MUSCLE (3.8) multiple sequence alignment

TPHA0B03240        -----------------------------------------MSNYIGVDVGTGSARACIT
KAFR0B05560        -----------MGRFQNPLTNGKEK-------------GGDNFHFIGVDVGTGSVRACVI
CAGL0B01727g       -----------------------------------------MGYYIGVDVGSGSVRACVV
AGR092W            -----------------------------------MSAAEMKQYYVGVDVGTEFARACII
KNAG0H03260        --------------------------------------MGEAGYYIGVDVGTGSARAVML
TBLA0E04400        -----------------------------------------MSYYIGVDVGTGSARACLI
NCAS0B03870        ----------------------------MSVFTEKKNTDEQTGYYVGIDVGTGSVRACVV
Ecym_4313          ----------------------------------------MLQHYIGVDVGTESVRACVV
Suva_2.269         MNVYKYKELQNKMPLKNASYSGQLPSQNKLLPQTSLQ-DSQEKFHVGVDVGTGSTRACII
Skud_4.370         ----MYVKKLRRRMQIKTCHLEVSPSKKISLSTIPLK-DPEVKFYVGVDVGTGSARACII
Smik_4.355         ---------MQDKIWQSTTFPSQRTSDSRI-----SQHESETKFYVGVDVGTGSTRACII
YDR109C            ----MKSRKRQNNMQNETREPAVLSSQETSISRISPQ-DPEAKFYVGVDVGTGSARACVI
Kpol_392.9         -----------------------------------------MNHYIGVDVGTGSVRACVI
NDAI0J01400        -------------------------------------MEKDIYYYIGVDVGTGSVRACII
ZYRO0C01782g       ---------MYRGRSRSSMSISQQRLLSQSMLGLSLE--QRMIYYIGVDVGTGSARACLI
TDEL0F03840        --------MRHRGQSRSSLSIAQQRFMSQSMAAISLE--QAMIYYVGVDVGTGSARACII
KLLA0F19041g       --------MFGSRKSHSSLSISQQRLLSHSMSGLSLQNERKMVYYVGVDVGTGSARACVI
SAKL0H17160g       ---------MHSRKSRSSLSISQQRLLSQSMSALSME-QNKMTYYVGVDVGTGSARACII
KLTH0G13794g       ---------MHSRRSRSSVSISQQRMMSRSMVGLSLE-QQKMLYYVGVDVGTGSARACII
Kwal_56.23607      ---------MHSRKSRSSLSISQQRMMSRSMTGLSLE-QQKMLYYIGVDVGTGSARACII
                                                               .:*:***:  .** : 

TPHA0B03240        NKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVIDISNVD--PSSIDGIAF
KAFR0B05560        DRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVIADAKIP--ANKVIGIGF
CAGL0B01727g       DDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSAIGNSNVN--NGDILGIGF
AGR092W            DKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAVAESQVA--VDEVAGINF
KNAG0H03260        QHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVVTKSGVN--PRLVKGIGF
TBLA0E04400        DLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRNILQESNVDDISSKIKGIGF
NCAS0B03870        DSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAIEQCKVD--KSLVLGIGF
Ecym_4313          DVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKIICDSQVV--KDSIIGIGF
Suva_2.269         DQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVLQESEVD--PKKVHGIGF
Skud_4.370         DQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVIQESRVD--PDRVHGMGF
Smik_4.355         DKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYCVRKVIQEAGVD--PARIHGIGF
YDR109C            DQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVVEESGVD--PERVRGIGF
Kpol_392.9         NDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYVLQESQII--PSSVLGIGF
NDAI0J01400        DDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVVNELGCT--RDQVKGIGF
ZYRO0C01782g       DSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKTVVRDSGVD--IERIHGIGF
TDEL0F03840        DNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKSVVRDSGVP--VERIHGIGF
KLLA0F19041g       DNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKNVVRDSGVD--PRTIHGIGF
SAKL0H17160g       DNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKSVVKDSGVL--PEKIHGIGF
KLTH0G13794g       DSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKSVVRDSGVP--AEKIHGIGF
Kwal_56.23607      DSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKSVVRDSGVP--SEKIHGIGF
                   :  *   :     * . :     :***: :**      :.  :           : *: *

TPHA0B03240        DATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLINSTNDKRLKYVGGKM
KAFR0B05560        DATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEINSIYDAPLKYVGGKM
CAGL0B01727g       DATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKEINRSGDPCLKYVGGQM
AGR092W            DATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEINSTGHSVLRYVGGKM
KNAG0H03260        DATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAINATGDRCLKYVGGQM
TBLA0E04400        DATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIETVEINSTDSKCLKYVGGQM
NCAS0B03870        DATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEINATNDKCLKYVGGAM
Ecym_4313          DATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNEINSTGHRCLKYVGGKM
Suva_2.269         DATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEEINSTGDKCLKYVGGQM
Skud_4.370         DATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEINSSEDKCLKYVGGQM
Smik_4.355         DATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKETEEINFSGNTCLKYVGGQM
YDR109C            DATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEINSSGDKCLKYVGGQM
Kpol_392.9         DATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDEINATGDKCLKYVGGKM
NDAI0J01400        DATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETKEINSTNDECLKYVGGQM
ZYRO0C01782g       DATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETAEINSTNHPVLKYVGGQM
TDEL0F03840        DATCSLVVVD-DEDKEVGVGPVFANNDQNIVLWMDHRAIAETNEINATNDKCLKYVGGQM
KLLA0F19041g       DATCSLVVVD-NNNEDVGVGPDFTDNLQNIILWMDHRAIEETEEINATGDKCLKYVGGQM
SAKL0H17160g       DATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETKEINATNDKCLKYVGGQM
KLTH0G13794g       DATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQLINATGDKCLKYVGGQM
Kwal_56.23607      DATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETEQINATGDKCLKYVGGQM
                   ******....      : .** * .   ::::******  *.  **      *.**** *

