MUSCLE (3.8) multiple sequence alignment

KLLA0D01001g      MSEYGNIPYPIKDLDSFTLSEETRPTYDKLNTQQGKV--NLQHNSAGQIK-SDKTLPKLS
SAKL0E01034g      ----MVTPYPVKELDEFSLSNGEVPDTVKISPIEPSIATRLQESPKNAFKISDKPQPENI
                         ***:*:**.*:**:   *   *:.. : .:  .** .. . :* ***. *:  

KLLA0D01001g      NLKDKFKIRNNKYLRSASSPEKEERDKQQNTIVIVTDDEEPEKQT--VQQDIYQEYIPSR
SAKL0E01034g      FPKFSYNIKN----KLNTLKKKCSSDPNDGSFIRVTTNVEPEHPSPAIGEDTSIIDVGSK
                    * .::*.*    .  :  :* . * ::.::: ** : ***: :  : :*     : *.

KLLA0D01001g      IHTTGRESSKHRKIKLTNRRSANP----QRQSESIGTIVTQSTPIPVSSNIDQPSILNTF
SAKL0E01034g      VITRPKKPKKQERARSFERLRPAPVLLVKKPRLSVPTTINAKPFSPYMSKKDNQPVTKDL
                  : *  .:..*: . .  :*  . *    :.   *: * :. ..  *  *: *: .: : :

KLLA0D01001g      SSSLKSVFDY----------------VDTVIDVRFPLLISYRRHVKIMLIVIFILQVNWY
SAKL0E01034g      TPQCSPGLDYLNSSYQIPIVGLIFQSVDTVIDTRLTYLAPYRKYLKVALILLAIIEINVF
                  :.. .. :**                ******.*:. * .**.::*: **:: *:::* :

KLLA0D01001g      IELLIILIARSVYQ-
SAKL0E01034g      ADHLIGYVEKLTGLG
                   : **  : . .   

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0D01001g
MSEYGNIPYPIKDLDSFTLSEETRPTYDKLNTQQGKV--NLQHNSAGQIK-SDKTLPKLS
NLKDKFKIRNNKYLRSASSPEKEERDKQQNTIVIVTDDEEPEKQT--VQQDIYQEYIPSR
IHTTGRESSKHRKIKLTNRRSANP----QRQSESIGTIVTQSTPIPVSSNIDQPSILNTF
SSSLKSVFDY----------------VDTVIDVRFPLLISYRRHVKIMLIVIFILQVNWY
IELLIILIARSVYQ-
>SAKL0E01034g
----MVTPYPVKELDEFSLSNGEVPDTVKISPIEPSIATRLQESPKNAFKISDKPQPENI
FPKFSYNIKN----KLNTLKKKCSSDPNDGSFIRVTTNVEPEHPSPAIGEDTSIIDVGSK
VITRPKKPKKQERARSFERLRPAPVLLVKKPRLSVPTTINAKPFSPYMSKKDNQPVTKDL
TPQCSPGLDYLNSSYQIPIVGLIFQSVDTVIDTRLTYLAPYRKYLKVALILLAIIEINVF
ADHLIGYVEKLTGLG