MUSCLE (3.8) multiple sequence alignment

TPHA0A01810        ------------------------------------------------------------
TBLA0F03070        ------------------------------------------------------------
TPHA0J00740        ------------------------------------------------------------
KNAG0H03240        ------------------------------------------------------------
TBLA0E04430        ------------------------------------------------------------
CAGL0B01771g       --------------------------------------------------MVKSAKKTGT
Kpol_543.38        -----------------------------------------------------------M
Kpol_392.6         -----------------------------------------------------MRINTRS
Suva_2.270         MKVSNFSLFRGKVGKRKNCKMIPHRINVSWLVDSSIQRRSSPQGHIGNEKMAKLRYKGTL
Skud_4.371         --------------------------------------------------MTNSRYNGAL
Smik_4.356         --------------------------------------------------MTKPRYNGVL
YDR110W            --------------------------------------------------MTKPRYNDVL
ZYRO0C01650g       ------------------------------------------------------------
NDAI0J01380        ----------------------MTETRTPSNSLRDRATLFVNEEGDDDNDEEQQQLHENS
NCAS0B03850        --------------------------------MEPSEHESSALRGRANLFFNDDESHEYT
KLLA0F19140g       --------------------------------------------MNISDTADKTTNKEKS
AGR086C            ------------------------------------------------------------
Ecym_4308          ------------------------------------------------------------
SAKL0H17028g       ------------------------------------------------------------
KLTH0G13684g       ------------------------------------------------------------
Kwal_56.23799      ------------------------------------------------------------
TDEL0F03890        ------------------------------------------------------------
KAFR0B05540        ------------------------------------------------------------
                                                                               

TPHA0A01810        ---------------MQDEKQASEPNPEKDRNEFKDPEHVLANI--------KYIIPRIG
TBLA0F03070        ----------MSKARQKDALFDDDALDDNEQLIDID----------------DFFCPPIG
TPHA0J00740        ---------------MKTLKRKHDMIDDSNNDRII-----------------KVDIPELD
KNAG0H03240        --------MTPRVIRGFTEEFERNPYDVDRIESSFSTETN------------PKLVPVIG
TBLA0E04430        -------MTNDSHQQNSNIQDLKSLTPDEKLEMLK-----------------IYNPKDLG
CAGL0B01771g       QDVDAIMKMNGTNLPSERPKFDIDGFRATKRRPAGTSNMSSTELELYN----KFVMPALD
Kpol_543.38        VESIIIDEDRSISVPSSNQVIDDTLAPISEFKEVNRYGKV------------VFDYPKVG
Kpol_392.6         VQKSKSLKEKNGAVGIVPNLTELKKSRSKSKDKSKIDDEEPAISLPRS-HLKELVLPEIK
Suva_2.270         FDDEGDSLPSESAKSKSSPQRRKTTSPRESRESLKDR---------------LLILPLMG
Skud_4.371         FDDGDDSLPSGSVTRKSSPQMRKTTSPRESREPLKDR---------------LLILPSMG
Smik_4.356         FDDDDSL-PSESATRKAPSQGRKATSSRESRDSSKDR---------------LLILPSMG
YDR110W            FDDDDSV---PSESVTRKSQRRKATSPGESRESSKDR---------------LLILPSMG
ZYRO0C01650g       ---MSKRKPLTQQKLASEEEHEIEGEPKRKKVNKKSRNG-------------EFIVPPMN
NDAI0J01380        IQKNGIEGSNSEEEGAATSNKGSMTRPRSEVNGDDDDGNEDERDPKRR-HYGSYLIPNVG
NCAS0B03850        KENHEKLKDDGEEGDESAADNQHIHKEVEEEDGLYDYDYSKRDKPIKRLKLKGYLIPNIG
KLLA0F19140g       GTTDEMTSEKDKLLGIRSPEGEVALYPASASTESTEPDF-------------KFVLPVKG
AGR086C            ----------MVDIMSSPSKGVNDSQPMFVYQYITDE---------------GFKVPQTD
Ecym_4308          --------MSKSDEMLLNPYDAQVGSDGSESFFVFQKITEE-----------GFKVPRFD
SAKL0H17028g       ---------------MAREIELPTNVPKSKDVCSKPTNN-------------DYVTPKLG
KLTH0G13684g       -----------------MTKLEKSRVDKRRRDKV------------------EFDMPAVG
Kwal_56.23799      -----------------MDKQVGSKVDGRRKDGV------------------KFRMPKVG
TDEL0F03890        -----MASKKPTTLQRRNVLFDEAHSDTQEDKILDEYNGVKS----------QFLAPSMG
KAFR0B05540        ---MTSTKMNENTRALGPEEKVAPVHNMIERDFASELIEAPENIVIKE----SYIVPRMG
                                                                               

TPHA0A01810        QKYDSLI---TPLLDKQLLQKGE---IAVANSKTNYLSKELYDLVKNDDLTRKNVA-VAL
TBLA0F03070        DDDEIYY---DSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDD-APIPA
TPHA0J00740        ILYKIEL---GSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEEAMK
KNAG0H03240        DKWSNYA---DEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIARLYP
TBLA0E04430        ISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDT
CAGL0B01771g       ETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTMETVMKAMN
Kpol_543.38        ATLYEYI---DSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSEKT-
Kpol_392.6         NLDELIS---ESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSREKV
Suva_2.270         ESYTEYV---DSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQISD
Skud_4.371         ESYTAYV---DSYLNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLTADTLQQISD
Smik_4.356         ESYTEYV---DSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISD
YDR110W            ESYTEYV---DSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISD
ZYRO0C01650g       QKFVSCL---QLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLERCH-
NDAI0J01380        ESYMDYV---DPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLAANFP
NCAS0B03850        EKYKDYV---DEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLSATAL
KLLA0F19140g       FDLGSF----CGELDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENLLRASD
AGR086C            LNLYQL----DGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCD
Ecym_4308          LNVYQL----APELDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCD
SAKL0H17028g       ESQVTY----STDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLLAVTD
KLTH0G13684g       EPIEKY----HNGLNLELLERGRLDFIKYQESVKGQLTQDQFDLVRSCSLTEDNLMTTSD
Kwal_56.23799      ETLEKY----GNGLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMSTSD
TDEL0F03890        ESYKEYA---NSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLASNSD
KAFR0B05540        ESYTSYT---DSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLASTNP
                                 .      *              :       .    .          