TPHA0B03240        SVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSFSSAVCKQGLLPTGVE
KAFR0B05560        SIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSLCSAVCKQGLLPIGVE
CAGL0B01727g       SVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRSYCSAVCKQGFLPKGVE
AGR092W            SVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSFCSTVCKMGLVPNGVD
KNAG0H03260        SVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSFCSAVCKQGLLPPGVD
TBLA0E04400        SVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNSIRSFCSAVCKQGLLPLGVE
NCAS0B03870        SVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSFCSVVCKQGFLPNGVE
Ecym_4313          SIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRSFCSTVCKMGLLPLGVD
Suva_2.269         SVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRSFASAVCKQGFLPAGVE
Skud_4.370         SVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSFSSAVCKQGFLPAGVE
Smik_4.355         SVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGKENRSFSSVVCKQGFLPEGVE
YDR109C            SVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSFCSAVCKQGFLPVGVE
Kpol_392.9         SVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRSFSSTVCKQGLLPLGVE
NDAI0J01400        SIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTRSFCSVVCKQGMVPMGVE
ZYRO0C01782g       SIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTRSFNSSVCKQGLLPLGVE
TDEL0F03840        SVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTRSFCSTVCKQGLIPIGVE
KLLA0F19041g       SVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIRSYCSTVCKQGLLPLGVE
SAKL0H17160g       SVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLETRSYCSTVCKQGLLPVGVE
KLTH0G13794g       SVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETRSFCSTVCKQGLLPVGVE
Kwal_56.23607      SVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETRSFCSTVCKQGLLPVGVE
                   *:*:::******: ::    :    * :* *:**: *:    .*  * *** *::* **:

TPHA0B03240        GSKLGWSKEFLEKIGLEELSTNNFEKLGGSIN---LKEGN--FLIPGDLVGHVDKKFAGL
KAFR0B05560        GSTEGWSRTFLSNTGLPELIENEFERIGGPGN----NSRN--FLSAGEYVSTLSKSSGEQ
CAGL0B01727g       GSSKGWSTEFLTKIGLEEISQSNFNALGGPNE-----SGN--FTYAGNQLSTVSESFIKS
AGR092W            SSTSGWSREFLEQIGLEELCEDGFRRLGGALD---EPGSE--FRSAGEPVGLLSEAAAAS
KNAG0H03260        GSEGHWSPEFLEAVGLSELIDTNFVQLGGTSE----SKPK--FLTAGQPVGQLTLEASEQ
TBLA0E04400        GSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVS--FSTAGEFIGYLSDKSSKI
NCAS0B03870        GSSEGWSKEFLSSIGLEDLAGNSYDSLGGALK--NDSQDN--FQSSGKCLGPLSNEAVIE
Ecym_4313          GSTKGWPQDLFEDIGLAELCRREFSKLGGVVS---STASN--FLSAGDYVGHLSDEAAAD
Suva_2.269         SSKLGWSEEFLNSIGLSELTTNDFERLGGSLR----DKKN--FLSAGECVGFLDVNSACE
Skud_4.370         GSNLGWSEEFLNTIGLSELIESDFEKLGGSLR----HKKN--FLSAGECIGSLDWKAARE
Smik_4.355         GSNLGWSKQFLDSIGLSELTDNDFEKLGGSLR----NQKN--FLSAGECIGPLDGKAARQ
YDR109C            GSDIGWSKEFLNSIGLSELTKNDFERLGGSLR----EKKN--FLTAGECISPLDKKAACQ
Kpol_392.9         GSDIGWSKEFFTKIDLDELSSDNFSAIGGSIH-SEQLENN--IRSVGEYVGHLSEISAKE
NDAI0J01400        GSKLGWSKDFLRNIDLEELTYNDYAKLGGSVS--GSHGRN--FLTAGEYIAPLNDQAIEE
ZYRO0C01782g       GSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRS-NFLSAGQYVGALSPEAAAD
TDEL0F03840        GSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTHSFLSAGEYVGALDEEAAEE
KLLA0F19041g       GSKNGWSKEFLQEIGLEELIADDFAKLGGSVT-----ETT--FLSAGECIGTLTEESAAE
SAKL0H17160g       SSKQGWSKEFLTNIGLEDLCQDDFRKLGGSIKSDGSGGST--FLSAGECIGSLDPSAAEE
KLTH0G13794g       GSAEGWSREFLTEIGLEELIEDDFRRIGGSVK-NSDKGKN--FLSAGEFIGAIDATVAEE
Kwal_56.23607      GSKEGWSREFLTEIGLEDFIEDDFRKIGGSVK-NSDKGKN--FLSAGEFVGAIDPAVAEE
                   .*   *.  ::   .* ::    :                  :   *. :. :       

