQSDAGAGAVPP--NISPRRQL---LQLQNRFPLSKKDNN-----NSFI
NCAS0B03830        SVNA----------------TDELGNISPRRRQ--LLQLQNRLPLAKKDNN----NSSFS
TPHA0A01780        V----------------------FKDAQQSKENNNNNIKLNRLPLASKDNNNSRRSNSFI
Kpol_543.41        AKD-----------------IQGGNVINTS--------PQKRLPLASKDNN---RSNSFL
TDEL0F03920        GEEN--PSNLTYRDCDA-----PVKRASPSRRV-----QQGRPPLASKDNN---RSTGFL
ZYRO0C01584g       ENTP----------------VKKSRSVSPV-------RGQRRLPLASKDHN---KSS---
Suva_2.273         VRLDQLKKDVNSNSGKNLKYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNN---RSKSFV
Skud_4.374         VRLDQLKKDLNSNNGKGLKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNN---RSKSFV
YDR113C            VRLDQLKRDANSNNGNTLKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNN---RSKSFI
Smik_4.358         TRLDQLKKDVNSNNCNALKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNN---RAKSFI
SAKL0H16962g       ---------------------KPLASNSPTK------KSGKRLPLASKDNN---KSNTLI
KLTH0G13618g       ------------------------KNKSPK-------RAEARRPLASKDNN---RSVSYL
Kwal_56.23781      ------------------------KNISPK-------RAEQRKPLASKDNN---KSTGFL
                                                            . **  *: *         

CAGL0L12298g       SLKRNS---NQKKLKP----------------------------------------AVTR
KNAG0H03230        VVSGKL---GRQPADQVRE--------------------------------ANSSRKLKR
KAFR0B05510        ISHKG------------------------------------------------NNTRIKK
TBLA0E04460        GQVKSS---ISSNNSNTNSTNNNDKNKNN----------------------MLPMNRLKK
KLLA0F19206g       SVKNNA---ALGKSDHPLKRPASSFMK------------------------NMPENKLKK
AGR083W            GLKTSG---AGGAGGAQAQSKRPASSSIAK---------------------NMPDSKLKK
Ecym_4305          NLKQQL---VQGHVGGGVMVGQNKSKRPASNSFVK----------------NMPDSKLKK
NDAI0J01350        LKQQQQ---------------------------------------------QFDHKRLKK
NCAS0B03830        SRKNG----------------------------------------------LNNIKKLKK
TPHA0A01780        LQNNKL---VLNKQLSLLNNNQTS-------------------------------NKLRK
Kpol_543.41        NNSNVN---LNFNINNNNNNNNNNINNNNIKKQHIFQQ--------NKSGILADDRKLKK
TDEL0F03920        PQLQKL---QQQPSLKRNLSQSKKRNANVVDGQL-----------------LTNPRRLKK
ZYRO0C01584g       ---------AAGPVKKRQPTLQGEL--------------------------LSNPRKLQK
Suva_2.273         FALETA---NQNKDAEIVPQQQNTLSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQK
Skud_4.374         FVSETT---NLSKDSEAIPQQQNTLSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQK
YDR113C            F-PETS---NQSKDAD-LPQLQNTLSIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQK
Smik_4.358         FIPENS---NQSKDADIIPQQQNTLSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQK
SAKL0H16962g       NNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFP----LLPDSRLKK
KLTH0G13618g       GTKEPL---RKRTRPGVNHAGS-----------------------------FVGNARLGP
Kwal_56.23781      GAKEPL---RKRTRPTVNHAGS-----------------------------FIGNTRPGV
                                                                               

CAGL0L12298g       AGSTANN---------ANRRVTSLILKDIASG--D-------------------------