TPHA0A01810        NLDE------KN-AITRLIPLKHRYYR-DSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLL
TBLA0F03070        SLKI---------KTSKKMYLQIRYSK-NSDGDLIE-TKTNKLLCEPKYIYKLTMKAHFM
TPHA0J00740        SHYTDSGKYMGT-ANKKFMLMEDRYQL-NELGQITDKRNDYKLIVPPNQIYDLIMHCHFL
KNAG0H03240        TDRS------GD-ESRKMMYITRRYYK-DANGMIRDATMNNRIVYDPIHTFDIIMSCHLM
TBLA0E04430        KLTN------HSKALEKYNFTSRRYYL-NEDNNIIDKRKPGRIICEPKYMYDIVIAYHLK
CAGL0B01771g       IWPP------NA-AETKYSNLIKRFYK-DKEGNIRDAKVDNNIVLEPDKLFNLILTAHLK
Kpol_543.38        RWSR------IN-ANAKCLYLKRRYKL-TKKGTVIDLTRENKIVYEPDLRYDYIISTHIL
Kpol_392.6         KWAN------KS-NE-KYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLI
Suva_2.270         KYDG------VA-AENKLLFLERQYYV-DNEGNVRDRRNNDKIYCEPKHIYDMVMATHLM
Skud_4.371         KYDG------VV-AENKLLFLQRQYYV-DNEGNVRDGRNNDKIYCEPKHIYDMVMATHLM
Smik_4.356         KYDG------VV-AENKLLFLQRQYYV-DDEGNVRDGRNNDKIYCEPNHIYDMVMATHLI
YDR110W            KYDG------VV-AENKLLFLQRQYYV-DDEGNVRDGRNNDKIYCEPKHVYDMVMATHLM
ZYRO0C01650g       KWKG------ES-SEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQ
NDAI0J01380        HFH----------APTRCALFKRRYVA-DNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLM
NCAS0B03850        KMDK------FR-AASRLVFLNRRYGL-DEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLI
KLLA0F19140g       KVTN------ST-VENKFVLLKRRYYV-Q-ENLLHDVKRKDLVVYEPNELFDLIMSVHVL
AGR086C            KVTP------NT-VENKYVLLKRRYVA-K-GGIVIDRKRKDAPVIEPDSLFDMIMSAHLI
Ecym_4308          KVTA------GT-VENKFVLLKRRYSI-L-QGNVVDHKREDLPVIEPDLVFDVIMAAHLI
SAKL0H17028g       GLIP------SN-AEAKYLFLKRRYYV-DSDQIVRDHKRDDTIVCEPELMYELIVSGHLL
KLTH0G13684g       KLHA------GN-VETKFLLLKRRYYV-DADGIVRDYKCSDTVVCEPELMFDLIMCGHLK
Kwal_56.23799      KLHS------GN-IETKFLLLKRRFYV-DADGTVRDFKCDDTVVCEPESLFDLIMCGHLK
TDEL0F03890        KWDK------DS-AESKYMFLMRRYYA-E-NGIVRDRRKGDKIVCEPLCIFDLIMCAHLM
KAFR0B05540        KWTK------IT-AEPRYLFLKRRYYR-DNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLM
                                          .:        : :          *       :  *. 

TPHA0A01810        NDHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNI--------RRK-KEPQLS
TBLA0F03070        NNHMRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIR--------DIRSNYGQRN
TPHA0J00740        NDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYK--------HIE-YTRHFS
KNAG0H03240        NKHLGSERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLT--------P-K-VQPKPY
TBLA0E04430        --LHSSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFK-NIRNNI
CAGL0B01771g       NGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIK--------PIE-KVRHRN
Kpol_543.38        NRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIP--------NLE-KTVHMN
Kpol_392.6         NEHAAHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVK--------PLK-KSKKNE
Suva_2.270         NKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIK--------PLK-EYKRPD
Skud_4.371         NKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIK--------PLK-EYKRPD
Smik_4.356         NKHLRGKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIK--------PLK-EYKRPD
YDR110W            NKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIK--------PLK-EYKRPD
ZYRO0C01650g       NNHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAK--------PFQ-KKRHKN
NDAI0J01380        NDHAQYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVG--------PLL-KFKHVN
NCAS0B03850        NDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETI--------PFK-KYKHIN
KLLA0F19140g       NSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKI--------SYK-KFKHEN
AGR086C            NDHMPWRKVYQHMKGLYANVTRELTNMVTGYCSHCNMDRSVR--------RFS-RYKHYN
Ecym_4308          NGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCNTDRNMK--------RFL-RYKHYN
SAKL0H17028g       NNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVK--------PFT-KFKHTN
KLTH0G13684g       NGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELR--------PYK-KFRHTN
Kwal_56.23799      NGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLR--------PYR-KFRHTN
TDEL0F03890        NDHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFR--------PLE-KYRHKN
KAFR0B05540        NNHGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIG--------KLE-KFKHRN
                               :   :.*            *. *                      .  

TPHA0A01810        NSPDILFYERLILDVVAPF----G-----AK-----KIQKRYTHILTITDFHTKFMWSFP
TBLA0F03070        QYIDYLPLERLQIDITKPF----------ND--SDIKIANKYSHILLIRDYHSRYSWIFP
TPHA0J00740        C-DKNFAFEKIHVEIFQPF----ED----VD-----TFANKFSHVIYIRDYFTRYVWLYP
KNAG0H03240        LFEKALPLERITIEIIEPF----P-----NE-----KVEGKYSNMVVMKDFIGRFEWLEP
TBLA0E04430        IDRPLFPMERIHIEIFNPF----------DD----LKIENKYQRILYIRDYSTRYIWTFT
CAGL0B01771g       INEELLPLERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFP
Kpol_543.38        IYEKYLPLERVQLDIFEPF----E-----NE-----KIQNRYSHIIYIRDYRSRFVWIYP
Kpol_392.6         VYEGLLPFERIHIEIFKPF----GD----EK-----LIEGTYSHILYIRDYYSRYVWLYP
Suva_2.270         MYDKLLPMERIHIEVFEPY----G-----GK-----AIEGKYPYVLLCRDYRSSFMWLLP
Skud_4.371         MYDKLLPMERIHIEVFEPF----T-----GG-----AIEGKYPYVLLCRDYRSSFMWLLP
Smik_4.356         MYDKLLPMERIHIEVFEPF----S-----GE-----TIEGKYSYVLLCRDYRSSFMWLLP
YDR110W            MYDKLLPMERIHIEVFEPF----N-----GE-----AIEGKYSYVLLCRDYRSSFMWLLP
ZYRO0C01650g       VYWELLPLERVHIEVFEPF----D-----GE-----KIQGRFSHLLYFRDYFSRYVWILP
NDAI0J01380        YYKGMLPLERVHIEIFEPF----N-----GK-----KIEGKYSHVIYCRDYRSRYIMLEP
NCAS0B03850        WFKGLLPLERVQVEVFEPF----P-----GE-----KLGGKYPQILYFRDYRSRFIWMVP
KLLA0F19140g       IHANLIPLGRCHVEIFAPF----DSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEP
AGR086C            VHEKLMPLERCHVEVFAPF----DD--EGVE-----KIQGKYSHFLYCRDYHSRFIWLLP
Ecym_4308          VYDKVMPLERCHVEIFAPF----DD--DGNE-----KIEDKYSHVLYCRDYHSRFVWMLP
SAKL0H17028g       AYQGLLPLERIHVEIFKPF----GT----DE-----LIEEKYSHVLYCRDYHSRFVWLSP
KLTH0G13684g       IYSGLLPLERVHVEIISPF----------SE-----AIEGTYSHVLFFRDYYSRFVWMQP
Kwal_56.23799      IYSGLLPLERVHVEIIAPF----------PK-----LIEGLYSHVLYLRDYYSRFVWMQP
TDEL0F03890        IFKGLLPLERVHIEIFEVF----D-----NE-----SISNKFTNVLYCRDYHTRFVWLAP
KAFR0B05540        IYNELMPLERVHIEIFEPF----P-----NE-----KIEKKYSHILYCRDYHSRYIWMLP
                        :   .  :::   :                  .   :  ..   *:   :    .

