MUSCLE (3.8) multiple sequence alignment

KLLA0F18953g       -MSLQFSYEKYMNLIQYPEHWSNPIP--HEISKKVIYNTLSPCICVQSNLELDNHLKDMY
AGR096C            ----MLSYETYMNLVHYPEHWSQPVP--HEISRRVICNALSPCVSVQSTAALEAHLAEEF
Ecym_4316          ----MLSYEKYMNLLHYPDQWSQPVP--REISRKVICNALSPCISVQSTDALNQHLEEVF
TBLA0E04380        ---MPFSYENYMNLLFHLDRTNEEIP--TDIAKRIVQNSIAPLISVTATPELDKHVQDSY
KNAG0H03270        ---MAFSYEHYMNLLSHLECASETVP--PDIARRIVSHAVAPVITVTSSLALDDHIMESY
SAKL0H17226g       ---MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAY
KLTH0G13860g       ---MPLSFGKYMNLAFHLDSALEPVP--TEISRKIVSSAVSPVVTVTSTAALDEHIQESY
Kwal_56.23583      ---MPLSYERYMNLVSHLDSASEPVP--SEISRKIVSNAVSPVVTVTSSAALDKHIQESY
Kpol_392.11        MASLQFSYENYMNLVYHLDRVNEPVP--QDISKRIVSNAIAPVITVMSTSELDQHVQDSY
TPHA0B03260        ---MTFTYENYMNLIFHLDKVHENVP--QDISKRIVSNAIAPVITVTATVELDSHISEEY
KAFR0B05570        --MINFSYEHYMNLLFHLECSDENIP--SEIARRIVSHAIAPVITVTSTPELDKHIQDTY
CAGL0B01705g       ---MVFSYEHYMNLIYHLDDANETVP--SDIAKRVVSNAMAPVITVTSTVLLDRHIEETY
ZYRO0C01826g       ---MKLSYENYMNLLFHLDHGQETVP--PDIARRIVSNAVSPVITVSSTPELDRHIRDTY
TDEL0F03820        --MVKLSYENYMNLLLHLDHGDDRVP--ADIAKRIVSNAISPVICVTSTPELDRHIQETH
NDAI0J01410        ---MVFSYEHYMNLLFHLDHAKESVP--PEIAKRIVSNAIAPVITVTSTPQLDNHIQETY
NCAS0B03880        ---MNFSYEHYMNLLFHLDYGKETVP--SEIAKRIVSNAISPVIAVTSTSELDHHILETY
Suva_2.268         ---MVFSYEHYMNLLFHLDHSRETVP--PEIAKRIVSNAIAPVITVTSTPLFDKHIQEAY
Skud_4.369         ---MVFSYEHYMNLLFHLDNSEEIVP--PEIAKRIVSNAIAPVITVTSTPLFDKHIQETY
Smik_4.354         ---MVFSYEHYMNLLFHLDNSKETVP--PEIAKRIVSNAIAPVITVTSTPLFDKHIQEAY
YDR108W            ---MVFSYEHYMNLLFHLDNSKETVP--PEIAKRIISNAIAPVITVTSTPLFDKHIQETY
                        :::  ****  : :   : :.   :::..::  :::* : * :.  :: *: : .

KLLA0F18953g       NIDSISMLFRYFGDYIQDRDQIPS------------------------------------
AGR096C            SEGSLYMLLRYFADYVRERGE---------------------------------------
Ecym_4316          KIGSLYKLLRYFGDYIQDRDQLDD------------------------------------
TBLA0E04380        NIDSLYMLLRYFGGCISDRDQYHEPHHQHPNELDHKNELHAALISPDTSITETPDTSMDM
KNAG0H03270        KVQSAYLLFRLFGGCISDRDQLME------------------------------------
SAKL0H17226g       GLHSMYMLLRFFGDCVTDRDQENE------------------------------------
KLTH0G13860g       GVDSLYMLLRYFGDCVSDRDQAEA------------------------------------
Kwal_56.23583      GLDSLYMLLRYFGDCISDRDQADS------------------------------------
Kpol_392.11        NIDSLYLLMRYFGGCISDRDQANEYVKKANVENTAQE-------------GVNDQIIEEQ
TPHA0B03260        GIDSFYTLLRYFGGCISDRDQSNEYIKKTEDEQKSHA-------------LNKVNLTTIE
KAFR0B05570        SIDSLYMLLRFFGGCVSDRDQASE--SK----------------------ANAP------
CAGL0B01705g       GIDSLYMLLRFFGGCVSDRDQANE--VKLGTDG-----------------LKVT------
ZYRO0C01826g       HLDSLYMFLRFFGDCVSDRDQANEYQPLRSKEEPELV-------------AEPP------
TDEL0F03820        HLDSLYMLLRFFGDCVGDRDQAHECTSAGSPSGDDRA-------------EK--------
NDAI0J01410        NIDSLYMLLRYFGGCVSDRDQANELVGKQELDV-----------------THPT------
NCAS0B03880        NIDSLYMLLRFFSGCVSDRDQANELEKSQKDKISSNN-------------TLTL------
Suva_2.268         SVDSLYMLLRFFGGCVSDRDQANE--GKFEQDE-----------------Q---------
Skud_4.369         NVDSLYMLLRFFGGCVSDRDQANE--GKVGPNE-----------------HEVS------
Smik_4.354         KVDSLYMLLRFFGGCVSDRDQANE--VKVGQDE-----------------HQVG------
YDR108W            KVDSLYMLLRFFGGCVSDRDQANE--AKVGQHE-----------------HEVC------
                      *   ::* *.. : :*.:                                       

KLLA0F18953g       --TTDLKDPGSV------------------------------------------------
AGR096C            --------EVGS------------------------------------------------
Ecym_4316          --KISAKLQPNN------------------------------------------------
TBLA0E04380        LIDNSMNTLTKEETIISTTTGTPTPTILASPTTENTITKPHNKTTTIKKNTKEHYTTTHN
KNAG0H03270        --HYTLDDSSTG------------------------------------------------
SAKL0H17226g       --------TETN------------------------------------------------
KLTH0G13860g       --GPELGTESGK------------------------------------------------
Kwal_56.23583      --EQESGVEPNK------------------------------------------------
Kpol_392.11        RNSNTLELPKSE------------------------------------------------
TPHA0B03260        --ETKVKLNEDEKMEEELQSDQNVINPTNDPTVNNNYLDVDTKTDNLLPKSSQT------
KAFR0B05570        --HSSSSLTTTK---------------------T--------------------------
CAGL0B01705g       --EEGVE-NEKD---------------------GTNGLT--------VPRQ---------
ZYRO0C01826g       --SKADNLIENS---------------------RKSSLK--------VPSTSSDTKNTTT
TDEL0F03820        --SSSSTLAVAS------------------------------------------------
NDAI0J01410        --NPSNPVSSLI---------------------VPSGQQ--------QPPLKA-------
NCAS0B03880        --PTTSPLPKVR------------------------------------------------
Suva_2.268         --NASPSIESSS---------------------KNQNLG--------VPSALK-------
Skud_4.369         --DTSVSMESLS---------------------KNQNLG--------VPNALK-------
Smik_4.354         --DTNASMESFS---------------------KSKNLE--------VPNLPK-------
YDR108W            --DASDSTDSIP---------------------KNKNLE--------VPNLSK-------
                                                                               