KNAG0H03230        YGSLLGYDNR------QLTRSKSLILKDPEAP----------------------------
KAFR0B05510        YGSILGLENPGNF---KLPKTKSLILKDNESS----------------------------
TBLA0E04460        YGSVLGYSNNTI----NSNASKTLILKDIAPL----------------------------
KLLA0F19206g       YGSVLGMNT-------FMPRTKSLVLKDTELN----------------------------
AGR083W            YGSVLGVGYG------SLAKAKSLVLKDTSDC----------------------------
Ecym_4305          YGSVLGVNYP------HLTKTKSLVLKDASDG----------------------------
NDAI0J01350        YGSVLGLGTDGNNHN-NLTRIKSLVLKDIDDDDNAGSHTDNSTNGNIRGSLNYSAIPNLD
NCAS0B03830        YGSVLGMD--------ALPRTKSLILKDVDDK----------------------------
TPHA0A01780        YGSILGVNNNGNNTNKTLNPVKSLILKDIPDN--G-------------------------
Kpol_543.41        YGSVLGYN--------ALPKVKSLVLKDISDN----------------------------
TDEL0F03920        YGSVLGYN--------ALPKMKSLVLKDVDQV----------------------------
ZYRO0C01584g       YGSVLGYT--------DLPRTKSLVLKDGDDE----------------------------
Suva_2.273         YGSVLGYN--------ALPKMKSLVLKDLADP--A-------------------------
Skud_4.374         YGSVLGYN--------ALPKMKSLVLKDLAGP--A-------------------------
YDR113C            YGSVLGYN--------ALPKMKSLVLKDLADS--G-------------------------
Smik_4.358         YGSVLGYN--------ALPKMKSLVLKDLVDP--G-------------------------
SAKL0H16962g       YGSVLGYN--------GLPRVKSLVLKDVDERKVG-------------------------
KLTH0G13618g       APTLNAS---------GAPKIKSLVLKDGIEE-EG-------------------------
Kwal_56.23781      V-PILNTN--------GAPRIKSLVLKDDIEE----------------------------
                     .                  .:*:***                                

CAGL0L12298g       ------EKESASESDSEDDEE---SNPLALKIKQALTHSIA-----------SA------
KNAG0H03230        ----------------NESSK---SVTKRLLLDEEIAKNSS-----------DGDDD---
KAFR0B05510        ----------------ESEEE---DGLLNRKLKEALSRSQN-----------DEDREG--
TBLA0E04460        -------------EKDKHIED---------------------------------------
KLLA0F19206g       --------EKNDDEDEEDEED---DLPIFPS-----------------------------
AGR083W            ----------ESANEESEEEE---GNPLAAKLKSRLCSAEE-----------GGNED---
Ecym_4305          ------SQDNGEESDDYDDEE---GNPLAAKLRSRLTSGVE-----------DENED---
NDAI0J01350        FNIDTIQERRKGSDDDSEDDDTGADDLFGLKLKHAMNNNNN-----------NNN-----
NCAS0B03830        ------------PDDDEEDED---DNAFGLKLRNAMKQHEN-----------NSNEEENE
TPHA0A01780        ----------NENDDDDDDDD---DNIITLNLKNALQSKKEPLLNQLKNAKKNSYSDSE-
Kpol_543.41        -----------------EDDD---DDLLSLKLRDSMNKKSI-----------NTNKS---
TDEL0F03920        --------GEQGEDENDDEDE---DHILRLKLHNAIDRSDE-----------EG------
ZYRO0C01584g       --------------DDDEEEE---NSELQKKLQDAMNRRE--------------------
Suva_2.273         ------KNQESSDDDDGSEGT---DNKLSQKLQSAFFQQHS-----------SEDEHEF-
Skud_4.374         ------KNQESSDDDDGSEGP---ESKLGVKLQNAFLQQHS-----------SDDEHES-
YDR113C            ------KNEESSDDDEGNEDS---ESKLGKKLQSALLKQDS-----------SDGENEL-
Smik_4.358         ------KNEESSDDDDGSEGS---ENKLSKKLQNALLQQHS-----------SDDEHEF-
SAKL0H16962g       ------KSEEGEEEEEDDDEEEEEDNPLAAKLLKALNNHNE-----------DDKE----