TPHA0B03240        ANLPNHCVVGTGVIDAYSGWVGTVAS--DVSDRVCSDSPQELNKIEGSLGRIAVVSGTST
KAFR0B05560        LGLTESCVVGSGLIDAYAGLIGTIAARIDESART--QDDANGQDLQNAIGRLAAVAGTST
CAGL0B01727g       TNINPGCIVGSGIIDAYAGWIGTVASST-IEVP----NNKEVVDIEECAGRLAAVAGTST
AGR092W            LGLTPRCVVGSGVIDAYAGWVGTVGASPDGA--------RESGGVEELAGRLAAVAGTST
KNAG0H03260        FGLSTSCIVASGVIDAYAGWIGSVGAKFDQS--------HKSSGLDVAITRLALIAGTST
TBLA0E04400        MGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLNGMICSSGRLAVVAGTST
NCAS0B03870        LGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQI---KNDSSIGLQNAIGRLASVAGTST
Ecym_4313          LGLTTKCIVASGLIDAYAGWVGTIAAGITLG--------SDGQESELASSRLATVAGTST
Suva_2.269         LGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAIGRLAAVAGTST
Skud_4.370         LGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAIGRLAAVAGTST
Smik_4.355         LGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHDFNGAIGRLAAVAGTST
YDR109C            LGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAIGRLAAVAGTST
Kpol_392.9         LGLPTTCIVGSGIIDAYAGWVGTVAAKVE-EIGTINNDDDASSKLDSSIGNLAVIAGTST
NDAI0J01400        LELSKECIVGSGIIDAYAGWLGTVGSGT-VDLEQLF-----RVGMANAIGRLAAVAGTST
ZYRO0C01782g       LGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLGVDKATGRLAAVAGTST
TDEL0F03840        LGLPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTKKGIDRATGRLAAVAGTST
KLLA0F19041g       LGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRATGRLAAVAGTST
SAKL0H17160g       LGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTGIDHATGRLAAVAGTST
KLTH0G13794g       LGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMDRATGRLAAVAGTST
Kwal_56.23607      LGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMDRATGRLAAVAGTST
                     :   * *.:*:****:* :*::.:                        .:* ::****

TPHA0B03240        CHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPAYQELERITSR
KAFR0B05560        CHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYEELKIKAAK
CAGL0B01727g       CHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSANELSNLVKQ
AGR092W            CLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHPAYTELHQAAQQ
KNAG0H03260        CHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHPAHEELVRLAAK
TBLA0E04400        CHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQHVLETHPAYKELCAISKQ
NCAS0B03870        CHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIHPAFKELINASGV
Ecym_4313          CHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPAYDTLCKLAKN
Suva_2.269         CHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIKTHPAFTELSQLADA
Skud_4.370         CHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHPAYTELSQLTNA
Smik_4.355         CHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVITTHPAFSKLSQLADA
YDR109C            CHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHPAFTELSHMANL
Kpol_392.9         CHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTHPAYPELHEQCEK
NDAI0J01400        CHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHPSYKELEEISEK
ZYRO0C01782g       CHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLSTHPAYTDLEHLSES
TDEL0F03840        CHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGALLAHVMSTHPAFTELSHLSDA
KLLA0F19041g       CHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTHPAYAELSQLSDA
SAKL0H17160g       CHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLTIHPAYTELSHLSDA
KLTH0G13794g       CHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVLTTHPAYTELSQLADA
Kwal_56.23607      CHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVMTTHPAYTELSQLADA
                   * : ::  . *: *:****.* :  . * :****: ** **   :  **:   *      

TPHA0B03240        QNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLMSGMIIGQTMD
KAFR0B05560        SKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPRMRASIIGQSMD
CAGL0B01727g       RNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMRAAIIGQSMD
AGR092W            RGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSMRAAMVGLSMD
KNAG0H03260        QQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMRATVIGQSMD
TBLA0E04400        QDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRSPVADEAMRGNIIGLSMD
NCAS0B03870        AKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADPMMSAAIIGQSMN
Ecym_4313          QGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNMRATIIGQSMD
Suva_2.269         ASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIADPNMRACIIGQSMD
Skud_4.370         AGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSNMRACIIGQSMD
Smik_4.355         ANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRSPIADPNMRACIIGQSMD
YDR109C            AGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPNMRACIIGQSMD
Kpol_392.9         HSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDESMRAAIIGQSMD
NDAI0J01400        NGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPSMKGAIVGLSMD
ZYRO0C01782g       AGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSPIADNTMRAAIIGQSMD
TDEL0F03840        ANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGNRSPIADPSMRAAIIGQSMD
KLLA0F19041g       ANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIADPSMRAAIIGQSMD
SAKL0H17160g       ASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRSPIADPSMRAAVIGQSMD
KLTH0G13794g       ASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIADPSMRAAIIGQSMD
Kwal_56.23607      ASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIADPSMRAAIIGQSMD
                        *  :.  :  :           * .  ::***  ***** :*  * . ::* :*:

TPHA0B03240        SSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLLMELISNCCVL
KAFR0B05560        TTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNILMELLADFTGL
CAGL0B01727g       TSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILMQLIANCTGL
AGR092W            VSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLLADAVRR
KNAG0H03260        VSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLMQLIADSVGV
TBLA0E04400        SSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGGQCRNELLMQLISNCVGL
NCAS0B03870        HNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNKLLMKLLSDCTGL
Ecym_4313          VSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVLIKLLANCTKL
Suva_2.269         NSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCRNGLLMRLLADCTGL
Skud_4.370         NSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDLLTRLLADCSGL
Smik_4.355         NSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGGQCRNGLLMRLLADCTGL
YDR109C            NSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSLLMRLLADCTGL
Kpol_392.9         TSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQLLMRLLADCTGL
NDAI0J01400        TSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSLLMKLLADCSGL
ZYRO0C01782g       NSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQCRNGLLMRLLADCTGL
TDEL0F03840        NSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMSGGQCRNGLLMRLLADCTGL
KLLA0F19041g       NSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNGLLMRLLADCTGL
SAKL0H17160g       NSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGGQCRNGLLMRLLADCTGL
KLTH0G13794g       NSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCRNGLLMRLLADCTGL
Kwal_56.23607      NSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCRNGLLMRLLADCTGL
                    . :.*.   * * ***: * .:*:  :   *  :  :::***:..* :*  *:::    