TPHA0A01810        LKNLKLRTIISKVTEFIVALPV-KPVFISSFTLSLNDIFELCCYLAREY--NISIGLGTR
TBLA0F03070        LKSPNIKNISTELGKFLVTLPR-TPIFLHSIGIPESQLIKILTKILLEYKIKIRIGIGGI
TPHA0J00740        LEKISVKELANTLATHLLLSLR-IPIYIESLTLDESNLLKILKRISKTT--NLILGVGTT
KNAG0H03240        LKNTKFKNIVPVVAKMILSFPR-VPIWVESNTLDWSDLFDIFEMIVTKY--GIKIGLGCT
TBLA0E04430        LKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREY--HISLGLGTN
CAGL0B01771g       LKNMKFKTLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKY--GLKLGLGFA
Kpol_543.38        LKNTKFKTLASEIGMLLLDLPR-IPIYIDTTTIERRDMLAICKRIAEKY--EISLGIGTI
Kpol_392.6         LKKTAFKELTQTLVTYFFTITK-TPIYIESSTINRNDLIAMVQKIALKY--DLRIGIGIG
Suva_2.270         LKSTKFKHLIPVVSSLFLSFAR-IPIFVTSSTLDKDDLYDICEEIASKY--GLRIGLGLK
Skud_4.371         LKSTKFKHLIPVISSLFLSFAR-VPIFVTSSTLDKDDLYDICEEIASKY--GLCIGLGLK
Smik_4.356         LKSTKFKHLIPVISSLFLSFAR-VPIFVTSSTLDKDDLYDICEEIASKY--GLRIGLGLK
YDR110W            LKSTKFKHLIPVVSSLFLTFAR-VPIFVTSSTLDKDDLYDICEEIASKY--GLRIGLGLK
ZYRO0C01650g       LQNDKRKHMIRAMSSFLLGLPR-IPIFLESTTIDREHLFDLCGQIAEHY--SLKLGLGVK
NDAI0J01380        LKNTKFKNLVSAIAKLLFNLPR-IPIFIETVSLNTQDAFDIFEAIVEKY--QINVGLGMK
NCAS0B03850        LRNSKFGHLVDLISKMIFSMIR-IPIFFETTTIENQDFFDIFEKIVEKY--QINIGLGTK
KLLA0F19140g       LKSVTLSDLLPVMTKLLFSMIR-MPIFIDTCTLDRQDMFDVCENIARIY--KIKIGLGMN
AGR086C            LEGIAFRYLLPALAQLLCTMIR-VPIFLETATLDRQDMFDICEVIARRY--KFKIGLGLN
Ecym_4308          LEGITFRDLVPALTQLLCSMIR-LPIFLETATLDRQDMFDVCEYIARKY--KLKIGLGLN
SAKL0H17028g       LTGITFQELVPQLTEFLLSLPR-LPIFLETTTLDRQDMFDMCEYIARKY--QLAIGLGLN
KLTH0G13684g       LKGDDVRDITKGLLATLLLLPR-IPIFIETSTIDRQDLFEACEDVAGQY--SLYIGLGMS
Kwal_56.23799      LASERVSEITKAFLTFLLSLPR-VPIFVETSTLKRQDLFEVCENIASQY--GLSIGLGMS
TDEL0F03890        LKNTKFKHLVSAVGTLLLGMTY-VPIFMESSTLDKQDLFDICEQLCGKY--NMKLGLGAN
KAFR0B05540        LKNTKFKHLVPTMASLFLSFIR-QPIFIETASLDWQDMFDICEKIAFEY--DLQIGLGTS
                   *       :   .   :       *::. :  :           :       : :*:*  

TPHA0A01810        NMQKAYSKN--PYVTRILN--SHKTECLKSWFMCLKWLADRQSNSKFDIRPPNKNYGLFS
TBLA0F03070        K-GRMFLRKGISRLVYLLNLKENKEKCKSDWYQCIRNTTFKE-NRRFDRNTGSFANFLIG
TPHA0J00740        K-LDEFQASGINHMKELFV--QNREYCGNNWNKYVIRCQNHY-NTTYNKWIYGIPLNLMA
KNAG0H03240        T--RSSAAQATARINRDLN--DHHDECLFDFNNCLKYGPTKY-NQIKYLGFHKSPCDIIS
TBLA0E04430        NKHDHFHLSGIEMFKQLVN--LNKSKCLKSWSNFLVFGSVLH-NNKFNSRILSKPIDIIN
CAGL0B01771g       N-FTKFHAQGIKRFKTHLH--RAKSECADDWLMCLKQGTYSA-N-RVIERQLGKASNILF
Kpol_543.38        E-PSSFYSIGLSRLKCLLN--ENKDKCLKDWNMCLKLGSYYY-NKKSITTARGVPSELFL
Kpol_392.6         N-SSYFHYNGLETMKQLLL--LHEDECLGDWGMCLKYGKNLH-NNLKNRKVLGMPINLLL
Suva_2.270         S-SARFHTGGILCIQYALN--SYKEECLADWGKCLRYGPYRF-NRRRNKRTKRKPTQVLL
Skud_4.371         S-SARFHTGGILCIQYALN--SYKEECLADWGKCLRYGPYRF-NRRRNKRTKRKPAQVLL
Smik_4.356         S-SARFHTGGILCIHYALN--SYKEECLADWGKCLRYGPYRF-NRRRNKRTKRKPAQVLL
YDR110W            S-SARFHTGGILCIQYALN--SYKKECLADWGKCLRYGPYRF-NRRRNKRTKRKPVQVLL
ZYRO0C01650g       N-SQRFHNNGIKDMKELLG--SHKEECLQDWNLCLKYGPFHI-NQNINVSSDGRPGDLLF
NDAI0J01380        T-AKRFHTRGVKQMKILLE--GHRKECLNDWTMCLKYGPHNY-NTKHNDRACGVPVDLLT
NCAS0B03850        L-GGKRLTNGLPQIRKLLG--PHKEECLADWIMCLKYGPHTF-NNKMNDRACGVPGDLLT
KLLA0F19140g       S-STSFQKTGIKRMKSLFL--QHKEECLHDWNMCLKLVVSRL-NQNYSDRVRGVPSDLLC
AGR086C            S-GTEFQKNGIKRVKQLLS--EYKEECQDDWNMCLRLVLSRV-NQTYADRVRGIPSDLLC
Ecym_4308          S-GTDFQRNGVTRIKNLFA--EHKEQCIKEWNMCLRLVLTRV-NQNYSDRVRGIPSDLLC
SAKL0H17028g       N-SSHFYKNGIERMKYLLQ--TNKKKCAKDWGMCLKYGSYHN-NTAYNPRIMGFSNDLLC
KLTH0G13684g       Q-SSTFQKNGVERLRYLLQ--RNEEQCLRSWYMCLKYGATNH-NLNYNARILGVPGNLLH
Kwal_56.23799      R-STTFQRNGVERLRYLLQ--QNEEPCLKSWHMCLKFGVTNH-NMTYNARVLGLPGNLLH
TDEL0F03890        S-SSQFHINGIKRMKKLLN--TRKVDCISDWNMCLRYGPYHL-NRRHNTLAGGIPNDLLY
KAFR0B05540        K-PNTFHAAGIRQMKAKLE--AHREECLLSWNLCLKYGSYDH-NIRHNDRAGGVPGDLLS
                                .   .        *  .:   :        *             :: 

TPHA0A01810        G--MTDFLKKYEERSKMIIGRLPSENFINIDEGS---HFIYSED----------------
TBLA0F03070        KQ-KAELNKVFENKRDALLSDLLEENVLKIGECG---SIIYFDN-------NNS------
TPHA0J00740        QE-TLADNKTYKKKRQRTILLTLSKNTILLKNGK---SALYKES----------------
KNAG0H03240        HS-ETQLKAKFRAKRAFILKHSPSSCVMNRGM-----GTLYLES---------PNGIQED
TBLA0E04430        CNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVA---SIIFIED---------EATSIAE
CAGL0B01771g       TELMGQFERDMRKKKLKYIEQSFSENIKTYPKSG---GCIFIE-----------------
Kpol_543.38        DE-MECSATTFESKRTEIINSLPIQNSYKTSTNK---GLVYAQD----------------
Kpol_392.6         NSGISECSIKYKSKKNTVIDETFPHNMIVLDNGK---SEIYLED----------------
Suva_2.270         SE-VPGHNAKFETKRERVIENTYARNMFTMAGGK---GLIYLEDVNTFALVNEGESS-NN
Skud_4.371         SE-VPGHNAKFETKRERVIENTYSRNMFKMAGGK---GLIYLEDVNTFALANEAENNGNN
Smik_4.356         SE-IPGHNAKFETKRERVIENTYSRNMFKTAGGK---GLIYLEDVNTFALANKADNSYNN
YDR110W            SE-VPGHNAKFETKRERVIENTYSRNMFKMAGGK---GLIYLEDVNTFALANEADNSCNN
ZYRO0C01650g       TS-VPDCNRKFVKKRNDVILDTPSQQVVHLGE-----GVLFLEN-NKEEHKTVEAVKENI