KLTH0G13618g       ------SQSEGAEVDEDDDDD---SNRLAAKLRTKLLSRDR-----------DAE-----
Kwal_56.23781      -------EQSQSDGGEAEDDE---SNSLAAKLRGKLNARDR-----------DDS-----
                                                                               

CAGL0L12298g       ---EGKTGLLNGK--------SGLRKIF----------------------NDR--DLDRE
KNAG0H03230        ---GDDTDILKIR----SQLGGGLDRLV--RQ-----------------------SQNRE
KAFR0B05510        ---DGSVGLFAKE---------AFQNHI---------------------SNDD--DSEID
TBLA0E04460        -----------------------------------------------------------E
KLLA0F19206g       ---GKSLNLGFGN---------GLKALI--REK----------------------EDELN
AGR083W            ---DGSSGLLLGE---------ALSQLA-------------------AAGETQ--EDVPP
Ecym_4305          ---DGSSGLLLGG---------GLKKLI--KLHES--------D-----NQDT--EEVPQ
NDAI0J01350        ---SDGSGLLFHD------SNHGLHQLINFNKKNMPEKNSISQSVKLDNKKEDTYDEEDD
NCAS0B03830        GMSGLGIGLFHDNEDNSKSKLGGLQQLI--RENTKERSTSKIRSPLKTIGQDT--DSDRE
TPHA0A01780        ---EEEIGLFGKG--------NGLQKLI--SQSMN------HKT-----KIEA--EIIPE
Kpol_543.41        ---NSGIGLLSGG---------NLQQLI--RDAN---------------------EDVRE
TDEL0F03920        ---EEVGGLFDKS---------GLLHLV--RDSKK--------------DEDD--WEDRE
ZYRO0C01584g       ---DSNEGL------------GGLAKLV--R------------------------DTKDD
Suva_2.273         ---SGGIGLFNNQ--------GGLQQLI--KNTAK------GKEGP---GKED--GDDHD
Skud_4.374         ---NGDIGLFNNQ--------GGLQQLI--KNTTK------GKQGSKE-EDDD--DDDYE
YDR113C            ---NGGLGLFNEQ--------GGLQQLI--KNSTK------NEQKTKNDKSDK--TDDYD
Smik_4.358         ---SGDIGLFNNQ--------GGLQQLI--KNSVQ------NESKS---KSDN--ADGYE
SAKL0H16962g       ---EGSIGLLGSN--------TGLQQLL--KHRNV--------------EEGE--NSDFE
KLTH0G13618g       ---GEQTGLLGAT--------GGLQSLLGPKLSQR--------------AEES--DSDQE
Kwal_56.23781      ---TEQGGLLGAT--------GGLQGLANTKLHSE--------------TLDS--DSDLE
                                                                               

CAGL0L12298g       IEVASVREPEKPYEPEGYEPLDDSDLEKLKLKN-AIN----------RPTFI---MDSPR
KNAG0H03230        LEIRPQAQDELPYIPDGHIILHEADIAKLRDYAPRDI----------MIDDSGADDTDD-
KAFR0B05510        IINGKEKDVELSYIPDHYEVIAADEIEKLKQVN-LGT----------RFKSS---ASSG-
TBLA0E04460        IETRSYEPKELDYEPENYFGFNQEEIDGLNDYT-FNFNLQPNNEFDNNDNDD---NEADA
KLLA0F19206g       IEYAPKRQKELPYIPNGYDPFDKESIEKLQHHR-SPF----------QVESI---TFDT-
AGR083W            VEYAPEKLPELPHVPNGYESLKSADLAKLAKYH-SPF-----------LRFG---DKED-
Ecym_4305          IETAPEKVPELEHIPNGYEQFEDEEIVKLATYT-SPF-----------LRFA---DREE-
NDAI0J01350        IEYAPIREDSLPYIPQGYTPFTNEDINKLKVYH-SPF-------AIHHDHSD---YQQS-
NCAS0B03830        IEYAPIREEPLPFVPFGYTPFTPEDINKLKTFH-SSY----------KLDSP---VSTV-
TPHA0A01780        IETKSAAYPDLSYSPEGYIPFNNEDIKKLNTFK-SPY-----------SNLN---VNDSL
Kpol_543.41        IEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFN-SPF----------KLEQS---NSDD-
TDEL0F03920        IEYGPQRHEPLPYIPEGHLSLAQEDYDKLKTFR-SPY--------LIEDDYS---DSDD-
ZYRO0C01584g       IEYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVD-LRI----------RDDQD---DHED-
