MUSCLE (3.8) multiple sequence alignment

AGR085W            -------------MAIGMLRRNSSGTAVSVLQGRVLRTR-RLSSVKDGS-----------
TBLA0F03060        ----------------MTMNQK--------------------------------------
TPHA0A01800        ------------------------------------------MESEHFT-----------
Kpol_543.39        ------------------------------------------------M-----------
Ecym_4307          -----MMAILRSAATVENMLIKNSGLQATMDVLHGLPHA-TMGLRSISS-----------
TBLA0E04440        -----MIKTCNRHSSHSLRGMSQTTLFKSPSSSSLFRSTSSSSLYIPPP-----------
Suva_2.271         ----------------MTMTDQK--------------DL-KSVFTTKDL-----------
Skud_4.372         ----------------MTMTHQQ--------------DL-KSVFIAKDL-----------
Smik_4.357         ----------------MAMTHQQ--------------DL-KSVFTTKDL-----------
YDR111C            ----------------MTMTHQQ--------------DL-KGVFTAKDL-----------
KNAG0M01210        ----------------MILSNEQKQMHWTTSSSKKRQHT-GDDSTVSGL-----------
KLTH0G13662g       ----------------MMLSRQLTRTMPHSRLILRRLSA-KAAVKSDLS-----------
Kwal_56.23791      -----------------MLSRPIIRSMPHSRLVLRHLST-RPGLRKDYS-----------
KAFR0B05530        ----------------MQLTEEFAATTQYFPVR-------KALDDDTIH-----------
NDAI0J01360        -------------------------------------MA-THTIQTDLH-----------
NCAS0B03840        ----------------------------------------MSPLSLENN-----------
CAGL0L12254g       -----MLRSTTSKSLSKMPHAIPPQCRR-SHSSSIFQTK-KRLAHLESD-----------
KAFR0B02730        ---MTTLSISRRSSSLNAFFTKMSPSVTILPPNTYSYYS-TKSFSNPKP-----------
KNAG0G02040        -----MLAARPYSTKMSVVYRGGGSLNSTTKRFFLTTSQ-KMAPSVILR-----QQPNDL
Suva_10.173        -----MLSLSAKNH--FTVNNSITHIVKSYHIKTLTTSA-KKMPHITTSFTTTASSTKLK
Skud_12.157        -----MLSLSVKNR--CTASNCITDIIKSYHIRTLTTSV-KKMPYINPPFITTASNTKLK
Smik_12.148        -----MSYLSAKTH--FTVSNSISQAIKSYHIRTLTSRA-EKMPHISTPFTTSASNTNLK
YLR089C            -----MLSLSAKNH--FTVSNSITHVIKSYHIRTLTSSA-EKMPHITTPFSTSASSTKLK
TDEL0F03900        -----MSSIAVTQR--CYMRSTSVGLIS---------RA-SAMPHTITT-----------
KLLA0F19162g       -----MLSVRV-----NLKTRISSGMIRV-NAPALKSTM-PSVTSLTQL-----------
SAKL0H17006g       -----MLTVAIRTPSLRMLRTTTAGNIAKNMPHSTLFLR-SFSSNFVPY-----------
ZYRO0C01628g       ------MVLLARPRILLSSRRTLLQVAQRYKSAQTEAHLHHIHSKVSNV-----------
NDAI0B01990        MSVASIITFRRSTS--TAVTTNFANLKQLNKMATCTYSI-KANVSNSNS--NNIKTINSN
NCAS0B05020        -----MMHSTPLLSSSKFASRQLRILTRTYSVNLTNNKFNNKMPHFMEP-----------
TPHA0J00750        ----------------MMLRSRSTNCTVNAAIALSGKRL-LSLTTISLK-----------
Kpol_392.5         -----------------MLRSGNCSISLVRRVGVRRLTL-STTLYEHKH-----------
                                                                               

AGR085W            ---------------------------------------------------RFV----PA
TBLA0F03060        ---------------------------------------------------TFL----PA
TPHA0A01800        ---------------------------------------------------DFT----PV
Kpol_543.39        ---------------------------------------------------SFV----PA
Ecym_4307          ----------------------------------------------GTSRIRFE----PG
TBLA0E04440        -------------------TALVRSISSSSILSNSSNASVTSPLSYSTSREKSY----FA
Suva_2.271         ---------------------------------------------------DFK----PA
Skud_4.372         ---------------------------------------------------DFK----PA
Smik_4.357         ---------------------------------------------------NFK----PA
YDR111C            ---------------------------------------------------DFK----PA
KNAG0M01210        ---------------------------------------------------AFE----PA
KLTH0G13662g       ---------------------------------------------------QKA----LG
Kwal_56.23791      ---------------------------------------------------QKP----LG
KAFR0B05530        ---------------------------------------------------NFK----PA
NDAI0J01360        ---------------------------------------------------DFE----PA
NCAS0B03840        ---------------------------------------------------DFQ----PA
CAGL0L12254g       --RPYLTHLPRSMNSSPNLRFHSSASSSSLRSSFLNTE----IHHHSHNNLPFL----PA
KAFR0B02730        ----------------------------------------------RKHNLNFK----PA
KNAG0G02040        IIQPYQHFDIGPKPSLIISRKFSASENIKMPHAVKRQRKPAKDQLHSKSHYKFT----PA
Suva_10.173        AFRQVRPVLQRHSSSWMAAQGQKRSISGQSSLKDLRHLNRFPHHTLKTANNEFY----PA
Skud_12.157        AFRKVRPVLQRHSSSWVAGQSHSRSLSGQSSLNDLRHLNRFPHHTLKTGNDDFY----PA
Smik_12.148        AFRKIRPVLQRHSSSWIAAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFY----PA
YLR089C            AFRKVRPVLQRHSSSWIVAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFY----PA
TDEL0F03900        -------TLQGRSGLGRSYMNIKRARSTSSTAAGLHHI------YHKKCHQDFY----PA
KLLA0F19162g       ---------------------------------------------------RFSTTVKPA
SAKL0H17006g       ---------------------------------------------------KFQ----PA
ZYRO0C01628g       -------------------------------------------------LGAVY----PA
NDAI0B01990        QVKKSPLIIKATTTAIPEYQFFDAKRALMTRSISHHSL---KVAKGK----DFA----PA
NCAS0B05020        -------------STSPQYPYFETKRTISSAATKLKTK---PKPTTKKNHNNFL----PA
TPHA0J00750        -------------------------------------------------HKNFK----PA
Kpol_392.5         ---------------------------------------------------NVY----PA
                                                                               

AGR085W            EPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEH--PGSLPFSKIIQANIGNPQQLG
TBLA0F03060        PKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLEN--SKSLPFAKIVYANIGNPQQLD
TPHA0A01800        AKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKD--PKSLPFNKIINANIGNPQQLG
Kpol_543.39        EKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIIND--PGSLPFDKIITANIGNPQQVG
Ecym_4307          DPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRD--PDSLPFKKIIYANIGNPQQLG
TBLA0E04440        ERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKH--PGTLPFESVINSNIGNPQQLG
Suva_2.271         AKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRS--SNSLPFNSIINANIGNPQQLD
Skud_4.372         AKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKN--PGLLPFDDIINANIGNPQQLD
Smik_4.357         AKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRK--PGVLPFDDIINANIGNPQQLD
YDR111C            GKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKN--PEVLPFDDIINANIGNPQQLD