NDAI0J01380        CN-VKDVTHKSIEKYEQIIRTLPKDNIVQIGN-----GSIYLEEKVKDPNIDNYDAMLGE
NCAS0B03850        GD-IPDLYTKSYDKIEQILQDLPTENIVKIGR-----GCIYLED-------RNPEDPEAE
KLLA0F19140g       ST-QQDLHKKFRTLQRNVISRLLGHHVVQFEEAG---GMIYLED----------------
AGR086C            NE-IPNISMKFKQKQKKIIDQLYAHHVVHFKEAG---GMIYLED-------EESAFVMDD
Ecym_4308          NE-ISNIAHKFKLKQRKIIDELYAHHVVQFREAG---GMIYLED-------DNSAFVVDE
SAKL0H17028g       NE-VSSCGKKFKLKREKIIHELFAHNVVTLKDTG---GMVYVEN-------ENSVFIMED
KLTH0G13684g       ST-VCDYGRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLED-------ETSAFKM--
Kwal_56.23799      ST-VSDYGRQFELKREELIEKLFASNVVELRNEGRRRGMIYLED-------ESSAFKM--
TDEL0F03890        HS-DHTNRKHFRPKQEMIIDELPAQNVVHVNK-----GLLYLED----------------
KAFR0B05540        SQ-IQECSLKFKEKIIQILENAVSESVLRVDN-----GLIFLEV--------------DE
                                     :                    :: :                 

TPHA0A01810        -------------------------EFSFDNLV-----EKETPKKLSE-----------S
TBLA0F03070        -----------------------GKELDEKDVN-----GGVNENSEEE-----------S
TPHA0J00740        ------------------------------------------------------------
KNAG0H03240        AAASSADELSSAKDAE-------DEERDNSTR------EGSGNGEESD-----------T
TBLA0E04430        GLTLEGNDKYEQFSDEYRS----DIDVIEDDSY-----DIPLSDTEKK-----------F
CAGL0B01771g       ----HVQDY--------------EKTMESIDRT-----GTYKSGRKAD-----------Q
Kpol_543.38        --------------------------------------EILTTSKNKS-----------S
Kpol_392.6         -------------------------NLTSTPVI---------------------------
Suva_2.270         NENLNNTNIGNDNFEEEVQK---QFDLTEQNYI-DEYDDLAHDSSEGE-----------Y
Skud_4.371         NRNHPDNNFGNDDFEEEVQK---QFDLTEQNYI-DEYDDLAHDSSEGE-----------F
Smik_4.356         GSS-HNNDVDNDNFEEEVQK---QFDLTEQNYI-DEYDDLAHESSEGE-----------F
YDR110W            NGILHNNNIGNDNFEEEVQK---QFDLTEKNYI-DEYDDLAHDSSEGE-----------F
ZYRO0C01650g       THSDPDEERAENDNTNDT-----QVRIDEGDVSPSKTEPVEQRDEDGEDRRGESDEADIR
NDAI0J01380        EYDSEQEDNNNKNTDQDLAYEHPDYEYDEEQLK-RRPVYGISSSTDKE-----------K
NCAS0B03850        YEANTDDESDTEDNVEHRQ----EDEEDIGAMMS----PMIDNTRTED-----------E
KLLA0F19140g       -ENSPNLLLSGDDNS--------EESEHDSEIF-----DELASSRDGT-----------P
AGR086C            ----PDDDCTPVPEEPPVA----SDSIQNSATI----LTPITSTQITE-----------N
Ecym_4308          DEHGPENDNVPVTESPS------KESMKSSNNI---ADNLLEPNNNSS-----------I
SAKL0H17028g       EDLISVNQDSQESGTPMATSGGQGVEQEMDEMPSMGLTPLKGSNGDML-----------H
KLTH0G13684g       ----PDEEYISAENETDMN----DDDLGFGSAT-RLTTPLTSPGRTPS-----------R
Kwal_56.23799      ----PDEEYISAENETE------NEGFDYGPMV--GLTPLTSPSRHDI-----------T
TDEL0F03890        ----ENSDVFEEEEEQD------DNESDDSEMS-----PGLPPGRIIN-----------S
KAFR0B05540        PHDEPHDEPYDEFQFEG------DQSIDEEDMG-----AVMPPATEAD------------
                                                                               

TPHA0A01810        VVNS---SEDSDDNYEDNQEDNYLAEGPN-------------------------------
TBLA0F03070        ------------------------------------------------------------
TPHA0J00740        ------------------------------------------------------------
KNAG0H03240        EPAV---DHSRRSKKKKIAGVKEEPQRSFSPMKDSQRTLFEEDSEQ--------------
TBLA0E04430        SSRK--------------------------------------------------------
CAGL0B01771g       LPAE---DTPTSHEPVANTTAINNRSTKANKLNGPNLRK---------------------
Kpol_543.38        NMEN--------------------------------------------------------
Kpol_392.6         ------------------------------------------------------------
Suva_2.270         EPST---LTPEENTSHNVEEERIESTSETTDLDGNTKEERDESEER----NLNSVEAVNA
Skud_4.371         EPNT---LTPEEKASHIVEEKRIGSTSETTDLDGNTKQEVDEPEEV-------NHNIEET
Smik_4.356         GPST---LTPEEKNTRIDEEERIGSASGVAQLNENTRQEIGELEKK---------HQKDA
YDR110W            EPNT---LTPEEKPPHNVDEDRIESTGVAAPMQGTEEPEKGDQKES--------------
ZYRO0C01650g       RPEDEPIDDAIEQKKEGNARNHLKNSAEVMVANIPNDNHVNTVQMQPAIVRDDYIYDSDE
NDAI0J01380        ESESIMNDNHVEENIEEEEEDQIQIDSNPEDNADSNNNDDAEEEKDEKETEQKYLDKRDK
NCAS0B03850        LENG---EKSHEDDNHSNDNEEGVTKVEGSVPTTPKRRKLNNKNVT--------------
KLLA0F19140g       ISEQ---PSPHRTNMNYDGINQESEKHRITKK----------------------------
AGR086C            EVAR---QDPDQLEIRPPSQNNESLSDRVSSEEPPVSKERKKRKIS------KRALKTAS
Ecym_4308          PSKR---VLPSEKSSIRKNGSKKKINKEKVTDKGKMELSSPLSQAG--------------
SAKL0H17028g       KTAD---STPKVKRTSSLSRASSKRTGERASLSDTITPTKKVKKVGENRSRLSGSESVEQ
KLTH0G13684g       TPNR----TPGRTPGRTPNEVRKVQGGELENLGAENQKVDDVDSTG--------------
Kwal_56.23799      RDTS---ISPSFSPSSPAFEGRPSQTPDTLNM----------------------------
TDEL0F03890        ATQT---PERSVEAMH--------------------------------------------
KAFR0B05540        -AQD---SMSLTEAYMTDGLPKPRVSKRLIDRQ---------------------------
                                                                               

TPHA0A01810        -----------RDDTILDYNDTFTEA-----------------E--------SGVLL
TBLA0F03070        -----------DYENDDDDDESFYTG-------VKKRKKARVN--------------