KLLA0F18953g       ------SSGRHRSDSLFQRQA--SECVRFTRSLEDLISI--DSEDHILQSTDIDSFLSQY
AGR096C            ------VSGQRRPGSVYQRQT--SRYVRFQRPLEEVIETV-EQQAV--DFEDLEEALGQH
Ecym_4316          --------RRQRQNSLFQRNS--SRYIRFQTPLTDIISVG-DNHQV--EFNDLEESLSEF
TBLA0E04380        YTHHHRQKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTR-DPTDSLFDHQSLETLLKGY
KNAG0H03270        ------GRTRKRSNSLFQRDATQSQFIRFAQPLPDLLRSY-TEQQGLFDNDSLEWYLTHY
SAKL0H17226g       ------FKGRPRSNSLFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKY
KLTH0G13860g       ------NRNRARSNSLFQRQA--SHYLRFTRPLTDLIDVR-ESRDLLFDYHSLEVFLEKY
Kwal_56.23583      ------SRARSRSGSLFQRQA--SQFLRFTRPLSDIIGTR-ETRDLLFDYHSLEVFLQKY
Kpol_392.11        ------RYSRSRSNSLFQRDSTQSHYIRFTKPIEDLINSR-DSHDMLFDYHSLEVYLEKC
TPHA0B03260        ------TRNRSRSNSLFQRDSTQSQFIRFTRPIEDLLYSG-GTGDMLFDYHTLEIFLGSC
KAFR0B05570        ------TRARSRSNSLFQRDSTQSQYIRFTRPLPDLVERH-DKNDMLFDHHSLESYLRQY
CAGL0B01705g       ------TRVRSNSNSLYQRDATQSQYVRFTKPLADLINTQ-DANDMLFDYHSLEVYLQEY
ZYRO0C01826g       STSGTTGGTRKRSNSLFQRDQTQSQYVRFTRPIDDLIESS-DSNDMLFDYHSLEVFLENT
TDEL0F03820        ------GPSRKRSNSLFQRDATQSQYIRFTRPLRDLVESA-DTNDMLFDYHTLESFLENI
NDAI0J01410        ------RRGRSRSNSLFQRDSTQSQYIRFTKPIDDIVAIK-SSNDMLFDYHSLEIYLEQY
NCAS0B03880        ------TRGRSRSNSLFQRDSTQSQYIRFTKPLGDVIATK-NANDMLFDYHSLEIYLQNY
Suva_2.268         ------RGSRSRSNSLFQRDSTQSQYVRFTRPLGDLIETR-DTNDMLFNYHSLEVFLDNY
Skud_4.369         ------KGSRSRSNSLFQRDSTQSQYIRFTRPLGDLIETR-DTNDMLFNYHSLEVYLDNY
Smik_4.354         ------KGSRSRSNSLFQRDSTQSQYIRFTRPLDDLIETR-DTNDMLFNYHSLEVFLDNY
YDR108W            ------KGSRSRSNSLFQRDSTQSQYIRFTRPLGDLIETR-DANDMLFNYHSLEVFLDNY
                            . . .*::**:   *  :**  .: :::           :   ::  *   

KLLA0F18953g       LQNLEPIMNEN---------------------GTPSKLLKHSIYHRFFITL--SSINLSR
AGR096C            LRDIEARTTNE----------------------SPSELLKHSIFHKFITML--SSTALSP
Ecym_4316          LKDIEEHTVND----------------------SPCELLKHSIFHKFITML--SSTTLSP
TBLA0E04380        LKIIETNTTPD----------------------MPHNALKKSLYHRFFSMTVTSTTNLCP
KNAG0H03270        LSWIQKLTATDPEKVEQLPDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISP
SAKL0H17226g       LRLVDHRVSAN----------------------TPHRLLKHSIYHKFFTAAISSTAYLSP
KLTH0G13860g       LSLVEANTTSD----------------------TPHTLLQHSIYHKFFTTAISSTAHLSP
Kwal_56.23583      LELVDVKTSPD----------------------TPHTLLQHSIYHKFFTTAISSTAHLSP
Kpol_392.11        LSLIDKNTNDE----------------------TDHKALKMSLFHRFFSSAISSTTYLSP
TPHA0B03260        LKMVEKYTTDD----------------------IDHKTLQKSLYHRFFSSAISSTNCLSP
KAFR0B05570        LELVEKFTFDS----------------------TSHQLLKKSLYHNFFSLAISSTTTLSP
CAGL0B01705g       LSVVDKKFSPH----------------------IPHHLLKTSIYHSFFALAISSTSKLSP
ZYRO0C01826g       LRLVEEYTDDN----------------------TPFELLKKSLYHKFFSLAISSTTYLSP
TDEL0F03820        LLLIEKSTNDK----------------------TPHKLLKKSLYHRFFSLAISSTAYLSP
NDAI0J01410        LQLIATNTNNS----------------------TPYELLKNSIYHNFFSLAISSTTQLSP
NCAS0B03880        LDLIQKNTDDN----------------------TPYELLKKSIYHSFFSLAISSTTILSP
Suva_2.268         LKLVAGNTDEK----------------------VPHDLLKKSIYHSFFSLAISSTNNLSP
Skud_4.369         LKLVTENTNET----------------------APHDLLKKSIYHSFFSLAISSTNNLSP
Smik_4.354         LKLVADNTDEM----------------------VPHDLLKKSIYHSFFSLAISSTNNLSP
YDR108W            LKLVAANTDEM----------------------VPHNLLKKSIYHSFFSLAISSTNNLSP
                   *  :                                  *. :::* *:     *:  :. 

KLLA0F18953g       YHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLE---NFPEFININDILPVFVL
AGR096C            YHTVNHPIMALLALDVTQGEEYTLARELLVQFKNLPSKSS---KFPSYINTNDVLPVFIL
Ecym_4316          YHSFNHPILALLALDITQGEEYELARELLMEFKNLPNTLS---KFPAFINTNDVLPVFIL
TBLA0E04380        FESFDHPIVSLLSIDLTLNQNYDTAKEMLIKFKNIHSKTP---NFPVYLNINDILPVFLL
KNAG0H03270        FETFNVPVMNLIAIDVSRGQDYEVVRDLVTTFKNLNKFLE---DFPVFINVNDILPMIVL
SAKL0H17226g       YESFNHPVMSLLALDISRGDTYENARDLLIRFKNMNSATKSAASFPTFININDILPVFLL
KLTH0G13860g       YESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTTP---HFPAFINVNDILPVFLL
Kwal_56.23583      YECFNHPVCSLLALDISQNEGYEDARDLLVTFKNMHNKTP---HFPSFINVNDILPVFLL
Kpol_392.11        YESFNHPLISLVALDISKGQNYEDARDLLIKFKNQNNAVE---EFPPFMSTNDILLVFLL
TPHA0B03260        YESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTIN---NFPIFMSTNDILPVFVL
KAFR0B05570        FESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTID---KFPIYINTYDMLPVFLL
CAGL0B01705g       FECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIP---SFPSFINTNDILPVFLL
ZYRO0C01826g       YETFNHPVVSLIAIDISAGQGYEEARDLLIKFKNLNHTVE---NFPIFMSTGDILPVFLL
TDEL0F03820        YETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTK---NFPVFLNTNDVLPVFLL
NDAI0J01410        YETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNLNTTTP---NFPIFMNTNDMLPIFLL
NCAS0B03880        YECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTH---NFPIFMNTNDMLPVVLL
Suva_2.268         YETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTE---SFPIFMNTNEMLPVFLL
Skud_4.369         YETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNTE---NFPIFMNTNEMLPVFLI
Smik_4.354         YETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNTE---NFPLFMNTNEMLPVFLL
YDR108W            YETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNTE---NFPIFMNTNEMLPVFLL
                   :  .  *:  *:.:*:. .: *      :  **.          ** ::.  ::* :.::