KNAG0M01210        RKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQ--PDLLPFNAITVANIGNPQQLD
KLTH0G13662g       SKKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEE--PGSLPFNKIINANIGNPQQLD
Kwal_56.23791      SKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEE--PGSLPFDKIINANIGNPQQLD
KAFR0B05530        KKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNPQQLD
NDAI0J01360        PKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKN--PHSLPFNEITVANIGNPQELH
NCAS0B03840        PKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKN--PHCLPFDEITVANIGNPQELN
CAGL0L12254g       EQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMEN--PHSLPFNDIINANIGNPQQLK
KAFR0B02730        GQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEK--PNSLPFDKIINANIGNPQQLQ
KNAG0G02040        AQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQED--PRSLPFDKIINANIGNPQQLN
Suva_10.173        EQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKD--PQSLPFNKIINANIGNPQQLQ
Skud_12.157        EQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKD--PQSLPFDKIINANIGNPQQLQ
Smik_12.148        EQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKD--PQSLPFNKIINANIGNPQQLQ
YLR089C            EQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKD--PQSLPFDRIINANIGNPQQLQ
TDEL0F03900        ESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRD--PSSLPFDKIVNANIGNPQQLN
KLLA0F19162g       PKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKD--PSSLPFSKIISANIGNPQQLD
SAKL0H17006g       DKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARD--PKSLPFDRIINANIGNPQQLD
ZYRO0C01628g       EKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKD--PHSLPFDNIVSANIGNPQHLK
NDAI0B01990        EQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENN--PSTLPFSQIVNANIGNPQQLK
NCAS0B05020        DQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQED--PSSLPFDHIVNANIGNPQQLN
TPHA0J00750        DKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDN--PSSLPFKKVINANIGNPQQLN
Kpol_392.5         QKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG---QKLPFDTVINANIGNPQQLK
                         ::*     : :*:** *.  *  *   :        *.*  :  :****** : 

AGR085W            QKPLTFYRQVISLMQNPQLLEM----PA-EWLQQAFKADVVVRARRMLQDAGGSVGAYSA
TBLA0F03060        QQPLTFQRQVMSLVQFPDLLKS--K-DI-LLAQKIYSKDSIERATKLLNSIGGSVGAYSS
TPHA0A01800        QKPLSFIRKVLSILQYPDILEDESKLQT-LIELRVYQKDVVRRARKLLGEIGGSVGAYSL
Kpol_543.39        QKPLTFIRQVLSILEYPNILNDPELLEK-LVQLGVYQRDVIERARKMLDSIGGSVGAYSA
Ecym_4307          QKPLSFSREVLSLLESPNLLQM----PM-EVLNLIYKPDAVRRAKRMMRDLQTSIGAYSH
TBLA0E04440        QKPLSFGRQVLSILEYPALLDH--E-RT-LVDSMGYAPDSIERAKTLLTDIG-SIGAYSN
Suva_2.271         QKPLTFTRQVLSILEYPEILRV-DH-DK-LASLNLFAKDALKRAQRLLDDIGGSVGAYSH
Skud_4.372         QKPLTFTRQVLSILEYPEILQV-DH-EK-LASLNLFSKDALKRAECLLKDIGGSVGAYSH
Smik_4.357         QKPLTFTRQVLSILEYPEILRV-GP-DK-LASLNLFRKDALGRAEHLLEDIGGSIGAYSH
YDR111C            QKPLTFTRQVLAILEYPEILRV-GH-NE-LASLNLFSRDALERAERLLNDIGGSIGAYSH
KNAG0M01210        QKPLTFSRQVVSILQYPPLLDY--E-EQ-LVTSGAYKRDAFKRAAVLLEQIGGSVGAYSL
KLTH0G13662g       QKPLTFYRQVLSLLQNPALIES--L-PT-GELHKLFKPDAVERAKKMLKQVGGSVGAYSA
Kwal_56.23791      QKPLTFYRQVLALLQNPDLISD--L-SS-GELHKFFKPDAVERAKKMLKQVGGSVGAYSN
KAFR0B05530        QKPLTFSRQVISILQYPELLNQ--R-NI-LVSTGIFKSDAMERAETLLCHIGGSVGAYSS
NDAI0J01360        QKPLTFARQVVSILQYPELLNRRNE-LT-STTPPIYNNDSFDRAEKLLNEIGGSVGAYSA
NCAS0B03840        QKPLTFARQVVSILQYPELLNN----RDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSA
CAGL0L12254g       QKPLSFYRQVLSLLQYPELIPT----LE-NNPQTMIKQDAIDRAKRLLDDIGGSVGAYSS
KAFR0B02730        QQPLSFYRQVLSLLQYPTLLHA-IE-TK-PGSSAVYKKDAILRAKKILKDIGGSVGAYSE
KNAG0G02040        QKPLSFYRQVLSLLQFPELLNSLKE-NP-AAATSLYKADAVRRAEKLLEDIGGSVGAYST
Suva_10.173        QKPLTYYRQVLSLLQYPELLNH-NE-QE-LVGSKLFKIDAIKRAKSLIKDIGGSVGAYSS
Skud_12.157        QKPLTYYRQVLSLLQYPELLNQ-NE-QQ-LVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS
Smik_12.148        QKPLTYYRQVLSLLQYPELLNQ-NE-QQ-LVDSKLFKLDAIKRAKSLMEEIGGSVGAYSS
YLR089C            QKPLTYYRQVLSLLQYPELLNQ-NE-QQ-LVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS
TDEL0F03900        QKPLSFYRQVLSILQYPEVLEQ-GE-EE-LISKGVFKRDAIERAKRILRDVGGSVGAYSS
KLLA0F19162g       QKPLTFYREVLSLLQHPELLEE----AD-EALQTLYKTDSIKRAKRLLSEVGGSVGAYSQ
SAKL0H17006g       QKPLTFYRQVLSLLQNPDMLEE----IPREQLSQIYKPDAIDRAARLLSNIGGSVGAYSH
ZYRO0C01628g       QKPLTFYRQVLSLLQYPGLLEE-NE-QV-LIDSKLYQKDAIARARRLLNDIGSSVGAYST
NDAI0B01990        QKPLSFYRQVLSILQYPDILKE-NE-QN-LIDAKVYKRDAIDRAKLLLSEIGGSVGAYSA
NCAS0B05020        QKPLSFYRQVLSLLQYPEILKQ-DE-SK-LVASGLFKKDALERAKTLLHEIGGTVGAYSA
TPHA0J00750        QKPLTFYRQVLSLLQYPMVLDE--T-FS-GNTKTLYKQDAIERAKRILNDIGSSVGSYSS
Kpol_392.5         QKPLTFYRQVLSILQYPELLES---------GSNIFKKDAIERARKLLKEIG-SVGSYSS
                   *:**:: *:*::::: * ::                  * . **  ::     ::*:** 

AGR085W            SQGVKGYRRTVAQFIERRD--GIPA------NPDNVYLTAGASSAVSCLLSTFCKGPETG
TBLA0F03060        SQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCG
TPHA0A01800        SQGVPGIQQTVADYITKRD-SGEVA------YPEDIFLTTGASSAVSFILPMFCNGPTTG
Kpol_543.39        SQGVLGFRQTVADFINKRDGCKQLA------SPNDIFLTGGASSAVHYLLSILCSGPEFG
Ecym_4307          SQGVLGFRKTVAEYLSSRD--GEPA------SAEDIFLTTGASNGASLMIELLCKGQESG
TBLA0E04440        SQGVHGIRQTVADFITNRD-DGEVA------YPDDIFLTAGASSAVSTILSILCKGQQTG
Suva_2.271         SQGVPGIRQTVADFITERD-GGEPA------GPEDIYLTTGASSAATSLLSLLCKDSQTG
Skud_4.372         SQGVPGIRQTVADFITARD-GGEPA------TPEDIYLTTGASSAATSLLSLLCKDTRTG
Smik_4.357         SQGVPGIRQSVAEFITKRD-DGEPA------APENIYLTTGASSAATSLLSLLCKDVQTG
YDR111C            SQGVPGIRQTVADFITRRD-GGEPA------TPEDIYLTTGASSAATSLLSLLCKDSQTG
KNAG0M01210        AQGVYGIRESVADFITRRD-EGETA------SPDDIFLTDGASKAATYLLSILCRDSSTG
KLTH0G13662g       SQGVAGFRQSVAEFIEERD--GEPA------SANDIFLTAGASSAVSAILSMFCTGSENG
Kwal_56.23791      SQGVAGFRESVAEFIEERD--GEPA------SAQDIFLTTGASGAVSYILSLFCNGPENG
KAFR0B05530        SQGVYGIRETVANYITARD-NGETA------SPDDIFLTEGASKAASYLLSLLCKDKNTG
NDAI0J01360        SQGVYGIRKTIANYITQRD-LGESA------SPNDIFMTTGATAASSYLLSILSNGPQTG
NCAS0B03840        SQGVYGIRKTAAEYITKRD-GGEPS------YPEDIFLTTGATSAASYLLSVLCRGPQTG
CAGL0L12254g       SQGVLGIRKTVADFITNRD-DGIIA------YPEDIFLTAGASSAVDYLLSIFCRGEETG
KAFR0B02730        SQGVYGIRRTVANFITERD-GGEPA------YPEDIFLTAGASAAVNYLLSILCKGEKTG
KNAG0G02040        SQGVMGIRKTVADFITRRD-NNEPA------YPEDIFLTAGASAAVSYLLSIFCKGEKTG