TPHA0B03240        PLVLSKYIDSSVVFGAAILGSVAAKINSMKEN----------------------------
KAFR0B05560        PVVIPKYIDAAVVFGAALIGATAWDVFNQCET----------------------------
CAGL0B01727g       PLIIPKYIDSAVVFGSAILGAMAYSSSKNNSD----------------------------
AGR092W            PVVTPRHVGAAVVFGSALLAAAAVENYLANTN----------------------------
KNAG0H03260        PVVLPKYTDCCVVFGAALLACCASKGCDGIEA----------------------------
TBLA0E04400        PVVIPKNIDTAVVFGSALMGACASELSKSHSD----------------------------
NCAS0B03870        PIMLPKYVDAAVVFGAAILGATA-------------------------------------
Ecym_4313          PIVLPKYIDAAVVFGSALLGVAASEKYLHGCS----------------------------
Suva_2.269         PIMIPRYIDAAVVFGSALLGAAASEASDLANE-------------KTICQTRRSSLSQKE
Skud_4.370         PIVIPRYIDGAVVFGSALLGAAASEAFDLAKG------------RRTLTTKKSSSAQEF-
Smik_4.355         PIVIPRYIDGAVVFGSALLGAAASKVFDLNKR-------------RRVIKSKKSSLVQTE
YDR109C            PIVIPRYVDAAVVFGSALLGAAASEDFDYTRE--------------KRTLKGQKSSQTKT
Kpol_392.9         PVVIPRYIDASVIFGSAILGAVAVDAYNIKHL----------------------------
NDAI0J01400        SVIIPEYIDSAVVFGAAILGASASKLYQLNGS----------------------------
ZYRO0C01782g       PIIIPRYIDAAVVFGSALLGAVASESYNAHHT------------KTDLRKRRASSLGSKD
TDEL0F03840        PIIIPRYIDAAVVFGSALLGAVASESFNSHHA------------KSEITRRRKSSLTNLD
KLLA0F19041g       PIVIPRYIDAAVVFGSALLGAVASESFNACAKLEETASDPATTSNKDVSIRRKSSLSRKD
SAKL0H17160g       PIVIPRYIDAAVVFGSALLGAVASESFNLNHK------------SGSLSRRRKSSLSGKY
KLTH0G13794g       PIVIPRYIDAAVVFGSALLGAVASESFDLSGT------------HSALSVSRKSSIAGE-
Kwal_56.23607      PIVIPRYIDAAVVFGSALLGAVASESFDLSGT------------TSELSVSRKSSIAGH-
                   .:: .   . .*:**:*::.  *                                     

TPHA0B03240        ------------------------------------------------------------
KAFR0B05560        ------------------------------------------------------------
CAGL0B01727g       ------------------------------------------------------------
AGR092W            ------------------------------------------------------------
KNAG0H03260        ----------------------------------------------D-------------
TBLA0E04400        ------------------------------------------------------------
NCAS0B03870        ------------------------------------------------------------
Ecym_4313          ------------------------------------------------------------
Suva_2.269         KVVNDPYKPIQNLSGEDQNLAF------------------------DVSPPNSTPSYIKN
Skud_4.370         --FINSYPSPQNSAMRHQNLAS------------------------DVTCSYNLPNSISS
Smik_4.355         F-LEGLYPSIQNLPLENHST--------------------------NVVASYKLACSNLN
YDR109C            ERFNDSYSSIQKLSMEDRNSTN------------------------GFVSPHNLQLSTPS
Kpol_392.9         ------------------------------------------------------------
NDAI0J01400        ------------------------------------------------------------
ZYRO0C01782g       QAIAGLGK-----GGLSKLSELQT----------------------DQPSPYTAPHATSS
TDEL0F03840        ---PSSLPSASGKGPLSQLGKMKP----------------------DLPSPYTAPHATSS
KLLA0F19041g       AGIIGDGSRSRSGSAASGLGHGGGNTLKPLTSFAKAQKKTNDLKFADMPSPYTAPSATSS
SAKL0H17160g       EEFKDSMEIPKK-NFLSKLGGTASG---------------------DLPSPYTAPSATAS
KLTH0G13794g       ---PANAGQPKK-SAVSKFGQLGGD---------------------DLPSPYTAPSATAS
Kwal_56.23607      ---PTDGSQPKK-SAVSKLGQFGSD---------------------DLPSPYTAPSATAS
                                                                               