TPHA0J00740        -----------TENSIDLHIENRYEE-------------------------------
KNAG0H03240        ----------NDSMELPTPSTSHQNLARSLQRRKFEISKSDTAD---------TSEL
TBLA0E04430        -----------RKSRSNDSDTSNSKT-----------KLKKKRK-------------
CAGL0B01771g       -----------RTKEITEIPMSDSDD-DEPKSKRKTRSRTRTRR-------------
Kpol_543.38        -----------GDDTFLEYDDTFIEG-------------STNFE-------------
Kpol_392.6         -----------DEKNIEPVGYEYYEN-----------PINTLTN-------------
Suva_2.270         VTAPQTEANGDRSVEITSPETSYYQTEELPSTKRQKVGKQGHGD--ITRDFGLSMEL
Skud_4.371         DGTRQADPQVDQSVEITRPDTSYYQTAASPSIKRQKLNQQRHGD--VTRDFGASMEL
Smik_4.356         DATPQTEPEVDQSLEIAKPETSYFQTMESPSTKRQKLDQQNHGD--VTRDFGMSMEL
YDR110W            ----DGASQVDQSVEITRPETSYYQTLESPSTKRQKLDQQGNGD--QTRDFGTSMEL
ZYRO0C01650g       LADYNLEVEQKRYKRMRKSNDADDKSMSEMGPRKKRKLLGRKLQ--SSTNMDESIEL
NDAI0J01380        SNDISYDVSRDESGEIQGPSTSYYNE------RVENDSLAVVGD--DDDNIKYSVEL
NCAS0B03850        ------NTQETESPEITEPSTSYYQT-YQETTSQPTMKHDDSGDDVEWNKLGYSREI
KLLA0F19140g       -----------RSKKVRRPLDQDKHA-----TRASVYNPYNIAD--------VSMEL
AGR086C            SPSPNVNEEYYNNSELAGPGSSFFKN-------ISTSQEPRYGD--------VSLEL
Ecym_4308          ------NQDFQDLSEIPEPSSPYFRN-------TSISQRSKYAD--------VSIEL
SAKL0H17028g       GNSEANRDEYDLSEEIPGPSTSFFAT-----VNHSRTARADEND--------ISIEL
KLTH0G13684g       -----------TSSELSGPAQKYYPG----NSRSTTYTEASNND--------FSVEI
Kwal_56.23799      ------------SREISGPPSFMLKG--------ADHDQTAFVN-------GTSMEL
TDEL0F03890        -----------HSPEISEPNTSFYQE-----LVSPSKKRSRLAQ-------------
KAFR0B05540        -----------DTSEISGPLTSYYEE-----THDSIISKKHKTDDYVEMESNSSMKL
                                                                            

FASTA FORMAT for MUSCLE Version 3.6

>TPHA0A01810
------------------------------------------------------------
---------------MQDEKQASEPNPEKDRNEFKDPEHVLANI--------KYIIPRIG
QKYDSLI---TPLLDKQLLQKGE---IAVANSKTNYLSKELYDLVKNDDLTRKNVA-VAL
NLDE------KN-AITRLIPLKHRYYR-DSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLL
NDHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNI--------RRK-KEPQLS
NSPDILFYERLILDVVAPF----G-----AK-----KIQKRYTHILTITDFHTKFMWSFP
LKNLKLRTIISKVTEFIVALPV-KPVFISSFTLSLNDIFELCCYLAREY--NISIGLGTR
NMQKAYSKN--PYVTRILN--SHKTECLKSWFMCLKWLADRQSNSKFDIRPPNKNYGLFS
G--MTDFLKKYEERSKMIIGRLPSENFINIDEGS---HFIYSED----------------
-------------------------EFSFDNLV-----EKETPKKLSE-----------S
VVNS---SEDSDDNYEDNQEDNYLAEGPN-------------------------------
-----------RDDTILDYNDTFTEA-----------------E--------SGVLL
>TBLA0F03070
------------------------------------------------------------
----------MSKARQKDALFDDDALDDNEQLIDID----------------DFFCPPIG
DDDEIYY---DSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDD-APIPA
SLKI---------KTSKKMYLQIRYSK-NSDGDLIE-TKTNKLLCEPKYIYKLTMKAHFM
NNHMRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIR--------DIRSNYGQRN
QYIDYLPLERLQIDITKPF----------ND--SDIKIANKYSHILLIRDYHSRYSWIFP
LKSPNIKNISTELGKFLVTLPR-TPIFLHSIGIPESQLIKILTKILLEYKIKIRIGIGGI
K-GRMFLRKGISRLVYLLNLKENKEKCKSDWYQCIRNTTFKE-NRRFDRNTGSFANFLIG
KQ-KAELNKVFENKRDALLSDLLEENVLKIGECG---SIIYFDN-------NNS------
-----------------------GKELDEKDVN-----GGVNENSEEE-----------S
------------------------------------------------------------
-----------DYENDDDDDESFYTG-------VKKRKKARVN--------------
>TPHA0J00740
------------------------------------------------------------
---------------MKTLKRKHDMIDDSNNDRII-----------------KVDIPELD
ILYKIEL---GSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEEAMK
SHYTDSGKYMGT-ANKKFMLMEDRYQL-NELGQITDKRNDYKLIVPPNQIYDLIMHCHFL
NDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYK--------HIE-YTRHFS
C-DKNFAFEKIHVEIFQPF----ED----VD-----TFANKFSHVIYIRDYFTRYVWLYP
LEKISVKELANTLATHLLLSLR-IPIYIESLTLDESNLLKILKRISKTT--NLILGVGTT
K-LDEFQASGINHMKELFV--QNREYCGNNWNKYVIRCQNHY-NTTYNKWIYGIPLNLMA
QE-TLADNKTYKKKRQRTILLTLSKNTILLKNGK---SALYKES----------------
------------------------------------------------------------
------------------------------------------------------------
-----------TENSIDLHIENRYEE-------------------------------
>KNAG0H03240
------------------------------------------------------------
--------MTPRVIRGFTEEFERNPYDVDRIESSFSTETN------------PKLVPVIG
DKWSNYA---DEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIARLYP
TDRS------GD-ESRKMMYITRRYYK-DANGMIRDATMNNRIVYDPIHTFDIIMSCHLM
NKHLGSERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLT--------P-K-VQPKPY
LFEKALPLERITIEIIEPF----P-----NE-----KVEGKYSNMVVMKDFIGRFEWLEP
LKNTKFKNIVPVVAKMILSFPR-VPIWVESNTLDWSDLFDIFEMIVTKY--GIKIGLGCT
T--RSSAAQATARINRDLN--DHHDECLFDFNNCLKYGPTKY-NQIKYLGFHKSPCDIIS
HS-ETQLKAKFRAKRAFILKHSPSSCVMNRGM-----GTLYLES---------PNGIQED
AAASSADELSSAKDAE-------DEERDNSTR------EGSGNGEESD-----------T
EPAV---DHSRRSKKKKIAGVKEEPQRSFSPMKDSQRTLFEEDSEQ--------------
----------NDSMELPTPSTSHQNLARSLQRRKFEISKSDTAD---------TSEL
>TBLA0E04430
------------------------------------------------------------