Suva_10.173        SQGVEGIRKSVADFITKRD-GGETA------YPEDIFLTAGASAAVTYLLSIFCRGPETG
Skud_12.157        SQGVEGIRKSVAEFITKRD-DGEIS------YPEDIFLTAGASAAVNYLLSIFCRGPETG
Smik_12.148        SQGVEGIRRSVAEFITKRD-EGEIS------YPEDIFLTAGASAAVNYLLSIFCRGPETG
YLR089C            SQGVEGIRKSVAEFITKRD-EGEIS------YPEDIFLTAGASAAVNYLLSIFCRGPETG
TDEL0F03900        SQGVYGIRKTVADFITERD-SGEPA------YPEDIFLTAGASAAVSYLLSILCRGQETG
KLLA0F19162g       SQGVQGIRETVADFITKRD-DGEIS------YPEDIYLTAGASAAVSYILSILCKGPNTG
SAKL0H17006g       SQGVYGFRKTVADFITKRD-GGEEA------YAEDIFLTAGASAAVSYILSILCRGPQTG
ZYRO0C01628g       SQGIQGIRETVAQFITERD-GGEKA------YAEDIFLTAGASSAVSYLLSILCKGQETG
NDAI0B01990        SQGVYGIRKTVANFITERD-GGEPA------YPEDIFLTVWCFRCCCYLLSILCQGPKTG
NCAS0B05020        SQGVYGIRKTVANFITKRD-NGEPA------YPEDIFLTAGASAAVMYLLSILCKGPETG
TPHA0J00750        SQGVFGLRKTVAEYISRRD-GGEKA------YAEDIFLTAGASSAVSYLLNILCKGKESG
Kpol_392.5         SQGIPAIRKTVANFITKRD-DGEIS------TPNDIFLTAGASSAVDYLLSILCKNEKSG
                   :**:   . . * ::  **     :       ..::::*  .      ::  :. .   *

AGR085W            VLIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVI-LDSKKRNIAPKCLVV
TBLA0F03060        VLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIV-IDAIKQNIKPTTLVV
TPHA0A01800        VLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTI-QESIKSGIKPTTIVI
Kpol_543.39        VLIPIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINI-KESMANGVKPVAIVI
Ecym_4307          VLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERII-IESIEKGVKPACLVV
TBLA0E04440        VLIPIPQYPLYTATLTLNDATALPYYLDESNGWSTDINEISKVA-QDSLEAGIKPTCLVV
Suva_2.271         LLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVV-LDALKKGIRPSVLVV
Skud_4.372         LLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVV-QDALEKGIRPSVLIV
Smik_4.357         LLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVV-KDALEKGIKPSVLIV
YDR111C            LLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVV-QDALKKQIRPSVLIV
KNAG0M01210        IMIPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQV-IDSIKRGVTPRVIVV
KLTH0G13662g       ALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVV-KDAIRKGVRPTCLVV
Kwal_56.23791      ALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVV-QDSIKKGIRPTCLVV
KAFR0B05530        VLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVV-LDAIADNVKPSVMVV
NDAI0J01360        VLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVI
NCAS0B03840        VLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLV-LDSIKKGIKPSVIVV
CAGL0L12254g       VLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESII-LDSIENNIKPSVLVV
KAFR0B02730        VLIPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVI-KKAVQDNIKPDVLVV
KNAG0G02040        VLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVV-LDAIDRNIKPSVLVV
Suva_10.173        VLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVV-KEAIQNEIKPTVLVV
Skud_12.157        VLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVV-KEAIQNEIKPTVLVV
Smik_12.148        VLIPIPQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVV-KEAIENEIKSTVLVV
YLR089C            VLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVV-KEAIQNEIKPTVLVV
TDEL0F03900        VLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVV-TESIESGIRPSVLVV
KLLA0F19162g       VLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVV-LDAIQKGIKPTCLVV
SAKL0H17006g       VLIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVV-TNSIAKGVEPKCLVV
ZYRO0C01628g       VLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVV-NNAIEQNIKPSVLVV
NDAI0B01990        VLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVV-QDAMERAINPSVLVV
NCAS0B05020        VLIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVV-LAAKDKKIRPSVLVV
TPHA0J00750        VLIPIPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVV-HNAIREKIIPRVLVV
Kpol_392.5         VLIPIPQYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVI-NDSLDKGIKPTALVI
                    ::**********  :   :  :.*:* *   ** .  ::.      :    : .  :::

AGR085W            INPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFG-DAKFHSMRKVLKNLQLR
TBLA0F03060        INPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYE-AFEFHSFKKVLSELRKN
TPHA0A01800        INPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFS-GNEFHSVKKVLRKLQRK
Kpol_543.39        INPGNPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFP-GFEFHSMRKVLLNLQSE
Ecym_4307          INPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFE-GLKFYSMKKVLRSLQRR
TBLA0E04440        INPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFP-GSEFHSMKKILRILQKE
Suva_2.271         INPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFG-DVKFHSMKKILRKLQNL
Skud_4.372         INPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFN-DFKFHSMKKVLRKLQHC
Smik_4.357         INPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFN-GVKFHSMKKVLRKLQRL
YDR111C            INPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFN-DVKFHSMKKVLRKLQHL
KNAG0M01210        INPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYK-GVKFHSMKKVLRSLQRD
KLTH0G13662g       INPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFD-DADFVSMKKVLRVLQKT
Kwal_56.23791      INPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFN-DAEFVSMKKVLRVLQKT
KAFR0B05530        INPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFD-G-EFHSMKKVLRSLQKQ
NDAI0J01360        INPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFN-GNKFHSCKKVLRSLQKQ
NCAS0B03840        INPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFD-GVQFHSTKKVLRGLQKQ
CAGL0L12254g       INPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFE-DVKFHSMKKVLRQLQMK
KAFR0B02730        INPGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFD-GMKFHSVKGVLRRLQRE
KNAG0G02040        INPGNPTGAVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQE
Suva_10.173        INPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP-GTEFNSMKKVLRHLQRD
Skud_12.157        INPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFP-GTKFHSMKKILRTLQRE
Smik_12.148        INPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP-GTKFHSMKKILRHLQRE
YLR089C            INPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP-GTKFHSMKKILRHLQRE