TPHA0B03240        --------------------------------------KLEYS-----------------
KAFR0B05560        ------------------------------------------NDDRVPQ-----------
CAGL0B01727g       ------------------------------------------KG----------------
AGR092W            ---------------------------------ATASSILPSSASRA-------------
KNAG0H03260        ------------------------------------------------------------
TBLA0E04400        ------------------------------------------NTKK--------------
NCAS0B03870        ------------------------------------------DASRKSVEIECD------
Ecym_4313          ---------------------------------DTASVSTIVDQQRITSELKP-------
Suva_2.269         IP---ATLNSHISPIVERQLHV----VVSARN-RNDKDTSTSTVTRGLQKERCN------
Skud_4.370         APDTMNRHSSTISKQSRGDMSS---------E-ESSKGTLNTVALRSLEEKRYR------
Smik_4.355         AP---ARTSSDLFPISKEQPAD------MISD-KSSKGISLDKGRENLEEERDI------
YDR109C            AP---AKINNYSLPICTQQPL------------DKTSEESSKDASLTVGQESLGEGRYN-
Kpol_392.9         ------------------------------------------DGNKNWD-----------
NDAI0J01400        ------------------------------------------ESDTVIN-----------
ZYRO0C01782g       S----HMGGGSYFPIVGSDAAANLSPGEAIAETEDEEEPVTFKSVKSTTQENLAEKTDTN
TDEL0F03840        TSQIAATSGSFPFPVVGESSEAI---TEEAND-SE--GPVSFKPTRATSQEGLATRNPPN
KLLA0F19041g       TAQISTTG-GYPFPVMASNEEAIIDEMEEENE-DE--SLLTFDAKTEKSKEAATSAANHN
SAKL0H17160g       TSQIASTVGGFPFPVTSDDSVAI---IEEDDP-EEANAALSFGSKKATAQEQLALEKEKS
KLTH0G13794g       TSQIASTI-GFPFP-TPEDAYAIDEHVEQEKD-EGESTELNFKAHSKWKKDMEDRMKGRS
Kwal_56.23607      TSQIASTV-GFPFP-TPDDPYALGEQTEPDAD-NDNSSELNFKAHSKWKKDMEDRMKGRS
                                                                               

TPHA0B03240        --------LNDVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKK
KAFR0B05560        --------VEHTLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSL
CAGL0B01727g       --------GADLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQL
AGR092W            --------PMHRLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKL
KNAG0H03260        --------QSTRLWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQ
TBLA0E04400        --------PDQILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSM
NCAS0B03870        --------FGFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQM
Ecym_4313          --------KQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDL
Suva_2.269         --------SGDLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNM
Skud_4.370         --------GTGILWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHM
Smik_4.355         --------DKNILWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRM
YDR109C            --------GTSFLWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRM
Kpol_392.9         --------HGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQ
NDAI0J01400        --------TENILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAI
ZYRO0C01782g       S-------NGEELWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSA
TDEL0F03840        --------NGDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREA
KLLA0F19041g       NAKVLRDVTKDKLWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKL
SAKL0H17160g       ASG-----KGDALWDVMYNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREA
KLTH0G13794g       -SD-----NGDAMWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTI
Kwal_56.23607      -SD-----NGDAMWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNL
                               :*  *  :*  .  : *          :  *: ::::*   :  **  

TPHA0B03240        MEEVYK-------------
KAFR0B05560        IDDSLSVQ-----------
CAGL0B01727g       VENAIR-------------
AGR092W            VDDVENTP-----------
KNAG0H03260        MDQVFRSIT----------
TBLA0E04400        VNGL---------------
NCAS0B03870        VDDIDI-------------
Ecym_4313          VTRAENSV-----------
Suva_2.269         VDRVEIPLVNKSK------
Skud_4.370         VDNLEESF---SK------
Smik_4.355         VDKVEETF---SR------
YDR109C            VDKVEGSF---SR------
Kpol_392.9         IDEIEASF---NE------
NDAI0J01400        VDAVED-------------
ZYRO0C01782g       IDRVEANL---KAQITK--
TDEL0F03840        IDKVEKAI---AK------
KLLA0F19041g       VDEVK--------------
SAKL0H17160g       VDKVENQR---QTIDPRWP
KLTH0G13794g       VDDAVRN------------
Kwal_56.23607      VNEVEKS------------
                   :                  