KLLA0F18953g       CYDENSREQWESVQALTKSLKKQLFVESVSISLF-TPH--D-NQKSTTLHSPITVSLHEQ
AGR096C            CFDESSSEQWETVQALQKAIKKQLFVESVPLPIF-TNY----ESDPVVLHPPITNSLQEQ
Ecym_4316          CFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIF-TNF----RDRSIVLHPPITNSLQEQ
TBLA0E04380        CYDASSPEQLDIAKKISTKIKKQLFFESILLPLWNDKI-YN-NDKFVKLHEPMMSSVDET
KNAG0H03270        CYDAADETQLATCEQLQRKIKKCLFVDSIPLALWDED---P-ESPLVPLHEPIMSSLDEI
SAKL0H17226g       CYNDSSHEQFEACQSLAKMLKKQLFVESILLPLWRDSEDYDAEEPRRILHPPIMSSLEEM
KLTH0G13860g       CYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAG-ASPSRILHQPIMSSLEET
Kwal_56.23583      CYEEGSREQFETCQSLAKMMKKQLFVESLLLPCWSVNFTAK-DTPTRVLHQPIMSSLEET
Kpol_392.11        CYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSH--S-EDVQVELHQPAMSSLDEM
TPHA0B03260        CYNGSSAEESEKSTELSKKIKKQLFAECIRMPLWDKRY--S-DDITVKLHQPAMSSLDEM
KAFR0B05570        CYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSY--Q-TEPFIKLHQPVMSSLDEM
CAGL0B01705g       CYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEF--T-DNLVVSLHQPVMSSIEEI
ZYRO0C01826g       CYNDESEDEQNACQQLANQLKKQLFVESLLLPLWKRSY--S-DHGEVELHQPIMSSLEEM
TDEL0F03820        CYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNY--K-TATQVILHQPIMTSLDEV
NDAI0J01410        CYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQY--E-IDIKVDLHQPIMSSLEEM
NCAS0B03880        CYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSY--P-SDPQVHLHQPVMSSLEEM
Suva_2.268         CYNDESQEEFEKCQALAKKLKKQLFVESILLPLWKDSFVDV-ENSNIQLHQPVMSSLEEI
Skud_4.369         CYNDESQEEFEKCQALAKKLKKQLFVESIFLPLWKESFIDD-ENSSIKLHQPVMSSLEEI
Smik_4.354         CYNDESQEEFEKCQALAKKLKKQLFVESVLLSLWKDSFIEA-NNSAIQLHQPVMSSLEEI
YDR108W            CYNDDSQEEFEKCQALAKKLKKQLFVESILLALWKDSFIYD-ENSVIQLHQPVMSSLEEI
                   *::     :      :   :** ** : : :. :              ** *   *: * 

KLLA0F18953g       VFNM---------------SHP-------------TSINIPSRLLTHIYDTISFIVEEMM
AGR096C            VYDG---------------SHP-------------PLLRLCPQLVDVIYETINAMVEDLM
Ecym_4316          LYDS---------------SHP-------------VSLKLCPRLVKLIYDTINSMVEDLM
TBLA0E04380        LYFL---------------QQYLQKNSCV------TDNKLPLSLVKYIYEMIANLSVNLI
KNAG0H03270        VKFY---------------SSNSSAGGDEVGTDGHSRAALPLNIITHMYQALDVLVDEML
SAKL0H17226g       LYFLDLEAPGKDNISYTGSSNPI------------SSFELPLALVETIYDRLNLLITELM
KLTH0G13860g       MYSM---------------MKE-------------STITLPLSLINYIYDRLTNLIDELM
Kwal_56.23583      MFSM---------------LKD-------------SAFDLPLPFIEHIYDRLTKLVDELM
Kpol_392.11        LYFF---------------ERP-------------SVHELPLNLINTIYDLMEKLVVDLM
TPHA0B03260        LYVF---------------QTS-------------KTDKLPLTLINLIYDQLEILTNDLM
KAFR0B05570        IYFL---------------QSD-------------EQNTLPIELTNTTYDMLEKLVYALL
CAGL0B01705g       MFFL---------------QNP-------------VDHKLPLKLVNCIYDQIDMIVYDLM
ZYRO0C01826g       LYFL---------------QSP-------------TPTRLPLQLINVTYNILEKLVKDLM
TDEL0F03820        LYFL---------------REP-------------SRIELSLELINSIYDVLEILINGLM
NDAI0J01410        IYFL---------------QTP-------------FSAKLSISLINSIYNILDSLIYDLM
NCAS0B03880        IYFL---------------NQP-------------KEVTLPYELIQSIYNILDSLVYNLM
Suva_2.268         LFFL---------------RAP-------------TQTKLSLPLINSIYDMLDYLVYDLM
Skud_4.369         LFFL---------------QAP-------------TQTTLSLPLINSIYDILDYLVYDLM
Smik_4.354         LFFL---------------QAP-------------TQTSLSLPLINSIYDMLDYLVYDLM
YDR108W            LFFL---------------QAP-------------TQTTLSLALINSIYDMLDYLVYDLM
                   :                                      :   :    *: :  :   ::

KLLA0F18953g       IPFMHRKLVFWDETVLQPRKSIFQS-NKFFRRFISPKSNHPIA--------------HKV
AGR096C            IPFMNRKISFWDETILQPRKSIFHG-NKFLKRFMNKTNS------------------SAA
Ecym_4316          IPFMNRKISFWDETILQPRKSIFHS-NKLLKRFISKSSG------------------SPT
TBLA0E04380        IPFMQRKIRFWDETILQPRKSIFR--NKLFKSFMNRNSNVSSSTGTSSSEISNSISKHHH
KNAG0H03270        IPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKTTT---------------------
SAKL0H17226g       IPFMKRKISFWEETILQPRKSIFLN-AKFLRRFVSKSAPATPA--------------API
KLTH0G13860g       IPFMKRKISFWDESILQPRKSIFPN-SKFFRKLISKTP--APP--------------PAS
Kwal_56.23583      IPFMKRKISFWEESILQPRRSIFPN-SKFFRKLISKAP--TPS--------------TNN
Kpol_392.11        IPFMQRKISFWEETILQPRKSLFHG-NKLFRKFMNRSSS-QTA--------------NQY
TPHA0B03260        IPFMQRKITFWEETILQPKKSLFQG-TKLFRKFMGRPSM-TNG--------------RQE
KAFR0B05570        IPFMQRKIAFWEETVLQPKKSIFHG-SKFLKKLMSRAST-SSH--------------QQQ
CAGL0B01705g       KPFMKRKMTFWEETILTPRKSLFHG-AKFFKKFMNKST--QAL--------------SQP
ZYRO0C01826g       VPFMKRKISFWEETILQPRKSLFHG-ANFFKKLMSKNSNGSNN--------------HQP
TDEL0F03820        IPFMQRKISFWEETILQPRRSLFHG-SKFLKRFMSKTTSGTNI--------------HQQ
NDAI0J01410        LPFMKRKLLFWEETILQPRRSLFHG-AKFLKKFMTKN---NNG--------------PQE
NCAS0B03880        IPFMKRKIAFWDETILQPRKSLFHG-AKFLKKFMTKTAL---T--------------HQE
Suva_2.268         IPFMKRKISFWEETILQPRKSLFNG-AKFFKKFMNKAPV-NGN--------------HQH
Skud_4.369         IPFMKRKVSFWEETILQPRKSLFNG-AKFFKKFMNKNPA-NGS--------------HQH
Smik_4.354         IPFMKRKVSFWEETILQPRKSLFNG-AKFFKKFMNKNPS-NGN--------------HHH
YDR108W            IPFMKRKVSFWEETILQPRKSLFNG-AKFFKKFMNKNPV-NGN--------------HQH
                    ***:**  :*:*.:* *..*:*    :::. ::                          