-------MTNDSHQQNSNIQDLKSLTPDEKLEMLK-----------------IYNPKDLG
ISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDT
KLTN------HSKALEKYNFTSRRYYL-NEDNNIIDKRKPGRIICEPKYMYDIVIAYHLK
--LHSSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFK-NIRNNI
IDRPLFPMERIHIEIFNPF----------DD----LKIENKYQRILYIRDYSTRYIWTFT
LKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREY--HISLGLGTN
NKHDHFHLSGIEMFKQLVN--LNKSKCLKSWSNFLVFGSVLH-NNKFNSRILSKPIDIIN
CNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVA---SIIFIED---------EATSIAE
GLTLEGNDKYEQFSDEYRS----DIDVIEDDSY-----DIPLSDTEKK-----------F
SSRK--------------------------------------------------------
-----------RKSRSNDSDTSNSKT-----------KLKKKRK-------------
>CAGL0B01771g
--------------------------------------------------MVKSAKKTGT
QDVDAIMKMNGTNLPSERPKFDIDGFRATKRRPAGTSNMSSTELELYN----KFVMPALD
ETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTMETVMKAMN
IWPP------NA-AETKYSNLIKRFYK-DKEGNIRDAKVDNNIVLEPDKLFNLILTAHLK
NGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIK--------PIE-KVRHRN
INEELLPLERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFP
LKNMKFKTLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKY--GLKLGLGFA
N-FTKFHAQGIKRFKTHLH--RAKSECADDWLMCLKQGTYSA-N-RVIERQLGKASNILF
TELMGQFERDMRKKKLKYIEQSFSENIKTYPKSG---GCIFIE-----------------
----HVQDY--------------EKTMESIDRT-----GTYKSGRKAD-----------Q
LPAE---DTPTSHEPVANTTAINNRSTKANKLNGPNLRK---------------------
-----------RTKEITEIPMSDSDD-DEPKSKRKTRSRTRTRR-------------
>Kpol_543.38
-----------------------------------------------------------M
VESIIIDEDRSISVPSSNQVIDDTLAPISEFKEVNRYGKV------------VFDYPKVG
ATLYEYI---DSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSEKT-
RWSR------IN-ANAKCLYLKRRYKL-TKKGTVIDLTRENKIVYEPDLRYDYIISTHIL
NRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIP--------NLE-KTVHMN
IYEKYLPLERVQLDIFEPF----E-----NE-----KIQNRYSHIIYIRDYRSRFVWIYP
LKNTKFKTLASEIGMLLLDLPR-IPIYIDTTTIERRDMLAICKRIAEKY--EISLGIGTI
E-PSSFYSIGLSRLKCLLN--ENKDKCLKDWNMCLKLGSYYY-NKKSITTARGVPSELFL
DE-MECSATTFESKRTEIINSLPIQNSYKTSTNK---GLVYAQD----------------
--------------------------------------EILTTSKNKS-----------S
NMEN--------------------------------------------------------
-----------GDDTFLEYDDTFIEG-------------STNFE-------------
>Kpol_392.6
-----------------------------------------------------MRINTRS
VQKSKSLKEKNGAVGIVPNLTELKKSRSKSKDKSKIDDEEPAISLPRS-HLKELVLPEIK
NLDELIS---ESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSREKV
KWAN------KS-NE-KYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLI
NEHAAHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVK--------PLK-KSKKNE
VYEGLLPFERIHIEIFKPF----GD----EK-----LIEGTYSHILYIRDYYSRYVWLYP
LKKTAFKELTQTLVTYFFTITK-TPIYIESSTINRNDLIAMVQKIALKY--DLRIGIGIG
N-SSYFHYNGLETMKQLLL--LHEDECLGDWGMCLKYGKNLH-NNLKNRKVLGMPINLLL
NSGISECSIKYKSKKNTVIDETFPHNMIVLDNGK---SEIYLED----------------
-------------------------NLTSTPVI---------------------------
------------------------------------------------------------
-----------DEKNIEPVGYEYYEN-----------PINTLTN-------------
>Suva_2.270
MKVSNFSLFRGKVGKRKNCKMIPHRINVSWLVDSSIQRRSSPQGHIGNEKMAKLRYKGTL
FDDEGDSLPSESAKSKSSPQRRKTTSPRESRESLKDR---------------LLILPLMG
ESYTEYV---DSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQISD
KYDG------VA-AENKLLFLERQYYV-DNEGNVRDRRNNDKIYCEPKHIYDMVMATHLM
NKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIK--------PLK-EYKRPD
MYDKLLPMERIHIEVFEPY----G-----GK-----AIEGKYPYVLLCRDYRSSFMWLLP
LKSTKFKHLIPVVSSLFLSFAR-IPIFVTSSTLDKDDLYDICEEIASKY--GLRIGLGLK
S-SARFHTGGILCIQYALN--SYKEECLADWGKCLRYGPYRF-NRRRNKRTKRKPTQVLL
SE-VPGHNAKFETKRERVIENTYARNMFTMAGGK---GLIYLEDVNTFALVNEGESS-NN
NENLNNTNIGNDNFEEEVQK---QFDLTEQNYI-DEYDDLAHDSSEGE-----------Y
EPST---LTPEENTSHNVEEERIESTSETTDLDGNTKEERDESEER----NLNSVEAVNA
VTAPQTEANGDRSVEITSPETSYYQTEELPSTKRQKVGKQGHGD--ITRDFGLSMEL
>Skud_4.371
--------------------------------------------------MTNSRYNGAL
FDDGDDSLPSGSVTRKSSPQMRKTTSPRESREPLKDR---------------LLILPSMG
ESYTAYV---DSYLNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLTADTLQQISD
KYDG------VV-AENKLLFLQRQYYV-DNEGNVRDGRNNDKIYCEPKHIYDMVMATHLM
NKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIK--------PLK-EYKRPD
MYDKLLPMERIHIEVFEPF----T-----GG-----AIEGKYPYVLLCRDYRSSFMWLLP
LKSTKFKHLIPVISSLFLSFAR-VPIFVTSSTLDKDDLYDICEEIASKY--GLCIGLGLK
S-SARFHTGGILCIQYALN--SYKEECLADWGKCLRYGPYRF-NRRRNKRTKRKPAQVLL
SE-VPGHNAKFETKRERVIENTYSRNMFKMAGGK---GLIYLEDVNTFALANEAENNGNN
NRNHPDNNFGNDDFEEEVQK---QFDLTEQNYI-DEYDDLAHDSSEGE-----------F
EPNT---LTPEEKASHIVEEKRIGSTSETTDLDGNTKQEVDEPEEV-------NHNIEET
DGTRQADPQVDQSVEITRPDTSYYQTAASPSIKRQKLNQQRHGD--VTRDFGASMEL
>Smik_4.356
--------------------------------------------------MTKPRYNGVL
FDDDDSL-PSESATRKAPSQGRKATSSRESRDSSKDR---------------LLILPSMG
ESYTEYV---DSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISD
KYDG------VV-AENKLLFLQRQYYV-DDEGNVRDGRNNDKIYCEPNHIYDMVMATHLI
NKHLRGKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIK--------PLK-EYKRPD
MYDKLLPMERIHIEVFEPF----S-----GE-----TIEGKYSYVLLCRDYRSSFMWLLP
LKSTKFKHLIPVISSLFLSFAR-VPIFVTSSTLDKDDLYDICEEIASKY--GLRIGLGLK
S-SARFHTGGILCIHYALN--SYKEECLADWGKCLRYGPYRF-NRRRNKRTKRKPAQVLL
SE-IPGHNAKFETKRERVIENTYSRNMFKTAGGK---GLIYLEDVNTFALANKADNSYNN
GSS-HNNDVDNDNFEEEVQK---QFDLTEQNYI-DEYDDLAHESSEGE-----------F
GPST---LTPEEKNTRIDEEERIGSASGVAQLNENTRQEIGELEKK---------HQKDA
DATPQTEPEVDQSLEIAKPETSYFQTMESPSTKRQKLDQQNHGD--VTRDFGMSMEL
>YDR110W
--------------------------------------------------MTKPRYNDVL
FDDDDSV---PSESVTRKSQRRKATSPGESRESSKDR---------------LLILPSMG
ESYTEYV---DSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISD
KYDG------VV-AENKLLFLQRQYYV-DDEGNVRDGRNNDKIYCEPKHVYDMVMATHLM
NKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIK--------PLK-EYKRPD
MYDKLLPMERIHIEVFEPF----N-----GE-----AIEGKYSYVLLCRDYRSSFMWLLP
LKSTKFKHLIPVVSSLFLTFAR-VPIFVTSSTLDKDDLYDICEEIASKY--GLRIGLGLK
S-SARFHTGGILCIQYALN--SYKKECLADWGKCLRYGPYRF-NRRRNKRTKRKPVQVLL
SE-VPGHNAKFETKRERVIENTYSRNMFKMAGGK---GLIYLEDVNTFALANEADNSCNN
NGILHNNNIGNDNFEEEVQK---QFDLTEKNYI-DEYDDLAHDSSEGE-----------F
EPNT---LTPEEKPPHNVDEDRIESTGVAAPMQGTEEPEKGDQKES--------------
----DGASQVDQSVEITRPETSYYQTLESPSTKRQKLDQQGNGD--QTRDFGTSMEL
>ZYRO0C01650g
------------------------------------------------------------
---MSKRKPLTQQKLASEEEHEIEGEPKRKKVNKKSRNG-------------EFIVPPMN
QKFVSCL---QLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLERCH-
KWKG------ES-SEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQ
NNHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAK--------PFQ-KKRHKN
VYWELLPLERVHIEVFEPF----D-----GE-----KIQGRFSHLLYFRDYFSRYVWILP
LQNDKRKHMIRAMSSFLLGLPR-IPIFLESTTIDREHLFDLCGQIAEHY--SLKLGLGVK
N-SQRFHNNGIKDMKELLG--SHKEECLQDWNLCLKYGPFHI-NQNINVSSDGRPGDLLF
TS-VPDCNRKFVKKRNDVILDTPSQQVVHLGE-----GVLFLEN-NKEEHKTVEAVKENI
THSDPDEERAENDNTNDT-----QVRIDEGDVSPSKTEPVEQRDEDGEDRRGESDEADIR
RPEDEPIDDAIEQKKEGNARNHLKNSAEVMVANIPNDNHVNTVQMQPAIVRDDYIYDSDE
LADYNLEVEQKRYKRMRKSNDADDKSMSEMGPRKKRKLLGRKLQ--SSTNMDESIEL
>NDAI0J01380
----------------------MTETRTPSNSLRDRATLFVNEEGDDDNDEEQQQLHENS
IQKNGIEGSNSEEEGAATSNKGSMTRPRSEVNGDDDDGNEDERDPKRR-HYGSYLIPNVG
ESYMDYV---DPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLAANFP
HFH----------APTRCALFKRRYVA-DNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLM
NDHAQYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVG--------PLL-KFKHVN
YYKGMLPLERVHIEIFEPF----N-----GK-----KIEGKYSHVIYCRDYRSRYIMLEP
LKNTKFKNLVSAIAKLLFNLPR-IPIFIETVSLNTQDAFDIFEAIVEKY--QINVGLGMK
T-AKRFHTRGVKQMKILLE--GHRKECLNDWTMCLKYGPHNY-NTKHNDRACGVPVDLLT
CN-VKDVTHKSIEKYEQIIRTLPKDNIVQIGN-----GSIYLEEKVKDPNIDNYDAMLGE
EYDSEQEDNNNKNTDQDLAYEHPDYEYDEEQLK-RRPVYGISSSTDKE-----------K
ESESIMNDNHVEENIEEEEEDQIQIDSNPEDNADSNNNDDAEEEKDEKETEQKYLDKRDK
SNDISYDVSRDESGEIQGPSTSYYNE------RVENDSLAVVGD--DDDNIKYSVEL
>NCAS0B03850
--------------------------------MEPSEHESSALRGRANLFFNDDESHEYT
KENHEKLKDDGEEGDESAADNQHIHKEVEEEDGLYDYDYSKRDKPIKRLKLKGYLIPNIG
EKYKDYV---DEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLSATAL
KMDK------FR-AASRLVFLNRRYGL-DEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLI
NDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETI--------PFK-KYKHIN
WFKGLLPLERVQVEVFEPF----P-----GE-----KLGGKYPQILYFRDYRSRFIWMVP
LRNSKFGHLVDLISKMIFSMIR-IPIFFETTTIENQDFFDIFEKIVEKY--QINIGLGTK
L-GGKRLTNGLPQIRKLLG--PHKEECLADWIMCLKYGPHTF-NNKMNDRACGVPGDLLT
GD-IPDLYTKSYDKIEQILQDLPTENIVKIGR-----GCIYLED-------RNPEDPEAE
YEANTDDESDTEDNVEHRQ----EDEEDIGAMMS----PMIDNTRTED-----------E
LENG---EKSHEDDNHSNDNEEGVTKVEGSVPTTPKRRKLNNKNVT--------------
------NTQETESPEITEPSTSYYQT-YQETTSQPTMKHDDSGDDVEWNKLGYSREI
>KLLA0F19140g
--------------------------------------------MNISDTADKTTNKEKS
GTTDEMTSEKDKLLGIRSPEGEVALYPASASTESTEPDF-------------KFVLPVKG
FDLGSF----CGELDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENLLRASD
KVTN------ST-VENKFVLLKRRYYV-Q-ENLLHDVKRKDLVVYEPNELFDLIMSVHVL
NSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKI--------SYK-KFKHEN
IHANLIPLGRCHVEIFAPF----DSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEP
LKSVTLSDLLPVMTKLLFSMIR-MPIFIDTCTLDRQDMFDVCENIARIY--KIKIGLGMN
S-STSFQKTGIKRMKSLFL--QHKEECLHDWNMCLKLVVSRL-NQNYSDRVRGVPSDLLC
ST-QQDLHKKFRTLQRNVISRLLGHHVVQFEEAG---GMIYLED----------------
-ENSPNLLLSGDDNS--------EESEHDSEIF-----DELASSRDGT-----------P
ISEQ---PSPHRTNMNYDGINQESEKHRITKK----------------------------
-----------RSKKVRRPLDQDKHA-----TRASVYNPYNIAD--------VSMEL
>AGR086C
------------------------------------------------------------
----------MVDIMSSPSKGVNDSQPMFVYQYITDE---------------GFKVPQTD
LNLYQL----DGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCD
KVTP------NT-VENKYVLLKRRYVA-K-GGIVIDRKRKDAPVIEPDSLFDMIMSAHLI
NDHMPWRKVYQHMKGLYANVTRELTNMVTGYCSHCNMDRSVR--------RFS-RYKHYN
VHEKLMPLERCHVEVFAPF----DD--EGVE-----KIQGKYSHFLYCRDYHSRFIWLLP
LEGIAFRYLLPALAQLLCTMIR-VPIFLETATLDRQDMFDICEVIARRY--KFKIGLGLN
S-GTEFQKNGIKRVKQLLS--EYKEECQDDWNMCLRLVLSRV-NQTYADRVRGIPSDLLC