FASTA FORMAT for MUSCLE Version 3.6

>TPHA0B03240
-----------------------------------------MSNYIGVDVGTGSARACIT
NKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVIDISNVD--PSSIDGIAF
DATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLINSTNDKRLKYVGGKM
SVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSFSSAVCKQGLLPTGVE
GSKLGWSKEFLEKIGLEELSTNNFEKLGGSIN---LKEGN--FLIPGDLVGHVDKKFAGL
ANLPNHCVVGTGVIDAYSGWVGTVAS--DVSDRVCSDSPQELNKIEGSLGRIAVVSGTST
CHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPAYQELERITSR
QNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLMSGMIIGQTMD
SSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLLMELISNCCVL
PLVLSKYIDSSVVFGAAILGSVAAKINSMKEN----------------------------
------------------------------------------------------------
--------------------------------------KLEYS-----------------
--------LNDVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKK
MEEVYK-------------
>KAFR0B05560
-----------MGRFQNPLTNGKEK-------------GGDNFHFIGVDVGTGSVRACVI
DRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVIADAKIP--ANKVIGIGF
DATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEINSIYDAPLKYVGGKM
SIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSLCSAVCKQGLLPIGVE
GSTEGWSRTFLSNTGLPELIENEFERIGGPGN----NSRN--FLSAGEYVSTLSKSSGEQ
LGLTESCVVGSGLIDAYAGLIGTIAARIDESART--QDDANGQDLQNAIGRLAAVAGTST
CHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYEELKIKAAK
SKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPRMRASIIGQSMD
TTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNILMELLADFTGL
PVVIPKYIDAAVVFGAALIGATAWDVFNQCET----------------------------
------------------------------------------------------------
------------------------------------------NDDRVPQ-----------
--------VEHTLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSL
IDDSLSVQ-----------
>CAGL0B01727g
-----------------------------------------MGYYIGVDVGSGSVRACVV
DDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSAIGNSNVN--NGDILGIGF
DATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKEINRSGDPCLKYVGGQM
SVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRSYCSAVCKQGFLPKGVE
GSSKGWSTEFLTKIGLEEISQSNFNALGGPNE-----SGN--FTYAGNQLSTVSESFIKS
TNINPGCIVGSGIIDAYAGWIGTVASST-IEVP----NNKEVVDIEECAGRLAAVAGTST
CHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSANELSNLVKQ
RNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMRAAIIGQSMD
TSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILMQLIANCTGL
PLIIPKYIDSAVVFGSAILGAMAYSSSKNNSD----------------------------
------------------------------------------------------------
------------------------------------------KG----------------
--------GADLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQL
VENAIR-------------
>AGR092W
-----------------------------------MSAAEMKQYYVGVDVGTEFARACII
DKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAVAESQVA--VDEVAGINF
DATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEINSTGHSVLRYVGGKM
SVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSFCSTVCKMGLVPNGVD
SSTSGWSREFLEQIGLEELCEDGFRRLGGALD---EPGSE--FRSAGEPVGLLSEAAAAS
LGLTPRCVVGSGVIDAYAGWVGTVGASPDGA--------RESGGVEELAGRLAAVAGTST
CLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHPAYTELHQAAQQ
RGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSMRAAMVGLSMD
VSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLLADAVRR
PVVTPRHVGAAVVFGSALLAAAAVENYLANTN----------------------------
------------------------------------------------------------
---------------------------------ATASSILPSSASRA-------------
--------PMHRLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKL
VDDVENTP-----------
>KNAG0H03260
--------------------------------------MGEAGYYIGVDVGTGSARAVML
QHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVVTKSGVN--PRLVKGIGF
DATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAINATGDRCLKYVGGQM
SVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSFCSAVCKQGLLPPGVD
GSEGHWSPEFLEAVGLSELIDTNFVQLGGTSE----SKPK--FLTAGQPVGQLTLEASEQ
FGLSTSCIVASGVIDAYAGWIGSVGAKFDQS--------HKSSGLDVAITRLALIAGTST
CHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHPAHEELVRLAAK
QQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMRATVIGQSMD
VSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLMQLIADSVGV
PVVLPKYTDCCVVFGAALLACCASKGCDGIEA----------------------------
----------------------------------------------D-------------
------------------------------------------------------------
--------QSTRLWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQ
MDQVFRSIT----------
>TBLA0E04400
-----------------------------------------MSYYIGVDVGTGSARACLI
DLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRNILQESNVDDISSKIKGIGF
DATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIETVEINSTDSKCLKYVGGQM
SVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNSIRSFCSAVCKQGLLPLGVE
GSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVS--FSTAGEFIGYLSDKSSKI
MGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLNGMICSSGRLAVVAGTST
CHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQHVLETHPAYKELCAISKQ
QDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRSPVADEAMRGNIIGLSMD
SSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGGQCRNELLMQLISNCVGL
PVVIPKNIDTAVVFGSALMGACASELSKSHSD----------------------------
------------------------------------------------------------
------------------------------------------NTKK--------------
--------PDQILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSM
VNGL---------------
>NCAS0B03870
----------------------------MSVFTEKKNTDEQTGYYVGIDVGTGSVRACVV
DSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAIEQCKVD--KSLVLGIGF
DATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEINATNDKCLKYVGGAM
SVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSFCSVVCKQGFLPNGVE
GSSEGWSKEFLSSIGLEDLAGNSYDSLGGALK--NDSQDN--FQSSGKCLGPLSNEAVIE
LGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQI---KNDSSIGLQNAIGRLASVAGTST
CHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIHPAFKELINASGV
AKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADPMMSAAIIGQSMN
HNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNKLLMKLLSDCTGL
PIMLPKYVDAAVVFGAAILGATA-------------------------------------
------------------------------------------------------------
------------------------------------------DASRKSVEIECD------
--------FGFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQM
VDDIDI-------------
>Ecym_4313
----------------------------------------MLQHYIGVDVGTESVRACVV
DVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKIICDSQVV--KDSIIGIGF
DATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNEINSTGHRCLKYVGGKM
SIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRSFCSTVCKMGLLPLGVD
GSTKGWPQDLFEDIGLAELCRREFSKLGGVVS---STASN--FLSAGDYVGHLSDEAAAD
LGLTTKCIVASGLIDAYAGWVGTIAAGITLG--------SDGQESELASSRLATVAGTST
CHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPAYDTLCKLAKN
QGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNMRATIIGQSMD
VSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVLIKLLANCTKL
PIVLPKYIDAAVVFGSALLGVAASEKYLHGCS----------------------------
------------------------------------------------------------
---------------------------------DTASVSTIVDQQRITSELKP-------
--------KQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDL
VTRAENSV-----------
>Suva_2.269
MNVYKYKELQNKMPLKNASYSGQLPSQNKLLPQTSLQ-DSQEKFHVGVDVGTGSTRACII
DQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVLQESEVD--PKKVHGIGF
DATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEEINSTGDKCLKYVGGQM
SVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRSFASAVCKQGFLPAGVE
SSKLGWSEEFLNSIGLSELTTNDFERLGGSLR----DKKN--FLSAGECVGFLDVNSACE
LGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAIGRLAAVAGTST
CHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIKTHPAFTELSQLADA
ASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIADPNMRACIIGQSMD
NSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCRNGLLMRLLADCTGL
PIMIPRYIDAAVVFGSALLGAAASEASDLANE-------------KTICQTRRSSLSQKE
KVVNDPYKPIQNLSGEDQNLAF------------------------DVSPPNSTPSYIKN
IP---ATLNSHISPIVERQLHV----VVSARN-RNDKDTSTSTVTRGLQKERCN------
--------SGDLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNM
VDRVEIPLVNKSK------
>Skud_4.370
----MYVKKLRRRMQIKTCHLEVSPSKKISLSTIPLK-DPEVKFYVGVDVGTGSARACII
DQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVIQESRVD--PDRVHGMGF
DATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEINSSEDKCLKYVGGQM
SVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSFSSAVCKQGFLPAGVE
GSNLGWSEEFLNTIGLSELIESDFEKLGGSLR----HKKN--FLSAGECIGSLDWKAARE
LGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAIGRLAAVAGTST
CHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHPAYTELSQLTNA
AGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSNMRACIIGQSMD
NSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDLLTRLLADCSGL
PIVIPRYIDGAVVFGSALLGAAASEAFDLAKG------------RRTLTTKKSSSAQEF-
--FINSYPSPQNSAMRHQNLAS------------------------DVTCSYNLPNSISS
APDTMNRHSSTISKQSRGDMSS---------E-ESSKGTLNTVALRSLEEKRYR------
--------GTGILWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHM
VDNLEESF---SK------
>Smik_4.355
---------MQDKIWQSTTFPSQRTSDSRI-----SQHESETKFYVGVDVGTGSTRACII
DKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYCVRKVIQEAGVD--PARIHGIGF
DATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKETEEINFSGNTCLKYVGGQM
SVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGKENRSFSSVVCKQGFLPEGVE
GSNLGWSKQFLDSIGLSELTDNDFEKLGGSLR----NQKN--FLSAGECIGPLDGKAARQ
LGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHDFNGAIGRLAAVAGTST
CHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVITTHPAFSKLSQLADA
ANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRSPIADPNMRACIIGQSMD
NSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGGQCRNGLLMRLLADCTGL
PIVIPRYIDGAVVFGSALLGAAASKVFDLNKR-------------RRVIKSKKSSLVQTE
F-LEGLYPSIQNLPLENHST--------------------------NVVASYKLACSNLN
AP---ARTSSDLFPISKEQPAD------MISD-KSSKGISLDKGRENLEEERDI------
--------DKNILWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRM
VDKVEETF---SR------
>YDR109C
----MKSRKRQNNMQNETREPAVLSSQETSISRISPQ-DPEAKFYVGVDVGTGSARACVI
DQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVVEESGVD--PERVRGIGF
DATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEINSSGDKCLKYVGGQM
SVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSFCSAVCKQGFLPVGVE
GSDIGWSKEFLNSIGLSELTKNDFERLGGSLR----EKKN--FLTAGECISPLDKKAACQ
LGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAIGRLAAVAGTST
CHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHPAFTELSHMANL
AGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPNMRACIIGQSMD
NSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSLLMRLLADCTGL
PIVIPRYVDAAVVFGSALLGAAASEDFDYTRE--------------KRTLKGQKSSQTKT
ERFNDSYSSIQKLSMEDRNSTN------------------------GFVSPHNLQLSTPS
AP---AKINNYSLPICTQQPL------------DKTSEESSKDASLTVGQESLGEGRYN-
--------GTSFLWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRM
VDKVEGSF---SR------
>Kpol_392.9
-----------------------------------------MNHYIGVDVGTGSVRACVI
NDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYVLQESQII--PSSVLGIGF
DATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDEINATGDKCLKYVGGKM
SVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRSFSSTVCKQGLLPLGVE
GSDIGWSKEFFTKIDLDELSSDNFSAIGGSIH-SEQLENN--IRSVGEYVGHLSEISAKE
LGLPTTCIVGSGIIDAYAGWVGTVAAKVE-EIGTINNDDDASSKLDSSIGNLAVIAGTST
CHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTHPAYPELHEQCEK
HSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDESMRAAIIGQSMD
TSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQLLMRLLADCTGL
PVVIPRYIDASVIFGSAILGAVAVDAYNIKHL----------------------------
------------------------------------------------------------
------------------------------------------DGNKNWD-----------
--------HGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQ
IDEIEASF---NE------
>NDAI0J01400
-------------------------------------MEKDIYYYIGVDVGTGSVRACII
DDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVVNELGCT--RDQVKGIGF
DATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETKEINSTNDECLKYVGGQM
SIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTRSFCSVVCKQGMVPMGVE
GSKLGWSKDFLRNIDLEELTYNDYAKLGGSVS--GSHGRN--FLTAGEYIAPLNDQAIEE