KLLA0F18953g       NDPQDPA-EGDIMFPASSPEFLLRKLADWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPC
AGR096C            GTLSTSS-DG--YFLASSNEFLLRKLADWSFMLSDYKTAYSIYYILLRDFELYPQYLSSC
Ecym_4316          ASMPTSP-DGH--FLASSNEFLLRKLADWCFMLSDYKTAYSIYEILIRDFENYPLYMSSC
TBLA0E04380        SLLTKDS-NGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYMASC
KNAG0H03270        ---QRDP-SDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASC
SAKL0H17226g       NSKSDGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPC
KLTH0G13860g       DSATHSQ-QGVAYFAATSNEFILRKLADWSFMLSDFKNAYSTYELLSKDFEQRPEYLASC
Kwal_56.23583      DSATHSE-QGLAYFAATSNELLLRKLADWSFMLSDFKTAYSTYELLSKDFEQHPEYLAPC
Kpol_392.11        NNIVKDS-RGNEYFTSSSPEFLLRKLADWSMMISDFKTAYSTYETLISDLEAHPKYLASC
TPHA0B03260        NIPIKDN-QGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFESLLEDIEMYPKYLASC
KAFR0B05570        NILTKDH-DGNEYFASSSPELLLRKLADWSIMLSDFKTGYATYEILSHDLELFPKYLASC
CAGL0B01705g       NSLLKEN-HGSNYLSSTSPEFLMRKLADWSMMVSDFKTAYTTYESLCQDFERMPKYLASC
ZYRO0C01826g       ISLGKDK-NGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASC
TDEL0F03820        ASIAKDA-NGKEYFVSSSAEFLMRKLADWSMMLSDYKTAYSTYDSLSHDLEHYPKYLASC
NDAI0J01410        NILTKDS-EGNEYFAFSSTELLMRKLADWSMMISDFKTAYSTYESLSRDLDTFPKYLASC
NCAS0B03880        NLLTKDA-QGNEYFTSASSEFLMRKLADWSMMLSDFKTAYATYESLTHDLESFPKYSASC
Suva_2.268         NSLTKDN-QGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASC
Skud_4.369         NSLTRDR-QGNEYFSSSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASC
Smik_4.354         NSLTSDN-QGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASC
YDR108W            NSLTRDS-QGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASC
                                :   *    :******.:*:**:...*  :  *  *::    * :.*

KLLA0F18953g       LEYKTISLLMGAQNIITAKTIKTEVDPLMTRAIEQYK-----------------------
AGR096C            QEFSALSLLMGAHSIVTTKMIKNDIDPLIMKYMDS-------------------------
Ecym_4316          QEFSALSLLMGAHSIVTAKMIKNDIDPLIMKYLD--------------------------
TBLA0E04380        LEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVPNSRLPSNNINSLNSRS
KNAG0H03270        LEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATYRQQGR-------------------
SAKL0H17226g       LEWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASK------------------
KLTH0G13860g       LEWCALSVLMGAQSIVTVKMIKNDIDPLINRALKSYELSARKAKEKNAQLKSSALAKKAE
Kwal_56.23583      LEWCALSVLMGAQSIVTVKMIKNDIDPLITRALKSYELCASKAKERNGLLKSKLQNRDHD
Kpol_392.11        LEWCAISILMGAQNIVTAKMIKNDVNPLIERSLDTYEQCSI-------------------
TPHA0B03260        LEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCA--------------------
KAFR0B05570        LEWEAVSLLMGAQNIVTVKMMKNDISPLIDRALDAYDACAANTH----------------
CAGL0B01705g       SEWCAVSLLMGAQNIVTAKMLKNEINPAIERALGAYELCAT-------------------
ZYRO0C01826g       FEWCAVSVLMGAQNIVTVKMIKNDIDPLIQRALETYENCA--------------------
TDEL0F03820        LEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAVETYENCA--------------------
NDAI0J01410        LEWCATSLLMGAQSIVTVKMIKNDINPLIERALQTYENCAIT------------------
NCAS0B03880        LEWCAVSLLMGAQNIVTVKMLKNDINPLIEKALSTYENCAT-------------------
Suva_2.268         IEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYENCSR-------------------
Skud_4.369         IEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYEKCSQ-------------------
Smik_4.354         IEWCAVSLLMGAQRIVTVKMIKNDINPLIEKALATYENCSK-------------------
YDR108W            IEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYENCSR-------------------
                    *: : .:*:**: *:*.* :*.:: * :   :                           

KLLA0F18953g       -------------------------KQDEKHSLRVI--HCILTFSDLLLSLSDTWVSSPL
AGR096C            -------------------------TVASLNYLGKF--RCLVYMAELFLSLSDTWTSAPF
Ecym_4316          --------------------------YAVNNIISLDQIRCMIYMTELFLSLSDTWTSAPF
TBLA0E04380        S----ISSATKAEVS----------LIENNHTIRSYEIRCMLLLSELFLSLSDTWTSTPY
KNAG0H03270        ---------------------------------SSYETRCMILSAELFLALRDTWTSTPY
SAKL0H17226g       -----LTSPHVAEAD----------SPVDSKPAQSYETRCMLLSAELFLSLSDTWTATPY
KLTH0G13860g       KDSKSATLPSTVSDEHSGQELDEGVSSAPSQSAQSYETRCMLLAAELFLSLSDTWTATPY
Kwal_56.23583      KSLNGFETISNSHDDRVSGTTDFEISSTPSQSAQSYETRCMLLAAELFLSLSDTWTATPY
Kpol_392.11        -----LAQNSLEN------------DELLSEPVRSYETRCMLLTSELFLSLNDTWTSTPY
TPHA0B03260        -----LLLNSIAESE----------ESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPY
KAFR0B05570        -----LSNKKIGPTN----------ESTSLEPVLSYETRCLILSSELFLSLSDTWTSTPY
CAGL0B01705g       -----ESNAHRKFGD----------SDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPF
ZYRO0C01826g       ---------ADEDST----------GEELYVPVRSYETRCMFLASELFLSLSDTWTSTPY
TDEL0F03820        -----LYDTQLSGSK----------KSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPY
NDAI0J01410        -----LIQDTTNKVF----------AEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPY
NCAS0B03880        -----VLPETDKRNT----------DELIVVPVRSYETRCMILASELFLSLSDTWTSTPY
Suva_2.268         -----MQRRNSKELT----------SSGVLEPVRSYETRCMILASELFLSLSDTWTSTPY
Skud_4.369         -----IQRHKGKELS----------SSSVTEPVRSYETRCMILASELFLSLSDTWTSTPY
Smik_4.354         -----IQRSKSEKSS----------SSNTVEPVRSYETRCMILASELFLSLSDKWTSTPY
YDR108W            -----IQRGKGKESN----------SLDVTEPVRSYETRCMILASELFLSLSNTWTSTPY
                                                         .*:.  ::*:*:* :.*.::* 

KLLA0F18953g       AVNYLTYIQ-KSH-LLGPYATVIILERIAYAYEICIDLRVND------------------
AGR096C            AIKYLELILQNEQLKLGPLSRTMLWERISYAYQLRIDPRIHT------------------
Ecym_4316          AIKYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIHA------------------
TBLA0E04380        ALRYLETIL-SDY-KLGPCSQTILWERLSFCYDLRVDPRIKR------------------
KNAG0H03270        AIRYLETIL-RDCPQLGACSQVMIWERLSDCYQSRTDPRV--------------------
SAKL0H17226g       AIKYLETIL-QNC-PLGPKSQVLLWEKLAYCYELRVDPRVSHIHAKQRHLQYEREEVISK
KLTH0G13860g       AIKYLETIL-DEC-TLGSLSEIVLWERLAYCYALRVDPRVKG------------------
Kwal_56.23583      AIKYLETIL-DQC-TVGALSEIVIWERLAYCYALRVDPRVKS------------------
Kpol_392.11        ALSNLETIL-AEC-KLGICSQIMIWERLSDCYNMRTDPRIRH------------------
TPHA0B03260        ALSNLETIL-SEC-KLGACSQIMIWERLSDCYNLRTDPRVKH------------------
KAFR0B05570        AINYLESIL-EES-RLGPCSRIMIWERLSDCYDLRVDPRIKS------------------
CAGL0B01705g       AIAYLETIL-NEC-KLGPLSEIMIWERLSDCYGMRIDPRIKH------------------
ZYRO0C01826g       ALNSLETIL-TEC-RLGPCSEIMIWERLSDCYYQRIDPRIRH------------------
TDEL0F03820        ALRNLETIL-AEC-RLGPCSQIMIWERLSNCYQQRIDHRIRH------------------
NDAI0J01410        AITYLETIL-TEC-KLGPCSQIQIWERLSDCYKLRIDPRIRY------------------
NCAS0B03880        AISYLETIL-VEC-KLGACSQIMIWERLSDCYELRVDPRIKH------------------
Suva_2.268         AIQYLETIL-DEC-KLGPCSQIMVWERLSDCYNLRVDPRVKH------------------
Skud_4.369         AIQYLETIL-DEC-KLGPCSQIMIWERLSDCYNLRVDPRIKH------------------
Smik_4.354         AIQYLETIL-DEC-KLGPCCQIMIWERLSDCYSLRVDPRIKH------------------
YDR108W            AIQYLETIL-DEC-KLGPCSQIMVWERLSDCYNLRVDPRIKH------------------
                   *:  *  *   .   :*  .   : *.:: .*    * *:                    