NE-IPNISMKFKQKQKKIIDQLYAHHVVHFKEAG---GMIYLED-------EESAFVMDD
----PDDDCTPVPEEPPVA----SDSIQNSATI----LTPITSTQITE-----------N
EVAR---QDPDQLEIRPPSQNNESLSDRVSSEEPPVSKERKKRKIS------KRALKTAS
SPSPNVNEEYYNNSELAGPGSSFFKN-------ISTSQEPRYGD--------VSLEL
>Ecym_4308
------------------------------------------------------------
--------MSKSDEMLLNPYDAQVGSDGSESFFVFQKITEE-----------GFKVPRFD
LNVYQL----APELDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCD
KVTA------GT-VENKFVLLKRRYSI-L-QGNVVDHKREDLPVIEPDLVFDVIMAAHLI
NGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCNTDRNMK--------RFL-RYKHYN
VYDKVMPLERCHVEIFAPF----DD--DGNE-----KIEDKYSHVLYCRDYHSRFVWMLP
LEGITFRDLVPALTQLLCSMIR-LPIFLETATLDRQDMFDVCEYIARKY--KLKIGLGLN
S-GTDFQRNGVTRIKNLFA--EHKEQCIKEWNMCLRLVLTRV-NQNYSDRVRGIPSDLLC
NE-ISNIAHKFKLKQRKIIDELYAHHVVQFREAG---GMIYLED-------DNSAFVVDE
DEHGPENDNVPVTESPS------KESMKSSNNI---ADNLLEPNNNSS-----------I
PSKR---VLPSEKSSIRKNGSKKKINKEKVTDKGKMELSSPLSQAG--------------
------NQDFQDLSEIPEPSSPYFRN-------TSISQRSKYAD--------VSIEL
>SAKL0H17028g
------------------------------------------------------------
---------------MAREIELPTNVPKSKDVCSKPTNN-------------DYVTPKLG
ESQVTY----STDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLLAVTD
GLIP------SN-AEAKYLFLKRRYYV-DSDQIVRDHKRDDTIVCEPELMYELIVSGHLL
NNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVK--------PFT-KFKHTN
AYQGLLPLERIHVEIFKPF----GT----DE-----LIEEKYSHVLYCRDYHSRFVWLSP
LTGITFQELVPQLTEFLLSLPR-LPIFLETTTLDRQDMFDMCEYIARKY--QLAIGLGLN
N-SSHFYKNGIERMKYLLQ--TNKKKCAKDWGMCLKYGSYHN-NTAYNPRIMGFSNDLLC
NE-VSSCGKKFKLKREKIIHELFAHNVVTLKDTG---GMVYVEN-------ENSVFIMED
EDLISVNQDSQESGTPMATSGGQGVEQEMDEMPSMGLTPLKGSNGDML-----------H
KTAD---STPKVKRTSSLSRASSKRTGERASLSDTITPTKKVKKVGENRSRLSGSESVEQ
GNSEANRDEYDLSEEIPGPSTSFFAT-----VNHSRTARADEND--------ISIEL
>KLTH0G13684g
------------------------------------------------------------
-----------------MTKLEKSRVDKRRRDKV------------------EFDMPAVG
EPIEKY----HNGLNLELLERGRLDFIKYQESVKGQLTQDQFDLVRSCSLTEDNLMTTSD
KLHA------GN-VETKFLLLKRRYYV-DADGIVRDYKCSDTVVCEPELMFDLIMCGHLK
NGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELR--------PYK-KFRHTN
IYSGLLPLERVHVEIISPF----------SE-----AIEGTYSHVLFFRDYYSRFVWMQP
LKGDDVRDITKGLLATLLLLPR-IPIFIETSTIDRQDLFEACEDVAGQY--SLYIGLGMS
Q-SSTFQKNGVERLRYLLQ--RNEEQCLRSWYMCLKYGATNH-NLNYNARILGVPGNLLH
ST-VCDYGRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLED-------ETSAFKM--
----PDEEYISAENETDMN----DDDLGFGSAT-RLTTPLTSPGRTPS-----------R
TPNR----TPGRTPGRTPNEVRKVQGGELENLGAENQKVDDVDSTG--------------
-----------TSSELSGPAQKYYPG----NSRSTTYTEASNND--------FSVEI
>Kwal_56.23799
------------------------------------------------------------
-----------------MDKQVGSKVDGRRKDGV------------------KFRMPKVG
ETLEKY----GNGLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMSTSD
KLHS------GN-IETKFLLLKRRFYV-DADGTVRDFKCDDTVVCEPESLFDLIMCGHLK
NGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLR--------PYR-KFRHTN
IYSGLLPLERVHVEIIAPF----------PK-----LIEGLYSHVLYLRDYYSRFVWMQP
LASERVSEITKAFLTFLLSLPR-VPIFVETSTLKRQDLFEVCENIASQY--GLSIGLGMS
R-STTFQRNGVERLRYLLQ--QNEEPCLKSWHMCLKFGVTNH-NMTYNARVLGLPGNLLH
ST-VSDYGRQFELKREELIEKLFASNVVELRNEGRRRGMIYLED-------ESSAFKM--
----PDEEYISAENETE------NEGFDYGPMV--GLTPLTSPSRHDI-----------T
RDTS---ISPSFSPSSPAFEGRPSQTPDTLNM----------------------------
------------SREISGPPSFMLKG--------ADHDQTAFVN-------GTSMEL
>TDEL0F03890
------------------------------------------------------------
-----MASKKPTTLQRRNVLFDEAHSDTQEDKILDEYNGVKS----------QFLAPSMG
ESYKEYA---NSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLASNSD
KWDK------DS-AESKYMFLMRRYYA-E-NGIVRDRRKGDKIVCEPLCIFDLIMCAHLM
NDHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFR--------PLE-KYRHKN
IFKGLLPLERVHIEIFEVF----D-----NE-----SISNKFTNVLYCRDYHTRFVWLAP
LKNTKFKHLVSAVGTLLLGMTY-VPIFMESSTLDKQDLFDICEQLCGKY--NMKLGLGAN
S-SSQFHINGIKRMKKLLN--TRKVDCISDWNMCLRYGPYHL-NRRHNTLAGGIPNDLLY
HS-DHTNRKHFRPKQEMIIDELPAQNVVHVNK-----GLLYLED----------------
----ENSDVFEEEEEQD------DNESDDSEMS-----PGLPPGRIIN-----------S
ATQT---PERSVEAMH--------------------------------------------
-----------HSPEISEPNTSFYQE-----LVSPSKKRSRLAQ-------------
>KAFR0B05540
------------------------------------------------------------
---MTSTKMNENTRALGPEEKVAPVHNMIERDFASELIEAPENIVIKE----SYIVPRMG
ESYTSYT---DSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLASTNP
KWTK------IT-AEPRYLFLKRRYYR-DNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLM
NNHGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIG--------KLE-KFKHRN
IYNELMPLERVHIEIFEPF----P-----NE-----KIEKKYSHILYCRDYHSRYIWMLP
LKNTKFKHLVPTMASLFLSFIR-QPIFIETASLDWQDMFDICEKIAFEY--DLQIGLGTS
K-PNTFHAAGIRQMKAKLE--AHREECLLSWNLCLKYGSYDH-NIRHNDRAGGVPGDLLS
SQ-IQECSLKFKEKIIQILENAVSESVLRVDN-----GLIFLEV--------------DE
PHDEPHDEPYDEFQFEG------DQSIDEEDMG-----AVMPPATEAD------------
-AQD---SMSLTEAYMTDGLPKPRVSKRLIDRQ---------------------------
-----------DTSEISGPLTSYYEE-----THDSIISKKHKTDDYVEMESNSSMKL