Suva_2.273         IEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFN-SPY----------GLDLE---GNSN-
Skud_4.374         IEIAPQRQEPLPYVPDGYPSFQREDIEKLRTFN-SPY----------ELDLE---DHGD-
YDR113C            IEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFN-SPY----------KLDLE---DEDD-
Smik_4.358         IEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFN-SPY----------ELDLE---DDGG-
SAKL0H16962g       IEIVPPHSEELPHVPNGYSPFKESDVIKLNTFT-SPF----------SMHKE---DSDC-
KLTH0G13618g       VEVIPPRPEPLPHVPEGYTPFGEQEIAKLQGVDVSPF----------QLNFS---GVDE-
Kwal_56.23781      VEVIPPRPEPLPHIPHGYTPFTDEDIGKLQDTEASPF----------QLNFA---DDDD-
                   :           . *  :      .   *                               

CAGL0L12298g       AISI--VGDDSPQLLPLDLEESK------------------LEEGVLNDKNTTDEVITRA
KNAG0H03230        --DKRQADGSSLQLLELE-----------------------------DIPDGPEHTQPEV
KAFR0B05510        --LN--DNDSTIQFLELEHV---------------------SDS---DTEENIDPSYNGV
TBLA0E04460        GDDS--LTDDTMSISSLEEIV--------------------IGT---STNENNHVNNKNS
KLLA0F19206g       -------EERDPELISLAA----------------------TDE---DLVSPTRYNNHKH
AGR083W            --EENTEPGDSQQLIPLEFGA--------------------LDD---SQSSSDEDDATSN
Ecym_4305          --DDSDSTEGERLLIPLDFGG--------------------IDE---SPSKKQELMATQE
NDAI0J01350        --PS--TLGDPEMLLSLQSFDTQTATTSSSCASPSLYPTTPIHK---DTNINTTDQKHNT
NCAS0B03830        --------EDADKLLALETIE--------------------TSV---DDEAEWEHEVRHH
TPHA0A01780        LADH--NNNNNSGLLELENVG--------------------SSD---DDDDNNLLNISNI
Kpol_543.41        -------EEDSSELLLLANT---------------------SDD---EGTHNDKITTNKN
TDEL0F03920        --------DKQDGFLQLEEIGSA------------------GDD---ENIERENLTVKQR
ZYRO0C01584g       --NE--PQENDDGLLPLMSIESN------------------NED---SNENEADEILPKN
Suva_2.273         ----NTNSADKVGLLSLVEV---------------------NEE---DEKDNTTHTIGDQ
Skud_4.374         -------SVDRVGLLSLEVI---------------------DEE---AEQDGTAHTTGDP
YDR113C            -------TPDKVDLLPLEQI---------------------DEE---GEKDETECITRNQ
Smik_4.358         -------STDKVDLLPLEAI---------------------NEE---SEQDEIVHIAGDR
SAKL0H16962g       --EE---CDDYDGLLTISMVK--------------------SED---EEQDDDTNDRKRR
KLTH0G13618g       --DEDINSQDSTQLFTLNFD---------------------RDD---NDDTDADQSGRKR
Kwal_56.23781      --DA--SSQDSTQLFTLKL----------------------DND---DNLGDQEHDRKRL
                                :  :                                           

CAGL0L12298g       NTQAKNANITESID----DCSSVEIDSIYD-GRGLDEQELLDLLD---
KNAG0H03230        HLNT--------------LDRFPQIAGSEDWENGLTNDDIEDLINGI-
KAFR0B05510        NRIGKNSTKSKSID----FDITEEIGTKYA-GSGLDDDDIEAMLRDL-
TBLA0E04460        NMINNIHTKQDQTQSDDELELETMITGHFD-GSGLNNQDLFDLLN---
KLLA0F19206g       NLELDSDN----------ESITIELGEEYN-GQGLDTLELNSLLD---
AGR083W            GAALGAIALS--------QEEPDEVQFEFAVGEGLDSKDLHSLLD---
Ecym_4305          NIIANKTIVDEL------GTQADEIQFSFDIGKGLSSNELQSLLD---
NDAI0J01350        VILNVHNNDNESEGEYG-GEHDQEIDKIYN-GDGLDEDDLNDLINDLQ
NCAS0B03830        RRRPTRDS----------NDDSIDLVPLYN-GEGLDEDDLQDLLADLH
TPHA0A01780        QDGRGSRQTNDNE-----TFIDFEIQPSYN-D-GLDANELENLLDI--