TDEL0F03900        INPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFA-GSEFHSMKKVLRQLQKE
KLLA0F19162g       INPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFK-GSKFYSMKKVLRNLQKT
SAKL0H17006g       INPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFN-GAEFHSMRKVLKDLQRK
ZYRO0C01628g       INPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFD-GAEFHSMKKILRKLQKS
NDAI0B01990        INPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIAD-GVKFYSMKKVLRKLQKS
NCAS0B05020        INPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFN-EVKFHSMKKVLRNLQKK
TPHA0J00750        INPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFP-GNEFHSMKKVLRDLQRR
Kpol_392.5         INPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFN-NAKFHSMKKVLRNLQKA
                   ********::*    :  :  :.* :.  :::*****:*      .* * . :*  *.  

AGR085W            EP-TLYKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQ
TBLA0F03060        YP-SKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQ
TPHA0A01800        YL-GFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQ
Kpol_543.39        FP-GTYDNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQ
Ecym_4307          YK-ELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQ
TBLA0E04440        VP-NKYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQ
Suva_2.271         HP-GKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQ
Skud_4.372         YP-GKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQ
Smik_4.357         YP-GKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQ
YDR111C            YP-GKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQ
KNAG0M01210        HPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQ
KLTH0G13662g       EP-GKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQ
Kwal_56.23791      EP-GKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQ
KAFR0B05530        YP-GKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQ
NDAI0J01360        FP-TQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQ
NCAS0B03840        YP-GKFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQ
CAGL0L12254g       QP-GLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQ
KAFR0B02730        IP-GKFDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQ
KNAG0G02040        HP-GKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQ
Suva_10.173        HP-GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ
Skud_12.157        HP-GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ
Smik_12.148        HP-GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ
YLR089C            HP-GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ
TDEL0F03900        HP-GIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQ
KLLA0F19162g       YH-GQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQ
SAKL0H17006g       HH-GKFDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQ
ZYRO0C01628g       NP-GVFDNVQLASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQ
NDAI0B01990        HP-GKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQ
NCAS0B05020        HP-GVYDMVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQ
TPHA0J00750        VP-GKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQ
Kpol_392.5         FP-GEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQ
                        :. :**.*:** ***. .***:***: *. *:  ::   . *: .: :*.   **

AGR085W            ALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLF
TBLA0F03060        ILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLF
TPHA0A01800        ALIDMVVSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLF
Kpol_543.39        ALMDLVTCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLF
Ecym_4307          ALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLF
TBLA0E04440        ALVDLMCCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMF
Suva_2.271         AIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLF
Skud_4.372         AIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLF
Smik_4.357         AVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLF
YDR111C            AVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLF
KNAG0M01210        ALVDLMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLF
KLTH0G13662g       ALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLF
Kwal_56.23791      ALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLF
KAFR0B05530        ALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLF
NDAI0J01360        AMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLF
NCAS0B03840        AMVDLMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLY
CAGL0L12254g       ALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLF
KAFR0B02730        ALVDLMVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLF
KNAG0G02040        ALVDLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLF
Suva_10.173        ALVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLF
Skud_12.157        ALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLF
Smik_12.148        ALVDLMVRPPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLF
YLR089C            ALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLF
TDEL0F03900        ALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLF
KLLA0F19162g       ALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLY
SAKL0H17006g       ALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLF
ZYRO0C01628g       ALVDLMVSPPKPGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLF
NDAI0B01990        ALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLF
NCAS0B05020        ALVDLMVSPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLF
TPHA0J00750        ALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLF
Kpol_392.5         ALVDLMVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLF
                    ::*::   *  *: *:     :   *      ..  *   *  : *: *  * *::*::

AGR085W            PKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGT
TBLA0F03060        PRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGI
TPHA0A01800        PKFIFPQKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGD
Kpol_543.39        PKLILPDKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGT
Ecym_4307          PRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGT
TBLA0E04440        PNIQLPFNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGV
Suva_2.271         PKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGT
Skud_4.372         PRLILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGT
Smik_4.357         PRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGT
YDR111C            PRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGT
KNAG0M01210        PKLLLSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGT
KLTH0G13662g       PKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGT
Kwal_56.23791      PKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGT
KAFR0B05530        PKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGN
NDAI0J01360        PRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGD
NCAS0B03840        PSLILSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGI
CAGL0L12254g       PKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGT
KAFR0B02730        PKLNLPYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGI
KNAG0G02040        PRLNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGT
Suva_10.173        PKIDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGV
Skud_12.157        PKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL
Smik_12.148        PKIDLPFRAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL
YLR089C            PKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL
TDEL0F03900        PQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGT
KLLA0F19162g       PKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGT
SAKL0H17006g       PRLDLSYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGT
ZYRO0C01628g       PRLLLPFKAIQSAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGT
NDAI0B01990        PKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGT
NCAS0B05020        PRLDLPFKAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGT
TPHA0J00750        PKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGT
Kpol_392.5         PKIDLPFKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGT
                   * : ..   .  :      .*  **  **. ********:** *  .* *:***** ** 

AGR085W            KWIESWKDFHKKFYDKYRD
TBLA0F03060        EWINSWEKFHLEFMEKYK-
TPHA0A01800        SWIDLWRKFHTEFCERYRS
Kpol_543.39        EWIERWREFHQQFYERFS-
Ecym_4307          EWIESWELFHKSFYDKYRD
TBLA0E04440        EWMKRWEKFHIEFFEKYR-
Suva_2.271         QWIQDWRQFHQDFFNKYRD
Skud_4.372         QWIQNWKNFHQSFFNEYRD
Smik_4.357         QWIQDWKHFHQDFFNKYRD
YDR111C            KWIQDWKEFHQDFFSKYRN
KNAG0M01210        QWIKDWETFHKAFYDKYRD
KLTH0G13662g       EWVDSWKKFHQKFVDEHRD
Kwal_56.23791      EWIDSWKKFHEKFTEDHRD
KAFR0B05530        QWTEKWKLFHEEFFSKYQ-
NDAI0J01360        QWINKWEKFHKAFLKRYT-
NCAS0B03840        EWINKWEKFHKHFYEKYQD
CAGL0L12254g       KWIEDWVDFHQEFYNKFKN
KAFR0B02730        EWIDSWKQFHIEFMEKYNS
KNAG0G02040        EWIDLWEKFHKEFYNKYRD
Suva_10.173        EWMKKWEIFHKEFFDQYRD
Skud_12.157        EWIKKWETFHKEFFDQYRD
Smik_12.148        EWIKKWETFHKEFFDHYRD
YLR089C            EWIKKWESFHKEFFDQYRD
TDEL0F03900        EWIKKWEDFHKKFYDQYRD
KLLA0F19162g       EWVETWEKFHKAFFDKYRD
SAKL0H17006g       DWIKAWEEFHKKFYNEYRD
ZYRO0C01628g       EWIERWENFHKAFYEEYRD
NDAI0B01990        EWIKKWEAFHKEFYDNYRD
NCAS0B05020        EWIEKWKIFHQDFYNTYRD
TPHA0J00750        SWIDQWREFHQIFCNKYRD
Kpol_392.5         EWIDRWNKFHAEFYDKYRD
                   .* . *  **  * . .  

FASTA FORMAT for MUSCLE Version 3.6

>AGR085W
-------------MAIGMLRRNSSGTAVSVLQGRVLRTR-RLSSVKDGS-----------
---------------------------------------------------RFV----PA
EPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEH--PGSLPFSKIIQANIGNPQQLG
QKPLTFYRQVISLMQNPQLLEM----PA-EWLQQAFKADVVVRARRMLQDAGGSVGAYSA
SQGVKGYRRTVAQFIERRD--GIPA------NPDNVYLTAGASSAVSCLLSTFCKGPETG
VLIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVI-LDSKKRNIAPKCLVV
INPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFG-DAKFHSMRKVLKNLQLR
EP-TLYKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQ
ALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLF
PKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGT
KWIESWKDFHKKFYDKYRD
>TBLA0F03060
----------------MTMNQK--------------------------------------
---------------------------------------------------TFL----PA
PKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLEN--SKSLPFAKIVYANIGNPQQLD
QQPLTFQRQVMSLVQFPDLLKS--K-DI-LLAQKIYSKDSIERATKLLNSIGGSVGAYSS
SQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCG
VLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIV-IDAIKQNIKPTTLVV
INPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYE-AFEFHSFKKVLSELRKN
YP-SKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQ
ILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLF
PRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGI
EWINSWEKFHLEFMEKYK-
>TPHA0A01800
------------------------------------------MESEHFT-----------
---------------------------------------------------DFT----PV
AKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKD--PKSLPFNKIINANIGNPQQLG
QKPLSFIRKVLSILQYPDILEDESKLQT-LIELRVYQKDVVRRARKLLGEIGGSVGAYSL
SQGVPGIQQTVADYITKRD-SGEVA------YPEDIFLTTGASSAVSFILPMFCNGPTTG
VLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTI-QESIKSGIKPTTIVI
INPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFS-GNEFHSVKKVLRKLQRK
YL-GFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQ
ALIDMVVSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLF
PKFIFPQKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGD
SWIDLWRKFHTEFCERYRS
>Kpol_543.39
------------------------------------------------M-----------
---------------------------------------------------SFV----PA
EKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIIND--PGSLPFDKIITANIGNPQQVG
QKPLTFIRQVLSILEYPNILNDPELLEK-LVQLGVYQRDVIERARKMLDSIGGSVGAYSA
SQGVLGFRQTVADFINKRDGCKQLA------SPNDIFLTGGASSAVHYLLSILCSGPEFG
VLIPIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINI-KESMANGVKPVAIVI
INPGNPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFP-GFEFHSMRKVLLNLQSE
FP-GTYDNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQ
ALMDLVTCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLF
PKLILPDKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGT
EWIERWREFHQQFYERFS-
>Ecym_4307
-----MMAILRSAATVENMLIKNSGLQATMDVLHGLPHA-TMGLRSISS-----------
----------------------------------------------GTSRIRFE----PG
DPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRD--PDSLPFKKIIYANIGNPQQLG
QKPLSFSREVLSLLESPNLLQM----PM-EVLNLIYKPDAVRRAKRMMRDLQTSIGAYSH
SQGVLGFRKTVAEYLSSRD--GEPA------SAEDIFLTTGASNGASLMIELLCKGQESG
VLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERII-IESIEKGVKPACLVV
INPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFE-GLKFYSMKKVLRSLQRR
YK-ELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQ
ALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLF
PRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGT
EWIESWELFHKSFYDKYRD
>TBLA0E04440
-----MIKTCNRHSSHSLRGMSQTTLFKSPSSSSLFRSTSSSSLYIPPP-----------
-------------------TALVRSISSSSILSNSSNASVTSPLSYSTSREKSY----FA
ERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKH--PGTLPFESVINSNIGNPQQLG
QKPLSFGRQVLSILEYPALLDH--E-RT-LVDSMGYAPDSIERAKTLLTDIG-SIGAYSN
SQGVHGIRQTVADFITNRD-DGEVA------YPDDIFLTAGASSAVSTILSILCKGQQTG
VLIPIPQYPLYTATLTLNDATALPYYLDESNGWSTDINEISKVA-QDSLEAGIKPTCLVV
INPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFP-GSEFHSMKKILRILQKE
VP-NKYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQ
ALVDLMCCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMF
PNIQLPFNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGV
EWMKRWEKFHIEFFEKYR-
>Suva_2.271
----------------MTMTDQK--------------DL-KSVFTTKDL-----------
---------------------------------------------------DFK----PA
AKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRS--SNSLPFNSIINANIGNPQQLD
QKPLTFTRQVLSILEYPEILRV-DH-DK-LASLNLFAKDALKRAQRLLDDIGGSVGAYSH
SQGVPGIRQTVADFITERD-GGEPA------GPEDIYLTTGASSAATSLLSLLCKDSQTG
LLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVV-LDALKKGIRPSVLVV
INPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFG-DVKFHSMKKILRKLQNL
HP-GKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQ
AIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLF
PKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGT
QWIQDWRQFHQDFFNKYRD
>Skud_4.372
----------------MTMTHQQ--------------DL-KSVFIAKDL-----------
---------------------------------------------------DFK----PA
AKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKN--PGLLPFDDIINANIGNPQQLD
QKPLTFTRQVLSILEYPEILQV-DH-EK-LASLNLFSKDALKRAECLLKDIGGSVGAYSH
SQGVPGIRQTVADFITARD-GGEPA------TPEDIYLTTGASSAATSLLSLLCKDTRTG
LLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVV-QDALEKGIRPSVLIV
INPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFN-DFKFHSMKKVLRKLQHC
YP-GKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQ
AIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLF
PRLILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGT
QWIQNWKNFHQSFFNEYRD
>Smik_4.357
----------------MAMTHQQ--------------DL-KSVFTTKDL-----------
---------------------------------------------------NFK----PA
AKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRK--PGVLPFDDIINANIGNPQQLD
QKPLTFTRQVLSILEYPEILRV-GP-DK-LASLNLFRKDALGRAEHLLEDIGGSIGAYSH
SQGVPGIRQSVAEFITKRD-DGEPA------APENIYLTTGASSAATSLLSLLCKDVQTG
LLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVV-KDALEKGIKPSVLIV
INPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFN-GVKFHSMKKVLRKLQRL
YP-GKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQ
AVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLF
PRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGT
QWIQDWKHFHQDFFNKYRD
>YDR111C
----------------MTMTHQQ--------------DL-KGVFTAKDL-----------
---------------------------------------------------DFK----PA
GKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKN--PEVLPFDDIINANIGNPQQLD
QKPLTFTRQVLAILEYPEILRV-GH-NE-LASLNLFSRDALERAERLLNDIGGSIGAYSH
SQGVPGIRQTVADFITRRD-GGEPA------TPEDIYLTTGASSAATSLLSLLCKDSQTG
LLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVV-QDALKKQIRPSVLIV
INPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFN-DVKFHSMKKVLRKLQHL
YP-GKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQ
AVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLF
PRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGT
KWIQDWKEFHQDFFSKYRN
>KNAG0M01210
----------------MILSNEQKQMHWTTSSSKKRQHT-GDDSTVSGL-----------
---------------------------------------------------AFE----PA
RKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQ--PDLLPFNAITVANIGNPQQLD
QKPLTFSRQVVSILQYPPLLDY--E-EQ-LVTSGAYKRDAFKRAAVLLEQIGGSVGAYSL
AQGVYGIRESVADFITRRD-EGETA------SPDDIFLTDGASKAATYLLSILCRDSSTG
IMIPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQV-IDSIKRGVTPRVIVV
INPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYK-GVKFHSMKKVLRSLQRD
HPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQ
ALVDLMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLF
PKLLLSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGT
QWIKDWETFHKAFYDKYRD
>KLTH0G13662g
----------------MMLSRQLTRTMPHSRLILRRLSA-KAAVKSDLS-----------
---------------------------------------------------QKA----LG
SKKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEE--PGSLPFNKIINANIGNPQQLD
QKPLTFYRQVLSLLQNPALIES--L-PT-GELHKLFKPDAVERAKKMLKQVGGSVGAYSA
SQGVAGFRQSVAEFIEERD--GEPA------SANDIFLTAGASSAVSAILSMFCTGSENG
ALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVV-KDAIRKGVRPTCLVV
INPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFD-DADFVSMKKVLRVLQKT
EP-GKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQ
ALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLF
PKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGT
EWVDSWKKFHQKFVDEHRD
>Kwal_56.23791
-----------------MLSRPIIRSMPHSRLVLRHLST-RPGLRKDYS-----------
---------------------------------------------------QKP----LG
SKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEE--PGSLPFDKIINANIGNPQQLD
QKPLTFYRQVLALLQNPDLISD--L-SS-GELHKFFKPDAVERAKKMLKQVGGSVGAYSN
SQGVAGFRESVAEFIEERD--GEPA------SAQDIFLTTGASGAVSYILSLFCNGPENG
ALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVV-QDSIKKGIRPTCLVV
INPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFN-DAEFVSMKKVLRVLQKT
EP-GKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQ
ALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLF
PKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGT
EWIDSWKKFHEKFTEDHRD
>KAFR0B05530
----------------MQLTEEFAATTQYFPVR-------KALDDDTIH-----------