LELSKECIVGSGIIDAYAGWLGTVGSGT-VDLEQLF-----RVGMANAIGRLAAVAGTST
CHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHPSYKELEEISEK
NGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPSMKGAIVGLSMD
TSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSLLMKLLADCSGL
SVIIPEYIDSAVVFGAAILGASASKLYQLNGS----------------------------
------------------------------------------------------------
------------------------------------------ESDTVIN-----------
--------TENILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAI
VDAVED-------------
>ZYRO0C01782g
---------MYRGRSRSSMSISQQRLLSQSMLGLSLE--QRMIYYIGVDVGTGSARACLI
DSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKTVVRDSGVD--IERIHGIGF
DATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETAEINSTNHPVLKYVGGQM
SIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTRSFNSSVCKQGLLPLGVE
GSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRS-NFLSAGQYVGALSPEAAAD
LGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLGVDKATGRLAAVAGTST
CHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLSTHPAYTDLEHLSES
AGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSPIADNTMRAAIIGQSMD
NSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQCRNGLLMRLLADCTGL
PIIIPRYIDAAVVFGSALLGAVASESYNAHHT------------KTDLRKRRASSLGSKD
QAIAGLGK-----GGLSKLSELQT----------------------DQPSPYTAPHATSS
S----HMGGGSYFPIVGSDAAANLSPGEAIAETEDEEEPVTFKSVKSTTQENLAEKTDTN
S-------NGEELWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSA
IDRVEANL---KAQITK--
>TDEL0F03840
--------MRHRGQSRSSLSIAQQRFMSQSMAAISLE--QAMIYYVGVDVGTGSARACII
DNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKSVVRDSGVP--VERIHGIGF
DATCSLVVVD-DEDKEVGVGPVFANNDQNIVLWMDHRAIAETNEINATNDKCLKYVGGQM
SVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTRSFCSTVCKQGLIPIGVE
GSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTHSFLSAGEYVGALDEEAAEE
LGLPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTKKGIDRATGRLAAVAGTST
CHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGALLAHVMSTHPAFTELSHLSDA
ANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGNRSPIADPSMRAAIIGQSMD
NSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMSGGQCRNGLLMRLLADCTGL
PIIIPRYIDAAVVFGSALLGAVASESFNSHHA------------KSEITRRRKSSLTNLD
---PSSLPSASGKGPLSQLGKMKP----------------------DLPSPYTAPHATSS
TSQIAATSGSFPFPVVGESSEAI---TEEAND-SE--GPVSFKPTRATSQEGLATRNPPN
--------NGDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREA
IDKVEKAI---AK------
>KLLA0F19041g
--------MFGSRKSHSSLSISQQRLLSHSMSGLSLQNERKMVYYVGVDVGTGSARACVI
DNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKNVVRDSGVD--PRTIHGIGF
DATCSLVVVD-NNNEDVGVGPDFTDNLQNIILWMDHRAIEETEEINATGDKCLKYVGGQM
SVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIRSYCSTVCKQGLLPLGVE
GSKNGWSKEFLQEIGLEELIADDFAKLGGSVT-----ETT--FLSAGECIGTLTEESAAE
LGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRATGRLAAVAGTST
CHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTHPAYAELSQLSDA
ANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIADPSMRAAIIGQSMD
NSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNGLLMRLLADCTGL
PIVIPRYIDAAVVFGSALLGAVASESFNACAKLEETASDPATTSNKDVSIRRKSSLSRKD
AGIIGDGSRSRSGSAASGLGHGGGNTLKPLTSFAKAQKKTNDLKFADMPSPYTAPSATSS
TAQISTTG-GYPFPVMASNEEAIIDEMEEENE-DE--SLLTFDAKTEKSKEAATSAANHN
NAKVLRDVTKDKLWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKL
VDEVK--------------
>SAKL0H17160g
---------MHSRKSRSSLSISQQRLLSQSMSALSME-QNKMTYYVGVDVGTGSARACII
DNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKSVVKDSGVL--PEKIHGIGF
DATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETKEINATNDKCLKYVGGQM
SVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLETRSYCSTVCKQGLLPVGVE
SSKQGWSKEFLTNIGLEDLCQDDFRKLGGSIKSDGSGGST--FLSAGECIGSLDPSAAEE
LGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTGIDHATGRLAAVAGTST
CHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLTIHPAYTELSHLSDA
ASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRSPIADPSMRAAVIGQSMD
NSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGGQCRNGLLMRLLADCTGL
PIVIPRYIDAAVVFGSALLGAVASESFNLNHK------------SGSLSRRRKSSLSGKY
EEFKDSMEIPKK-NFLSKLGGTASG---------------------DLPSPYTAPSATAS
TSQIASTVGGFPFPVTSDDSVAI---IEEDDP-EEANAALSFGSKKATAQEQLALEKEKS
ASG-----KGDALWDVMYNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREA
VDKVENQR---QTIDPRWP
>KLTH0G13794g
---------MHSRRSRSSVSISQQRMMSRSMVGLSLE-QQKMLYYVGVDVGTGSARACII
DSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKSVVRDSGVP--AEKIHGIGF
DATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQLINATGDKCLKYVGGQM
SVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETRSFCSTVCKQGLLPVGVE
GSAEGWSREFLTEIGLEELIEDDFRRIGGSVK-NSDKGKN--FLSAGEFIGAIDATVAEE
LGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMDRATGRLAAVAGTST
CHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVLTTHPAYTELSQLADA
ASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIADPSMRAAIIGQSMD
NSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCRNGLLMRLLADCTGL
PIVIPRYIDAAVVFGSALLGAVASESFDLSGT------------HSALSVSRKSSIAGE-
---PANAGQPKK-SAVSKFGQLGGD---------------------DLPSPYTAPSATAS
TSQIASTI-GFPFP-TPEDAYAIDEHVEQEKD-EGESTELNFKAHSKWKKDMEDRMKGRS
-SD-----NGDAMWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTI
VDDAVRN------------
>Kwal_56.23607
---------MHSRKSRSSLSISQQRMMSRSMTGLSLE-QQKMLYYIGVDVGTGSARACII
DSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKSVVRDSGVP--SEKIHGIGF
DATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETEQINATGDKCLKYVGGQM
SVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETRSFCSTVCKQGLLPVGVE
GSKEGWSREFLTEIGLEDFIEDDFRKIGGSVK-NSDKGKN--FLSAGEFVGAIDPAVAEE
LGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMDRATGRLAAVAGTST
CHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVMTTHPAYTELSQLADA
ASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIADPSMRAAIIGQSMD
NSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCRNGLLMRLLADCTGL
PIVIPRYIDAAVVFGSALLGAVASESFDLSGT------------TSELSVSRKSSIAGH-
---PTDGSQPKK-SAVSKLGQFGSD---------------------DLPSPYTAPSATAS
TSQIASTV-GFPFP-TPDDPYALGEQTEPDAD-NDNSSELNFKAHSKWKKDMEDRMKGRS
-SD-----NGDAMWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNL
VNEVEKS------------