KLLA0F18953g       -------HFLPKPDEENKADESEAAENSKKGENGLEVDDM----------------HEW-
AGR096C            -------------------------DDEYLSDNFMELTTE----------------DDFC
Ecym_4316          -------------------------DDDSTSDCDHDLEEE----------------LY--
TBLA0E04380        -------KPTITNINKGTKATGSEASHSSIKEVNEKYRNDGKQEKYSIDRKNSLIIDV--
KNAG0H03270        --------------------------ASALSTNTSPGSAQ----------------PG--
SAKL0H17226g       SNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEALSNR----------------EK--
KLTH0G13860g       -------KLPSLDGQSG---------QNEKRGEESEGSDE----------------SD--
Kwal_56.23583      -------RLTASEIQSSD--------QNEKLDEESEGSDN----------------DS--
Kpol_392.11        -------RV----------------------ETVTKIENN----------------EG--
TPHA0B03260        -------KLR----------------SNISTSSVSEVSEE----------------EI--
KAFR0B05570        -------KVEQ---------------VQKQDNLEEPADNE----------------HRIL
CAGL0B01705g       -------RIGN---------------LELLQKKEENMDDP--------------------
ZYRO0C01826g       -------KTS----------------AQGAKAMTDELAPD----------------EE--
TDEL0F03820        -------KV-----------------NDGAMSNEEKVENE----------------DD--
NDAI0J01410        -------KINDTATTTTTVTTTT---ADKVVATPSTDKPK----------------TI--
NCAS0B03880        -------KAAGTIANTSSPKKSSESDMQGHVMTPSPLTKE----------------DV--
Suva_2.268         -------KVGG---------------MKKSVKNTEDLRND----------------DE--
Skud_4.369         -------RVGV---------------MKKSFKETEDLRNG----------------DE--
Smik_4.354         -------RVGA---------------MKKGIRDTEDLRGG----------------DG--
YDR108W            -------RVGA---------------MKKDAKDTEDLRGE----------------HK--
                                                                               

KLLA0F18953g       RNENKLIQ-----NNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAKWCIYHAAPAYEK
AGR096C            MNPNKLHH-----WRIHSLGLTRHRKEAVFRLLAAKKWLEYGHIRQGAWSLKGCNKVYRN
Ecym_4316          LNPHKLHC-----GKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRD
TBLA0E04380        NSNEEYDCG----YDILSDGFTRKRKAAFFKLIAAKKWSEQKQWRQLDWCLKDIENVYKE
KNAG0H03270        -------------NEILAQGFTRKRKAAFFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTA
SAKL0H17226g       EHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDVDTVYSG
KLTH0G13860g       DETQKYDHKISQ-NCMASLGLARRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSE
Kwal_56.23583      GDESQVCQHKMSQSCIASSGLTRKRKATLFRLIATKKWTESKQWRQACWSFQDLEVMYSH
Kpol_392.11        GQQLQT-------DDIVSKGLARKRKAAFFRLLAAKKWAEQKQWRQVSWCLRDVEYIYDD
TPHA0B03260        KKQDV--------SSIVLKGLTRQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQD
KAFR0B05570        NSQDDLNP-----SNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSR
CAGL0B01705g       KNADVFTT-----EDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSD
ZYRO0C01826g       SN-----------EEIVTRGLTRKRKAAFFRLIAANKWVEQKQWKQAFWCLKEIEEAYAG
TDEL0F03820        SEKEHTH------ADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAG
NDAI0J01410        QWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVAWCLKDMESIYDA
NCAS0B03880        SNDANNDTD----QDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSIDDTYSK
Suva_2.268         YDTDHFTE-----EDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSD
Skud_4.369         HYTDHFIE-----EDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSE
Smik_4.354         NSTDHFTD-----DDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSD
YDR108W            YSTDHFTD-----EDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSE
                                  :   *::* ** :.:.*:*:. * :  . .:  * :      *  

KLLA0F18953g       LSLSKRPDGLFHRLSMELS-----------------------------------------
AGR096C            LGFANADGTLLSRLVDMVVHEETVQSLAEHRNH---------------------------
Ecym_4316          LPFANAEGTLLSRLADAVVDSENSQRAN--------------------------------
TBLA0E04380        VGFSDRKDLILIKLKDQLNKYYIKNNIKCTKEDSRSIDMELDSKITQDVQASPATATVKT
KNAG0H03270        SALYDKKGLLIDRLNTEVQSFSM-------------------------------------
SAKL0H17226g       LVFSYRKGLILERLVGEIEANMHA------------------------------------
KLTH0G13860g       LDFANRDDLILEKLRKKIHEHEPLPQKLNTSFIST-------------------------
Kwal_56.23583      LVFANREDLILKKLEKRIAQHSSIS-----------------------------------
Kpol_392.11        LSFSKRPELIYQKLKDELNEERQGNKKQ--------------------------------
TPHA0B03260        TVFGKRESLIYQKLKRNLLENSKK------------------------------------
KAFR0B05570        VGLVNRDDLILTRLREEYNIAVSDSK----------------------------------
CAGL0B01705g       LKCFNKENLLYTRLRNELIAARQDM-----------------------------------
ZYRO0C01826g       LDFVNREDLILARLKRQMNEAQNNVDESSNQTVESGAA----------------------
TDEL0F03820        IEFVNRKDLALAKLKETLKNVEIDSRTIAPPKDQVHVEEKVITD----------------
NDAI0J01410        TDLGKRDDLIVAKLRNLLDENIGGDDGNFKLKDEKLSADHIEVSS---------------
NCAS0B03880        IGLADRDDLILKKIQNKLKTAETETIDAGAEKNAEVSHHEVDSPN---------------
Suva_2.268         IDFLHGNGLILSNLKNQLNSKDVDSAPTPTEKNPTKTSINYIE-----------------
Skud_4.369         IKFLHCNDSILSKLKSQLNLKDLDSAPGPTEKNPTTTSINFIE-----------------
Smik_4.354         IKFLNGDGLILSKLHNQLNLKDLNSAPSPTEKNPTMTSVSFIG-----------------
YDR108W            IKFLHGNGLILSKLKNQLNLKDVDSAPRPSEKNLTRTSVSFIG-----------------
                               .:                                              