---------------------------------------------------NFK----PA
KKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNPQQLD
QKPLTFSRQVISILQYPELLNQ--R-NI-LVSTGIFKSDAMERAETLLCHIGGSVGAYSS
SQGVYGIRETVANYITARD-NGETA------SPDDIFLTEGASKAASYLLSLLCKDKNTG
VLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVV-LDAIADNVKPSVMVV
INPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFD-G-EFHSMKKVLRSLQKQ
YP-GKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQ
ALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLF
PKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGN
QWTEKWKLFHEEFFSKYQ-
>NDAI0J01360
-------------------------------------MA-THTIQTDLH-----------
---------------------------------------------------DFE----PA
PKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKN--PHSLPFNEITVANIGNPQELH
QKPLTFARQVVSILQYPELLNRRNE-LT-STTPPIYNNDSFDRAEKLLNEIGGSVGAYSA
SQGVYGIRKTIANYITQRD-LGESA------SPNDIFMTTGATAASSYLLSILSNGPQTG
VLLPIPQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVI
INPGNPTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFN-GNKFHSCKKVLRSLQKQ
FP-TQYNNVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQ
AMMDLMILPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLF
PRLLLSTKVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGD
QWINKWEKFHKAFLKRYT-
>NCAS0B03840
----------------------------------------MSPLSLENN-----------
---------------------------------------------------DFQ----PA
PKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKN--PHCLPFDEITVANIGNPQELN
QKPLTFARQVVSILQYPELLNN----RDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSA
SQGVYGIRKTAAEYITKRD-GGEPS------YPEDIFLTTGATSAASYLLSVLCRGPQTG
VLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLV-LDSIKKGIKPSVIVV
INPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFD-GVQFHSTKKVLRGLQKQ
YP-GKFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQ
AMVDLMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLY
PSLILSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGI
EWINKWEKFHKHFYEKYQD
>CAGL0L12254g
-----MLRSTTSKSLSKMPHAIPPQCRR-SHSSSIFQTK-KRLAHLESD-----------
--RPYLTHLPRSMNSSPNLRFHSSASSSSLRSSFLNTE----IHHHSHNNLPFL----PA
EQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMEN--PHSLPFNDIINANIGNPQQLK
QKPLSFYRQVLSLLQYPELIPT----LE-NNPQTMIKQDAIDRAKRLLDDIGGSVGAYSS
SQGVLGIRKTVADFITNRD-DGIIA------YPEDIFLTAGASSAVDYLLSIFCRGEETG
VLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESII-LDSIENNIKPSVLVV
INPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFE-DVKFHSMKKVLRQLQMK
QP-GLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQ
ALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLF
PKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGT
KWIEDWVDFHQEFYNKFKN
>KAFR0B02730
---MTTLSISRRSSSLNAFFTKMSPSVTILPPNTYSYYS-TKSFSNPKP-----------
----------------------------------------------RKHNLNFK----PA
GQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEK--PNSLPFDKIINANIGNPQQLQ
QQPLSFYRQVLSLLQYPTLLHA-IE-TK-PGSSAVYKKDAILRAKKILKDIGGSVGAYSE
SQGVYGIRRTVANFITERD-GGEPA------YPEDIFLTAGASAAVNYLLSILCKGEKTG
VLIPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVI-KKAVQDNIKPDVLVV
INPGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFD-GMKFHSVKGVLRRLQRE
IP-GKFDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQ
ALVDLMVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLF
PKLNLPYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGI
EWIDSWKQFHIEFMEKYNS
>KNAG0G02040
-----MLAARPYSTKMSVVYRGGGSLNSTTKRFFLTTSQ-KMAPSVILR-----QQPNDL
IIQPYQHFDIGPKPSLIISRKFSASENIKMPHAVKRQRKPAKDQLHSKSHYKFT----PA
AQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQED--PRSLPFDKIINANIGNPQQLN
QKPLSFYRQVLSLLQFPELLNSLKE-NP-AAATSLYKADAVRRAEKLLEDIGGSVGAYST
SQGVMGIRKTVADFITRRD-NNEPA------YPEDIFLTAGASAAVSYLLSIFCKGEKTG
VLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVV-LDAIDRNIKPSVLVV
INPGNPTGAVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQE
HP-GKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQ
ALVDLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLF
PRLNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGT
EWIDLWEKFHKEFYNKYRD
>Suva_10.173
-----MLSLSAKNH--FTVNNSITHIVKSYHIKTLTTSA-KKMPHITTSFTTTASSTKLK
AFRQVRPVLQRHSSSWMAAQGQKRSISGQSSLKDLRHLNRFPHHTLKTANNEFY----PA
EQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKD--PQSLPFNKIINANIGNPQQLQ
QKPLTYYRQVLSLLQYPELLNH-NE-QE-LVGSKLFKIDAIKRAKSLIKDIGGSVGAYSS
SQGVEGIRKSVADFITKRD-GGETA------YPEDIFLTAGASAAVTYLLSIFCRGPETG
VLIPIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVV-KEAIQNEIKPTVLVV
INPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP-GTEFNSMKKVLRHLQRD
HP-GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ
ALVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLF
PKIDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGV
EWMKKWEIFHKEFFDQYRD
>Skud_12.157
-----MLSLSVKNR--CTASNCITDIIKSYHIRTLTTSV-KKMPYINPPFITTASNTKLK
AFRKVRPVLQRHSSSWVAGQSHSRSLSGQSSLNDLRHLNRFPHHTLKTGNDDFY----PA
EQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKD--PQSLPFDKIINANIGNPQQLQ
QKPLTYYRQVLSLLQYPELLNQ-NE-QQ-LVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS
SQGVEGIRKSVAEFITKRD-DGEIS------YPEDIFLTAGASAAVNYLLSIFCRGPETG
VLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVV-KEAIQNEIKPTVLVV
INPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFP-GTKFHSMKKILRTLQRE
HP-GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ
ALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLF
PKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL
EWIKKWETFHKEFFDQYRD
>Smik_12.148
-----MSYLSAKTH--FTVSNSISQAIKSYHIRTLTSRA-EKMPHISTPFTTSASNTNLK
AFRKIRPVLQRHSSSWIAAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFY----PA
EQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKD--PQSLPFNKIINANIGNPQQLQ
QKPLTYYRQVLSLLQYPELLNQ-NE-QQ-LVDSKLFKLDAIKRAKSLMEEIGGSVGAYSS
SQGVEGIRRSVAEFITKRD-EGEIS------YPEDIFLTAGASAAVNYLLSIFCRGPETG
VLIPIPQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVV-KEAIENEIKSTVLVV
INPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP-GTKFHSMKKILRHLQRE
HP-GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ
ALVDLMVRPPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLF
PKIDLPFRAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL
EWIKKWETFHKEFFDHYRD
>YLR089C
-----MLSLSAKNH--FTVSNSITHVIKSYHIRTLTSSA-EKMPHITTPFSTSASSTKLK
AFRKVRPVLQRHSSSWIVAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFY----PA
EQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKD--PQSLPFDRIINANIGNPQQLQ
QKPLTYYRQVLSLLQYPELLNQ-NE-QQ-LVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS
SQGVEGIRKSVAEFITKRD-EGEIS------YPEDIFLTAGASAAVNYLLSIFCRGPETG
VLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVV-KEAIQNEIKPTVLVV
INPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFP-GTKFHSMKKILRHLQRE
HP-GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQ
ALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLF
PKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGL
EWIKKWESFHKEFFDQYRD
>TDEL0F03900
-----MSSIAVTQR--CYMRSTSVGLIS---------RA-SAMPHTITT-----------
-------TLQGRSGLGRSYMNIKRARSTSSTAAGLHHI------YHKKCHQDFY----PA
ESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRD--PSSLPFDKIVNANIGNPQQLN
QKPLSFYRQVLSILQYPEVLEQ-GE-EE-LISKGVFKRDAIERAKRILRDVGGSVGAYSS
SQGVYGIRKTVADFITERD-SGEPA------YPEDIFLTAGASAAVSYLLSILCRGQETG
VLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVV-TESIESGIRPSVLVV
INPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFA-GSEFHSMKKVLRQLQKE
HP-GIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQ
ALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLF
PQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGT
EWIKKWEDFHKKFYDQYRD
>KLLA0F19162g
-----MLSVRV-----NLKTRISSGMIRV-NAPALKSTM-PSVTSLTQL-----------
---------------------------------------------------RFSTTVKPA
PKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKD--PSSLPFSKIISANIGNPQQLD
QKPLTFYREVLSLLQHPELLEE----AD-EALQTLYKTDSIKRAKRLLSEVGGSVGAYSQ
SQGVQGIRETVADFITKRD-DGEIS------YPEDIYLTAGASAAVSYILSILCKGPNTG
VLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVV-LDAIQKGIKPTCLVV
INPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFK-GSKFYSMKKVLRNLQKT
YH-GQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQ
ALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLY
PKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGT
EWVETWEKFHKAFFDKYRD
>SAKL0H17006g
-----MLTVAIRTPSLRMLRTTTAGNIAKNMPHSTLFLR-SFSSNFVPY-----------
---------------------------------------------------KFQ----PA
DKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARD--PKSLPFDRIINANIGNPQQLD
QKPLTFYRQVLSLLQNPDMLEE----IPREQLSQIYKPDAIDRAARLLSNIGGSVGAYSH
SQGVYGFRKTVADFITKRD-GGEEA------YAEDIFLTAGASAAVSYILSILCRGPQTG
VLIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVV-TNSIAKGVEPKCLVV
INPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFN-GAEFHSMRKVLKDLQRK
HH-GKFDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQ
ALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLF
PRLDLSYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGT
DWIKAWEEFHKKFYNEYRD
>ZYRO0C01628g
------MVLLARPRILLSSRRTLLQVAQRYKSAQTEAHLHHIHSKVSNV-----------
-------------------------------------------------LGAVY----PA
EKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKD--PHSLPFDNIVSANIGNPQHLK
QKPLTFYRQVLSLLQYPGLLEE-NE-QV-LIDSKLYQKDAIARARRLLNDIGSSVGAYST
SQGIQGIRETVAQFITERD-GGEKA------YAEDIFLTAGASSAVSYLLSILCKGQETG
VLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVV-NNAIEQNIKPSVLVV
INPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFD-GAEFHSMKKILRKLQKS
NP-GVFDNVQLASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQ
ALVDLMVSPPKPGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLF
PRLLLPFKAIQSAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGT
EWIERWENFHKAFYEEYRD
>NDAI0B01990
MSVASIITFRRSTS--TAVTTNFANLKQLNKMATCTYSI-KANVSNSNS--NNIKTINSN
QVKKSPLIIKATTTAIPEYQFFDAKRALMTRSISHHSL---KVAKGK----DFA----PA
EQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENN--PSTLPFSQIVNANIGNPQQLK
QKPLSFYRQVLSILQYPDILKE-NE-QN-LIDAKVYKRDAIDRAKLLLSEIGGSVGAYSA
SQGVYGIRKTVANFITERD-GGEPA------YPEDIFLTVWCFRCCCYLLSILCQGPKTG
VLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVV-QDAMERAINPSVLVV
INPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIAD-GVKFYSMKKVLRKLQKS
HP-GKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQ
ALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLF
PKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGT
EWIKKWEAFHKEFYDNYRD
>NCAS0B05020
-----MMHSTPLLSSSKFASRQLRILTRTYSVNLTNNKFNNKMPHFMEP-----------
-------------STSPQYPYFETKRTISSAATKLKTK---PKPTTKKNHNNFL----PA
DQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQED--PSSLPFDHIVNANIGNPQQLN
QKPLSFYRQVLSLLQYPEILKQ-DE-SK-LVASGLFKKDALERAKTLLHEIGGTVGAYSA
SQGVYGIRKTVANFITKRD-NGEPA------YPEDIFLTAGASAAVMYLLSILCKGPETG
VLIPIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVV-LAAKDKKIRPSVLVV
INPGNPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFN-EVKFHSMKKVLRNLQKK
HP-GVYDMVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQ
ALVDLMVSPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLF
PRLDLPFKAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGT
EWIEKWKIFHQDFYNTYRD
>TPHA0J00750
----------------MMLRSRSTNCTVNAAIALSGKRL-LSLTTISLK-----------
-------------------------------------------------HKNFK----PA
DKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDN--PSSLPFKKVINANIGNPQQLN
QKPLTFYRQVLSLLQYPMVLDE--T-FS-GNTKTLYKQDAIERAKRILNDIGSSVGSYSS
SQGVFGLRKTVAEYISRRD-GGEKA------YAEDIFLTAGASSAVSYLLNILCKGKESG
VLIPIPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVV-HNAIREKIIPRVLVV
INPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFP-GNEFHSMKKVLRDLQRR
VP-GKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQ
ALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLF
PKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGT
SWIDQWREFHQIFCNKYRD
>Kpol_392.5
-----------------MLRSGNCSISLVRRVGVRRLTL-STTLYEHKH-----------
---------------------------------------------------NVY----PA
QKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG---QKLPFDTVINANIGNPQQLK
QKPLTFYRQVLSILQYPELLES---------GSNIFKKDAIERARKLLKEIG-SVGSYSS
SQGIPAIRKTVANFITKRD-DGEIS------TPNDIFLTAGASSAVDYLLSILCKNEKSG
VLIPIPQYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVI-NDSLDKGIKPTALVI
INPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFN-NAKFHSMKKVLRNLQKA
FP-GEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQ
ALVDLMVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLF
PKIDLPFKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGT
EWIDRWNKFHAEFYDKYRD