Kpol_543.41        LSINNKPNSKDVI-----PADILDIEPSY--GEGLDSNDLEDLLDL--
TDEL0F03920        EMLP--------------QYDTFEIQPSYC-GEGLDASDLNDLLKD--
ZYRO0C01584g       HRIHPFPKLR--------VFDEDQVENIYN-GEGLNAEELEDLLA---
Suva_2.273         QEPAELSLALQNSEDDD-NAAMPLIESLYN-GEGLDSEELEDLLT---
Skud_4.374         EACAAPPLLSKRLKE---GTASPTINLLCS-GEGLEPEELEDLLT---
YDR113C            EEGAALPLLSKNFKE---VAAVPTMELVYS-EEGLDPEELEDLVT---
Smik_4.358         EEGTPLPLLSKNLRK---ITAIPTIESLCN-GEGLDPEELEDLIT---
SAKL0H16962g       KSWIDEGLATARHGLFDFNKPELYIEPHYN-GEGLNKEDLESLLD---
KLTH0G13618g       HHTPERTTIPISTGQRR-KSDVFELEPTYA-GNGLTAKELESLLE---
Kwal_56.23781      HTPEKKPTRASIAQ----QAADFELDPIYA-GHGLSTKELESLLE---
                                           :        **   ::  ::    

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0L12298g
--------MGAVETDKENNVV----GT--------LREKGPATPTQ-LLKRTRSTL----
---------------------------LPK-------KNGQRQPLASKDKNYN-RSSSYL
SLKRNS---NQKKLKP----------------------------------------AVTR
AGSTANN---------ANRRVTSLILKDIASG--D-------------------------
------EKESASESDSEDDEE---SNPLALKIKQALTHSIA-----------SA------
---EGKTGLLNGK--------SGLRKIF----------------------NDR--DLDRE
IEVASVREPEKPYEPEGYEPLDDSDLEKLKLKN-AIN----------RPTFI---MDSPR
AISI--VGDDSPQLLPLDLEESK------------------LEEGVLNDKNTTDEVITRA
NTQAKNANITESID----DCSSVEIDSIYD-GRGLDEQELLDLLD---
>KNAG0H03230
---------MQDNEDKENAVA------------------VPQTPASNILDGSGVVL-KPV
GSRGK---------------QSFSVRKSPT--------RGGRLPLASKDNN-----ASGL
VVSGKL---GRQPADQVRE--------------------------------ANSSRKLKR
YGSLLGYDNR------QLTRSKSLILKDPEAP----------------------------
----------------NESSK---SVTKRLLLDEEIAKNSS-----------DGDDD---
---GDDTDILKIR----SQLGGGLDRLV--RQ-----------------------SQNRE
LEIRPQAQDELPYIPDGHIILHEADIAKLRDYAPRDI----------MIDDSGADDTDD-
--DKRQADGSSLQLLELE-----------------------------DIPDGPEHTQPEV
HLNT--------------LDRFPQIAGSEDWENGLTNDDIEDLINGI-
>KAFR0B05510
---------MSNQSDKENNLS------T-------IPVLALQTPNTNFVKKNTTST----
-------------------------RISPLKRL----QQQGKLPLQSKNGN---KSNSIL
ISHKG------------------------------------------------NNTRIKK
YGSILGLENPGNF---KLPKTKSLILKDNESS----------------------------
----------------ESEEE---DGLLNRKLKEALSRSQN-----------DEDREG--
---DGSVGLFAKE---------AFQNHI---------------------SNDD--DSEID
IINGKEKDVELSYIPDHYEVIAADEIEKLKQVN-LGT----------RFKSS---ASSG-
--LN--DNDSTIQFLELEHV---------------------SDS---DTEENIDPSYNGV
NRIGKNSTKSKSID----FDITEEIGTKYA-GSGLDDDDIEAMLRDL-
>TBLA0E04460
-----------MNSNKENIFT------------------APRTPSP-QLKRDSSNILKFN
STTH-----------------TNVLKSKITDVPSNASGITARRPLASKDKN---VRRTAL
GQVKSS---ISSNNSNTNSTNNNDKNKNN----------------------MLPMNRLKK
YGSVLGYSNNTI----NSNASKTLILKDIAPL----------------------------
-------------EKDKHIED---------------------------------------
-----------------------------------------------------------E
IETRSYEPKELDYEPENYFGFNQEEIDGLNDYT-FNFNLQPNNEFDNNDNDD---NEADA
GDDS--LTDDTMSISSLEEIV--------------------IGT---STNENNHVNNKNS
NMINNIHTKQDQTQSDDELELETMITGHFD-GSGLNNQDLFDLLN---