KLLA0F18953g       ---------------------------------
AGR096C            ---------------------------------
Ecym_4316          ---------------------------------
TBLA0E04380        SVGSTDTSNTNLINDSQANSLQSSKIDHEITFP
KNAG0H03270        ---------------------------------
SAKL0H17226g       ---------------------------------
KLTH0G13860g       ---------------------------------
Kwal_56.23583      ---------------------------------
Kpol_392.11        ---------------------------------
TPHA0B03260        ---------------------------------
KAFR0B05570        ---------------------------------
CAGL0B01705g       ---------------------------------
ZYRO0C01826g       ---------------------------------
TDEL0F03820        ---------------------------------
NDAI0J01410        ---------------------------------
NCAS0B03880        ---------------------------------
Suva_2.268         ---------------------------------
Skud_4.369         ---------------------------------
Smik_4.354         ---------------------------------
YDR108W            ---------------------------------
                                                    

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0F18953g
-MSLQFSYEKYMNLIQYPEHWSNPIP--HEISKKVIYNTLSPCICVQSNLELDNHLKDMY
NIDSISMLFRYFGDYIQDRDQIPS------------------------------------
--TTDLKDPGSV------------------------------------------------
------SSGRHRSDSLFQRQA--SECVRFTRSLEDLISI--DSEDHILQSTDIDSFLSQY
LQNLEPIMNEN---------------------GTPSKLLKHSIYHRFFITL--SSINLSR
YHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLE---NFPEFININDILPVFVL
CYDENSREQWESVQALTKSLKKQLFVESVSISLF-TPH--D-NQKSTTLHSPITVSLHEQ
VFNM---------------SHP-------------TSINIPSRLLTHIYDTISFIVEEMM
IPFMHRKLVFWDETVLQPRKSIFQS-NKFFRRFISPKSNHPIA--------------HKV
NDPQDPA-EGDIMFPASSPEFLLRKLADWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPC
LEYKTISLLMGAQNIITAKTIKTEVDPLMTRAIEQYK-----------------------
-------------------------KQDEKHSLRVI--HCILTFSDLLLSLSDTWVSSPL
AVNYLTYIQ-KSH-LLGPYATVIILERIAYAYEICIDLRVND------------------
-------HFLPKPDEENKADESEAAENSKKGENGLEVDDM----------------HEW-
RNENKLIQ-----NNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAKWCIYHAAPAYEK
LSLSKRPDGLFHRLSMELS-----------------------------------------
---------------------------------
>AGR096C
----MLSYETYMNLVHYPEHWSQPVP--HEISRRVICNALSPCVSVQSTAALEAHLAEEF
SEGSLYMLLRYFADYVRERGE---------------------------------------
--------EVGS------------------------------------------------
------VSGQRRPGSVYQRQT--SRYVRFQRPLEEVIETV-EQQAV--DFEDLEEALGQH
LRDIEARTTNE----------------------SPSELLKHSIFHKFITML--SSTALSP
YHTVNHPIMALLALDVTQGEEYTLARELLVQFKNLPSKSS---KFPSYINTNDVLPVFIL
CFDESSSEQWETVQALQKAIKKQLFVESVPLPIF-TNY----ESDPVVLHPPITNSLQEQ
VYDG---------------SHP-------------PLLRLCPQLVDVIYETINAMVEDLM
IPFMNRKISFWDETILQPRKSIFHG-NKFLKRFMNKTNS------------------SAA
GTLSTSS-DG--YFLASSNEFLLRKLADWSFMLSDYKTAYSIYYILLRDFELYPQYLSSC
QEFSALSLLMGAHSIVTTKMIKNDIDPLIMKYMDS-------------------------
-------------------------TVASLNYLGKF--RCLVYMAELFLSLSDTWTSAPF
AIKYLELILQNEQLKLGPLSRTMLWERISYAYQLRIDPRIHT------------------
-------------------------DDEYLSDNFMELTTE----------------DDFC
MNPNKLHH-----WRIHSLGLTRHRKEAVFRLLAAKKWLEYGHIRQGAWSLKGCNKVYRN
LGFANADGTLLSRLVDMVVHEETVQSLAEHRNH---------------------------
---------------------------------
>Ecym_4316
----MLSYEKYMNLLHYPDQWSQPVP--REISRKVICNALSPCISVQSTDALNQHLEEVF
KIGSLYKLLRYFGDYIQDRDQLDD------------------------------------
--KISAKLQPNN------------------------------------------------
--------RRQRQNSLFQRNS--SRYIRFQTPLTDIISVG-DNHQV--EFNDLEESLSEF
LKDIEEHTVND----------------------SPCELLKHSIFHKFITML--SSTTLSP
YHSFNHPILALLALDITQGEEYELARELLMEFKNLPNTLS---KFPAFINTNDVLPVFIL
CFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIF-TNF----RDRSIVLHPPITNSLQEQ
LYDS---------------SHP-------------VSLKLCPRLVKLIYDTINSMVEDLM
IPFMNRKISFWDETILQPRKSIFHS-NKLLKRFISKSSG------------------SPT
ASMPTSP-DGH--FLASSNEFLLRKLADWCFMLSDYKTAYSIYEILIRDFENYPLYMSSC
QEFSALSLLMGAHSIVTAKMIKNDIDPLIMKYLD--------------------------
--------------------------YAVNNIISLDQIRCMIYMTELFLSLSDTWTSAPF
AIKYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIHA------------------
-------------------------DDDSTSDCDHDLEEE----------------LY--
LNPHKLHC-----GKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRD
LPFANAEGTLLSRLADAVVDSENSQRAN--------------------------------
---------------------------------
>TBLA0E04380
---MPFSYENYMNLLFHLDRTNEEIP--TDIAKRIVQNSIAPLISVTATPELDKHVQDSY
NIDSLYMLLRYFGGCISDRDQYHEPHHQHPNELDHKNELHAALISPDTSITETPDTSMDM
LIDNSMNTLTKEETIISTTTGTPTPTILASPTTENTITKPHNKTTTIKKNTKEHYTTTHN
YTHHHRQKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTR-DPTDSLFDHQSLETLLKGY
LKIIETNTTPD----------------------MPHNALKKSLYHRFFSMTVTSTTNLCP
FESFDHPIVSLLSIDLTLNQNYDTAKEMLIKFKNIHSKTP---NFPVYLNINDILPVFLL
CYDASSPEQLDIAKKISTKIKKQLFFESILLPLWNDKI-YN-NDKFVKLHEPMMSSVDET
LYFL---------------QQYLQKNSCV------TDNKLPLSLVKYIYEMIANLSVNLI
IPFMQRKIRFWDETILQPRKSIFR--NKLFKSFMNRNSNVSSSTGTSSSEISNSISKHHH
SLLTKDS-NGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYMASC
LEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVPNSRLPSNNINSLNSRS
S----ISSATKAEVS----------LIENNHTIRSYEIRCMLLLSELFLSLSDTWTSTPY
ALRYLETIL-SDY-KLGPCSQTILWERLSFCYDLRVDPRIKR------------------
-------KPTITNINKGTKATGSEASHSSIKEVNEKYRNDGKQEKYSIDRKNSLIIDV--
NSNEEYDCG----YDILSDGFTRKRKAAFFKLIAAKKWSEQKQWRQLDWCLKDIENVYKE
VGFSDRKDLILIKLKDQLNKYYIKNNIKCTKEDSRSIDMELDSKITQDVQASPATATVKT
SVGSTDTSNTNLINDSQANSLQSSKIDHEITFP
>KNAG0H03270
---MAFSYEHYMNLLSHLECASETVP--PDIARRIVSHAVAPVITVTSSLALDDHIMESY
KVQSAYLLFRLFGGCISDRDQLME------------------------------------
--HYTLDDSSTG------------------------------------------------