>KLLA0F19206g
----------MPNEGKENIIS---VQDP-------DNDLGLRTPLN-QMKRTDSLV----
--------------------------------------RGNRRPLASKDNN---RTQSIL
SVKNNA---ALGKSDHPLKRPASSFMK------------------------NMPENKLKK
YGSVLGMNT-------FMPRTKSLVLKDTELN----------------------------
--------EKNDDEDEEDEED---DLPIFPS-----------------------------
---GKSLNLGFGN---------GLKALI--REK----------------------EDELN
IEYAPKRQKELPYIPNGYDPFDKESIEKLQHHR-SPF----------QVESI---TFDT-
-------EERDPELISLAA----------------------TDE---DLVSPTRYNNHKH
NLELDSDN----------ESITIELGEEYN-GQGLDTLELNSLLD---
>AGR083W
---------MKKHEDKENLVT----SAG-------RGAMMPRTPIH-QLKRSSSNL----
-----------------------------------AGRNSTRMPLASKDRN---QSQGVF
GLKTSG---AGGAGGAQAQSKRPASSSIAK---------------------NMPDSKLKK
YGSVLGVGYG------SLAKAKSLVLKDTSDC----------------------------
----------ESANEESEEEE---GNPLAAKLKSRLCSAEE-----------GGNED---
---DGSSGLLLGE---------ALSQLA-------------------AAGETQ--EDVPP
VEYAPEKLPELPHVPNGYESLKSADLAKLAKYH-SPF-----------LRFG---DKED-
--EENTEPGDSQQLIPLEFGA--------------------LDD---SQSSSDEDDATSN
GAALGAIALS--------QEEPDEVQFEFAVGEGLDSKDLHSLLD---
>Ecym_4305
---------MKKHEDKENIPT---GSEP-------SGSIVPRTPMH-QLKRSTSNV----
-----------------------------------HLKNNSRLPLASKDRN---RSQSGF
NLKQQL---VQGHVGGGVMVGQNKSKRPASNSFVK----------------NMPDSKLKK
YGSVLGVNYP------HLTKTKSLVLKDASDG----------------------------
------SQDNGEESDDYDDEE---GNPLAAKLRSRLTSGVE-----------DENED---
---DGSSGLLLGG---------GLKKLI--KLHES--------D-----NQDT--EEVPQ
IETAPEKVPELEHIPNGYEQFEDEEIVKLATYT-SPF-----------LRFA---DREE-
--DDSDSTEGERLLIPLDFGG--------------------IDE---SPSKKQELMATQE
NIIANKTIVDEL------GTQADEIQFSFDIGKGLSSNELQSLLD---
>NDAI0J01350
MSSTNGNNKVNPDEDKENASTFYDHHQHFRSG---KPILFPQTPAH-LLKRSSSILSKQK
PDIKPGNLELQLQSDAGAGAVPP--NISPRRQL---LQLQNRFPLSKKDNN-----NSFI
LKQQQQ---------------------------------------------QFDHKRLKK
YGSVLGLGTDGNNHN-NLTRIKSLVLKDIDDDDNAGSHTDNSTNGNIRGSLNYSAIPNLD
FNIDTIQERRKGSDDDSEDDDTGADDLFGLKLKHAMNNNNN-----------NNN-----
---SDGSGLLFHD------SNHGLHQLINFNKKNMPEKNSISQSVKLDNKKEDTYDEEDD
IEYAPIREDSLPYIPQGYTPFTNEDINKLKVYH-SPF-------AIHHDHSD---YQQS-
--PS--TLGDPEMLLSLQSFDTQTATTSSSCASPSLYPTTPIHK---DTNINTTDQKHNT
VILNVHNNDNESEGEYG-GEHDQEIDKIYN-GDGLDEDDLNDLINDLQ
>NCAS0B03830
-------MSLDTNEDKENKTT-YESHVH-STK---QSHLMPETPAHLLLKRSLSTVLKPN
SVNA----------------TDELGNISPRRRQ--LLQLQNRLPLAKKDNN----NSSFS
SRKNG----------------------------------------------LNNIKKLKK
YGSVLGMD--------ALPRTKSLILKDVDDK----------------------------
------------PDDDEEDED---DNAFGLKLRNAMKQHEN-----------NSNEEENE
GMSGLGIGLFHDNEDNSKSKLGGLQQLI--RENTKERSTSKIRSPLKTIGQDT--DSDRE
IEYAPIREEPLPFVPFGYTPFTPEDINKLKTFH-SSY----------KLDSP---VSTV-
--------EDADKLLALETIE--------------------TSV---DDEAEWEHEVRHH
RRRPTRDS----------NDDSIDLVPLYN-GEGLDEDDLQDLLADLH
>TPHA0A01780
---MPNRDTLNVNSDKENDIA-YKNNDPLFVKDAISNRTVPQTPMDKLLKRTHSKTLSTA
V----------------------FKDAQQSKENNNNNIKLNRLPLASKDNNNSRRSNSFI
LQNNKL---VLNKQLSLLNNNQTS-------------------------------NKLRK
YGSILGVNNNGNNTNKTLNPVKSLILKDIPDN--G-------------------------
----------NENDDDDDDDD---DNIITLNLKNALQSKKEPLLNQLKNAKKNSYSDSE-
---EEEIGLFGKG--------NGLQKLI--SQSMN------HKT-----KIEA--EIIPE
IETKSAAYPDLSYSPEGYIPFNNEDIKKLNTFK-SPY-----------SNLN---VNDSL
LADH--NNNNNSGLLELENVG--------------------SSD---DDDDNNLLNISNI
QDGRGSRQTNDNE-----TFIDFEIQPSYN-D-GLDANELENLLDI--
>Kpol_543.41
-----------MDQNKENNIF----RHA-------MLKDMPQTPNN-LLKRTHSKLKTGI
AKD-----------------IQGGNVINTS--------PQKRLPLASKDNN---RSNSFL
NNSNVN---LNFNINNNNNNNNNNINNNNIKKQHIFQQ--------NKSGILADDRKLKK
YGSVLGYN--------ALPKVKSLVLKDISDN----------------------------
-----------------EDDD---DDLLSLKLRDSMNKKSI-----------NTNKS---
---NSGIGLLSGG---------NLQQLI--RDAN---------------------EDVRE
IEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFN-SPF----------KLEQS---NSDD-
-------EEDSSELLLLANT---------------------SDD---EGTHNDKITTNKN
LSINNKPNSKDVI-----PADILDIEPSY--GEGLDSNDLEDLLDL--
>TDEL0F03920
---------MPINENKENDLV-LNLPES-------GGVSFPQTPAH-LLKRSQSAMMKPS
GEEN--PSNLTYRDCDA-----PVKRASPSRRV-----QQGRPPLASKDNN---RSTGFL
PQLQKL---QQQPSLKRNLSQSKKRNANVVDGQL-----------------LTNPRRLKK
YGSVLGYN--------ALPKMKSLVLKDVDQV----------------------------
--------GEQGEDENDDEDE---DHILRLKLHNAIDRSDE-----------EG------
---EEVGGLFDKS---------GLLHLV--RDSKK--------------DEDD--WEDRE
IEYGPQRHEPLPYIPEGHLSLAQEDYDKLKTFR-SPY--------LIEDDYS---DSDD-
--------DKQDGFLQLEEIGSA------------------GDD---ENIERENLTVKQR
EMLP--------------QYDTFEIQPSYC-GEGLDASDLNDLLKD--
>ZYRO0C01584g
-------MVGKVQDNKENNVV-LDPGEN-------GSLALPQTPIH-LLKRSQPNVLKPE
ENTP----------------VKKSRSVSPV-------RGQRRLPLASKDHN---KSS---
---------AAGPVKKRQPTLQGEL--------------------------LSNPRKLQK
YGSVLGYT--------DLPRTKSLVLKDGDDE----------------------------
--------------DDDEEEE---NSELQKKLQDAMNRRE--------------------
---DSNEGL------------GGLAKLV--R------------------------DTKDD
IEYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVD-LRI----------RDDQD---DHED-
--NE--PQENDDGLLPLMSIESN------------------NED---SNENEADEILPKN
HRIHPFPKLR--------VFDEDQVENIYN-GEGLNAEELEDLLA---
>Suva_2.273
---------MPANEDKENNIV-YTGNES-------SSTSFPQTPAH-LLKRSHSNVLKPP
VRLDQLKKDVNSNSGKNLKYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNN---RSKSFV
FALETA---NQNKDAEIVPQQQNTLSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQK
YGSVLGYN--------ALPKMKSLVLKDLADP--A-------------------------
------KNQESSDDDDGSEGT---DNKLSQKLQSAFFQQHS-----------SEDEHEF-
---SGGIGLFNNQ--------GGLQQLI--KNTAK------GKEGP---GKED--GDDHD
IEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFN-SPY----------GLDLE---GNSN-
----NTNSADKVGLLSLVEV---------------------NEE---DEKDNTTHTIGDQ
QEPAELSLALQNSEDDD-NAAMPLIESLYN-GEGLDSEELEDLLT---
>Skud_4.374
---------MPANEDKENNIV-YTGNES-------SGINFPQTPAH-LLKRSHSNVLKPP
VRLDQLKKDLNSNNGKGLKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNN---RSKSFV
FVSETT---NLSKDSEAIPQQQNTLSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQK
YGSVLGYN--------ALPKMKSLVLKDLAGP--A-------------------------
------KNQESSDDDDGSEGP---ESKLGVKLQNAFLQQHS-----------SDDEHES-
---NGDIGLFNNQ--------GGLQQLI--KNTTK------GKQGSKE-EDDD--DDDYE
IEIAPQRQEPLPYVPDGYPSFQREDIEKLRTFN-SPY----------ELDLE---DHGD-