------GRTRKRSNSLFQRDATQSQFIRFAQPLPDLLRSY-TEQQGLFDNDSLEWYLTHY
LSWIQKLTATDPEKVEQLPDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISP
FETFNVPVMNLIAIDVSRGQDYEVVRDLVTTFKNLNKFLE---DFPVFINVNDILPMIVL
CYDAADETQLATCEQLQRKIKKCLFVDSIPLALWDED---P-ESPLVPLHEPIMSSLDEI
VKFY---------------SSNSSAGGDEVGTDGHSRAALPLNIITHMYQALDVLVDEML
IPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKTTT---------------------
---QRDP-SDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASC
LEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATYRQQGR-------------------
---------------------------------SSYETRCMILSAELFLALRDTWTSTPY
AIRYLETIL-RDCPQLGACSQVMIWERLSDCYQSRTDPRV--------------------
--------------------------ASALSTNTSPGSAQ----------------PG--
-------------NEILAQGFTRKRKAAFFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTA
SALYDKKGLLIDRLNTEVQSFSM-------------------------------------
---------------------------------
>SAKL0H17226g
---MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAY
GLHSMYMLLRFFGDCVTDRDQENE------------------------------------
--------TETN------------------------------------------------
------FKGRPRSNSLFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKY
LRLVDHRVSAN----------------------TPHRLLKHSIYHKFFTAAISSTAYLSP
YESFNHPVMSLLALDISRGDTYENARDLLIRFKNMNSATKSAASFPTFININDILPVFLL
CYNDSSHEQFEACQSLAKMLKKQLFVESILLPLWRDSEDYDAEEPRRILHPPIMSSLEEM
LYFLDLEAPGKDNISYTGSSNPI------------SSFELPLALVETIYDRLNLLITELM
IPFMKRKISFWEETILQPRKSIFLN-AKFLRRFVSKSAPATPA--------------API
NSKSDGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPC
LEWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASK------------------
-----LTSPHVAEAD----------SPVDSKPAQSYETRCMLLSAELFLSLSDTWTATPY
AIKYLETIL-QNC-PLGPKSQVLLWEKLAYCYELRVDPRVSHIHAKQRHLQYEREEVISK
SNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEALSNR----------------EK--
EHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDVDTVYSG
LVFSYRKGLILERLVGEIEANMHA------------------------------------
---------------------------------
>KLTH0G13860g
---MPLSFGKYMNLAFHLDSALEPVP--TEISRKIVSSAVSPVVTVTSTAALDEHIQESY
GVDSLYMLLRYFGDCVSDRDQAEA------------------------------------
--GPELGTESGK------------------------------------------------
------NRNRARSNSLFQRQA--SHYLRFTRPLTDLIDVR-ESRDLLFDYHSLEVFLEKY
LSLVEANTTSD----------------------TPHTLLQHSIYHKFFTTAISSTAHLSP
YESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTTP---HFPAFINVNDILPVFLL
CYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAG-ASPSRILHQPIMSSLEET
MYSM---------------MKE-------------STITLPLSLINYIYDRLTNLIDELM
IPFMKRKISFWDESILQPRKSIFPN-SKFFRKLISKTP--APP--------------PAS
DSATHSQ-QGVAYFAATSNEFILRKLADWSFMLSDFKNAYSTYELLSKDFEQRPEYLASC
LEWCALSVLMGAQSIVTVKMIKNDIDPLINRALKSYELSARKAKEKNAQLKSSALAKKAE
KDSKSATLPSTVSDEHSGQELDEGVSSAPSQSAQSYETRCMLLAAELFLSLSDTWTATPY
AIKYLETIL-DEC-TLGSLSEIVLWERLAYCYALRVDPRVKG------------------
-------KLPSLDGQSG---------QNEKRGEESEGSDE----------------SD--
DETQKYDHKISQ-NCMASLGLARRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSE
LDFANRDDLILEKLRKKIHEHEPLPQKLNTSFIST-------------------------
---------------------------------
>Kwal_56.23583
---MPLSYERYMNLVSHLDSASEPVP--SEISRKIVSNAVSPVVTVTSSAALDKHIQESY
GLDSLYMLLRYFGDCISDRDQADS------------------------------------
--EQESGVEPNK------------------------------------------------
------SRARSRSGSLFQRQA--SQFLRFTRPLSDIIGTR-ETRDLLFDYHSLEVFLQKY
LELVDVKTSPD----------------------TPHTLLQHSIYHKFFTTAISSTAHLSP
YECFNHPVCSLLALDISQNEGYEDARDLLVTFKNMHNKTP---HFPSFINVNDILPVFLL
CYEEGSREQFETCQSLAKMMKKQLFVESLLLPCWSVNFTAK-DTPTRVLHQPIMSSLEET
MFSM---------------LKD-------------SAFDLPLPFIEHIYDRLTKLVDELM
IPFMKRKISFWEESILQPRRSIFPN-SKFFRKLISKAP--TPS--------------TNN
DSATHSE-QGLAYFAATSNELLLRKLADWSFMLSDFKTAYSTYELLSKDFEQHPEYLAPC
LEWCALSVLMGAQSIVTVKMIKNDIDPLITRALKSYELCASKAKERNGLLKSKLQNRDHD
KSLNGFETISNSHDDRVSGTTDFEISSTPSQSAQSYETRCMLLAAELFLSLSDTWTATPY
AIKYLETIL-DQC-TVGALSEIVIWERLAYCYALRVDPRVKS------------------
-------RLTASEIQSSD--------QNEKLDEESEGSDN----------------DS--
GDESQVCQHKMSQSCIASSGLTRKRKATLFRLIATKKWTESKQWRQACWSFQDLEVMYSH
LVFANREDLILKKLEKRIAQHSSIS-----------------------------------
---------------------------------
>Kpol_392.11
MASLQFSYENYMNLVYHLDRVNEPVP--QDISKRIVSNAIAPVITVMSTSELDQHVQDSY
NIDSLYLLMRYFGGCISDRDQANEYVKKANVENTAQE-------------GVNDQIIEEQ
RNSNTLELPKSE------------------------------------------------
------RYSRSRSNSLFQRDSTQSHYIRFTKPIEDLINSR-DSHDMLFDYHSLEVYLEKC
LSLIDKNTNDE----------------------TDHKALKMSLFHRFFSSAISSTTYLSP
YESFNHPLISLVALDISKGQNYEDARDLLIKFKNQNNAVE---EFPPFMSTNDILLVFLL
CYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSH--S-EDVQVELHQPAMSSLDEM
LYFF---------------ERP-------------SVHELPLNLINTIYDLMEKLVVDLM
IPFMQRKISFWEETILQPRKSLFHG-NKLFRKFMNRSSS-QTA--------------NQY
NNIVKDS-RGNEYFTSSSPEFLLRKLADWSMMISDFKTAYSTYETLISDLEAHPKYLASC
LEWCAISILMGAQNIVTAKMIKNDVNPLIERSLDTYEQCSI-------------------
-----LAQNSLEN------------DELLSEPVRSYETRCMLLTSELFLSLNDTWTSTPY
ALSNLETIL-AEC-KLGICSQIMIWERLSDCYNMRTDPRIRH------------------
-------RV----------------------ETVTKIENN----------------EG--
GQQLQT-------DDIVSKGLARKRKAAFFRLLAAKKWAEQKQWRQVSWCLRDVEYIYDD
LSFSKRPELIYQKLKDELNEERQGNKKQ--------------------------------
---------------------------------
>TPHA0B03260
---MTFTYENYMNLIFHLDKVHENVP--QDISKRIVSNAIAPVITVTATVELDSHISEEY
GIDSFYTLLRYFGGCISDRDQSNEYIKKTEDEQKSHA-------------LNKVNLTTIE
--ETKVKLNEDEKMEEELQSDQNVINPTNDPTVNNNYLDVDTKTDNLLPKSSQT------
------TRNRSRSNSLFQRDSTQSQFIRFTRPIEDLLYSG-GTGDMLFDYHTLEIFLGSC
LKMVEKYTTDD----------------------IDHKTLQKSLYHRFFSSAISSTNCLSP
YESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTIN---NFPIFMSTNDILPVFVL
CYNGSSAEESEKSTELSKKIKKQLFAECIRMPLWDKRY--S-DDITVKLHQPAMSSLDEM