-------SVDRVGLLSLEVI---------------------DEE---AEQDGTAHTTGDP
EACAAPPLLSKRLKE---GTASPTINLLCS-GEGLEPEELEDLLT---
>YDR113C
--------MMPANEDKENNIV-YTGNES-------SGINFPQTPAH-LLKRSHSNILKPP
VRLDQLKRDANSNNGNTLKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNN---RSKSFI
F-PETS---NQSKDAD-LPQLQNTLSIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQK
YGSVLGYN--------ALPKMKSLVLKDLADS--G-------------------------
------KNEESSDDDEGNEDS---ESKLGKKLQSALLKQDS-----------SDGENEL-
---NGGLGLFNEQ--------GGLQQLI--KNSTK------NEQKTKNDKSDK--TDDYD
IEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFN-SPY----------KLDLE---DEDD-
-------TPDKVDLLPLEQI---------------------DEE---GEKDETECITRNQ
EEGAALPLLSKNFKE---VAAVPTMELVYS-EEGLDPEELEDLVT---
>Smik_4.358
---------MPANEDKENNIV-YSGNGS-------SNLNFPQTPAH-LLKRSHSNVLKPP
TRLDQLKKDVNSNNCNALKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNN---RAKSFI
FIPENS---NQSKDADIIPQQQNTLSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQK
YGSVLGYN--------ALPKMKSLVLKDLVDP--G-------------------------
------KNEESSDDDDGSEGS---ENKLSKKLQNALLQQHS-----------SDDEHEF-
---SGDIGLFNNQ--------GGLQQLI--KNSVQ------NESKS---KSDN--ADGYE
IEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFN-SPY----------ELDLE---DDGG-
-------STDKVDLLPLEAI---------------------NEE---SEQDEIVHIAGDR
EEGTPLPLLSKNLRK---ITAIPTIESLCN-GEGLDPEELEDLIT---
>SAKL0H16962g
---------MRTHENKENVIF--------------SSENLPTTPSH-LLKRSQSFM----
---------------------KPLASNSPTK------KSGKRLPLASKDNN---KSNTLI
NNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFP----LLPDSRLKK
YGSVLGYN--------GLPRVKSLVLKDVDERKVG-------------------------
------KSEEGEEEEEDDDEEEEEDNPLAAKLLKALNNHNE-----------DDKE----
---EGSIGLLGSN--------TGLQQLL--KHRNV--------------EEGE--NSDFE
IEIVPPHSEELPHVPNGYSPFKESDVIKLNTFT-SPF----------SMHKE---DSDC-
--EE---CDDYDGLLTISMVK--------------------SED---EEQDDDTNDRKRR
KSWIDEGLATARHGLFDFNKPELYIEPHYN-GEGLNKEDLESLLD---
>KLTH0G13618g
---------MGRHEDKENSIW--------------SESNVPVTPRH-LLSRSQSFM----
------------------------KNKSPK-------RAEARRPLASKDNN---RSVSYL
GTKEPL---RKRTRPGVNHAGS-----------------------------FVGNARLGP
APTLNAS---------GAPKIKSLVLKDGIEE-EG-------------------------
------SQSEGAEVDEDDDDD---SNRLAAKLRTKLLSRDR-----------DAE-----
---GEQTGLLGAT--------GGLQSLLGPKLSQR--------------AEES--DSDQE
VEVIPPRPEPLPHVPEGYTPFGEQEIAKLQGVDVSPF----------QLNFS---GVDE-
--DEDINSQDSTQLFTLNFD---------------------RDD---NDDTDADQSGRKR
HHTPERTTIPISTGQRR-KSDVFELEPTYA-GNGLTAKELESLLE---
>Kwal_56.23781
---------MGARENKENAIW--------------SERSVPVTPTH-LLSRSQSFM----
------------------------KNISPK-------RAEQRKPLASKDNN---KSTGFL
GAKEPL---RKRTRPTVNHAGS-----------------------------FIGNTRPGV
V-PILNTN--------GAPRIKSLVLKDDIEE----------------------------
-------EQSQSDGGEAEDDE---SNSLAAKLRGKLNARDR-----------DDS-----
---TEQGGLLGAT--------GGLQGLANTKLHSE--------------TLDS--DSDLE
VEVIPPRPEPLPHIPHGYTPFTDEDIGKLQDTEASPF----------QLNFA---DDDD-
--DA--SSQDSTQLFTLKL----------------------DND---DNLGDQEHDRKRL
HTPEKKPTRASIAQ----QAADFELDPIYA-GHGLSTKELESLLE---