LYVF---------------QTS-------------KTDKLPLTLINLIYDQLEILTNDLM
IPFMQRKITFWEETILQPKKSLFQG-TKLFRKFMGRPSM-TNG--------------RQE
NIPIKDN-QGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFESLLEDIEMYPKYLASC
LEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCA--------------------
-----LLLNSIAESE----------ESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPY
ALSNLETIL-SEC-KLGACSQIMIWERLSDCYNLRTDPRVKH------------------
-------KLR----------------SNISTSSVSEVSEE----------------EI--
KKQDV--------SSIVLKGLTRQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQD
TVFGKRESLIYQKLKRNLLENSKK------------------------------------
---------------------------------
>KAFR0B05570
--MINFSYEHYMNLLFHLECSDENIP--SEIARRIVSHAIAPVITVTSTPELDKHIQDTY
SIDSLYMLLRFFGGCVSDRDQASE--SK----------------------ANAP------
--HSSSSLTTTK---------------------T--------------------------
------TRARSRSNSLFQRDSTQSQYIRFTRPLPDLVERH-DKNDMLFDHHSLESYLRQY
LELVEKFTFDS----------------------TSHQLLKKSLYHNFFSLAISSTTTLSP
FESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTID---KFPIYINTYDMLPVFLL
CYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSY--Q-TEPFIKLHQPVMSSLDEM
IYFL---------------QSD-------------EQNTLPIELTNTTYDMLEKLVYALL
IPFMQRKIAFWEETVLQPKKSIFHG-SKFLKKLMSRAST-SSH--------------QQQ
NILTKDH-DGNEYFASSSPELLLRKLADWSIMLSDFKTGYATYEILSHDLELFPKYLASC
LEWEAVSLLMGAQNIVTVKMMKNDISPLIDRALDAYDACAANTH----------------
-----LSNKKIGPTN----------ESTSLEPVLSYETRCLILSSELFLSLSDTWTSTPY
AINYLESIL-EES-RLGPCSRIMIWERLSDCYDLRVDPRIKS------------------
-------KVEQ---------------VQKQDNLEEPADNE----------------HRIL
NSQDDLNP-----SNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSR
VGLVNRDDLILTRLREEYNIAVSDSK----------------------------------
---------------------------------
>CAGL0B01705g
---MVFSYEHYMNLIYHLDDANETVP--SDIAKRVVSNAMAPVITVTSTVLLDRHIEETY
GIDSLYMLLRFFGGCVSDRDQANE--VKLGTDG-----------------LKVT------
--EEGVE-NEKD---------------------GTNGLT--------VPRQ---------
------TRVRSNSNSLYQRDATQSQYVRFTKPLADLINTQ-DANDMLFDYHSLEVYLQEY
LSVVDKKFSPH----------------------IPHHLLKTSIYHSFFALAISSTSKLSP
FECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIP---SFPSFINTNDILPVFLL
CYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEF--T-DNLVVSLHQPVMSSIEEI
MFFL---------------QNP-------------VDHKLPLKLVNCIYDQIDMIVYDLM
KPFMKRKMTFWEETILTPRKSLFHG-AKFFKKFMNKST--QAL--------------SQP
NSLLKEN-HGSNYLSSTSPEFLMRKLADWSMMVSDFKTAYTTYESLCQDFERMPKYLASC
SEWCAVSLLMGAQNIVTAKMLKNEINPAIERALGAYELCAT-------------------
-----ESNAHRKFGD----------SDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPF
AIAYLETIL-NEC-KLGPLSEIMIWERLSDCYGMRIDPRIKH------------------
-------RIGN---------------LELLQKKEENMDDP--------------------
KNADVFTT-----EDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSD
LKCFNKENLLYTRLRNELIAARQDM-----------------------------------
---------------------------------
>ZYRO0C01826g
---MKLSYENYMNLLFHLDHGQETVP--PDIARRIVSNAVSPVITVSSTPELDRHIRDTY
HLDSLYMFLRFFGDCVSDRDQANEYQPLRSKEEPELV-------------AEPP------
--SKADNLIENS---------------------RKSSLK--------VPSTSSDTKNTTT
STSGTTGGTRKRSNSLFQRDQTQSQYVRFTRPIDDLIESS-DSNDMLFDYHSLEVFLENT
LRLVEEYTDDN----------------------TPFELLKKSLYHKFFSLAISSTTYLSP
YETFNHPVVSLIAIDISAGQGYEEARDLLIKFKNLNHTVE---NFPIFMSTGDILPVFLL
CYNDESEDEQNACQQLANQLKKQLFVESLLLPLWKRSY--S-DHGEVELHQPIMSSLEEM
LYFL---------------QSP-------------TPTRLPLQLINVTYNILEKLVKDLM
VPFMKRKISFWEETILQPRKSLFHG-ANFFKKLMSKNSNGSNN--------------HQP
ISLGKDK-NGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASC
FEWCAVSVLMGAQNIVTVKMIKNDIDPLIQRALETYENCA--------------------
---------ADEDST----------GEELYVPVRSYETRCMFLASELFLSLSDTWTSTPY
ALNSLETIL-TEC-RLGPCSEIMIWERLSDCYYQRIDPRIRH------------------
-------KTS----------------AQGAKAMTDELAPD----------------EE--
SN-----------EEIVTRGLTRKRKAAFFRLIAANKWVEQKQWKQAFWCLKEIEEAYAG
LDFVNREDLILARLKRQMNEAQNNVDESSNQTVESGAA----------------------
---------------------------------
>TDEL0F03820
--MVKLSYENYMNLLLHLDHGDDRVP--ADIAKRIVSNAISPVICVTSTPELDRHIQETH
HLDSLYMLLRFFGDCVGDRDQAHECTSAGSPSGDDRA-------------EK--------
--SSSSTLAVAS------------------------------------------------
------GPSRKRSNSLFQRDATQSQYIRFTRPLRDLVESA-DTNDMLFDYHTLESFLENI
LLLIEKSTNDK----------------------TPHKLLKKSLYHRFFSLAISSTAYLSP
YETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTK---NFPVFLNTNDVLPVFLL
CYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNY--K-TATQVILHQPIMTSLDEV
LYFL---------------REP-------------SRIELSLELINSIYDVLEILINGLM
IPFMQRKISFWEETILQPRRSLFHG-SKFLKRFMSKTTSGTNI--------------HQQ
ASIAKDA-NGKEYFVSSSAEFLMRKLADWSMMLSDYKTAYSTYDSLSHDLEHYPKYLASC
LEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAVETYENCA--------------------
-----LYDTQLSGSK----------KSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPY
ALRNLETIL-AEC-RLGPCSQIMIWERLSNCYQQRIDHRIRH------------------
-------KV-----------------NDGAMSNEEKVENE----------------DD--
SEKEHTH------ADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAG
IEFVNRKDLALAKLKETLKNVEIDSRTIAPPKDQVHVEEKVITD----------------
---------------------------------
>NDAI0J01410
---MVFSYEHYMNLLFHLDHAKESVP--PEIAKRIVSNAIAPVITVTSTPQLDNHIQETY
NIDSLYMLLRYFGGCVSDRDQANELVGKQELDV-----------------THPT------
--NPSNPVSSLI---------------------VPSGQQ--------QPPLKA-------
------RRGRSRSNSLFQRDSTQSQYIRFTKPIDDIVAIK-SSNDMLFDYHSLEIYLEQY
LQLIATNTNNS----------------------TPYELLKNSIYHNFFSLAISSTTQLSP
YETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNLNTTTP---NFPIFMNTNDMLPIFLL
CYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQY--E-IDIKVDLHQPIMSSLEEM
IYFL---------------QTP-------------FSAKLSISLINSIYNILDSLIYDLM
LPFMKRKLLFWEETILQPRRSLFHG-AKFLKKFMTKN---NNG--------------PQE
NILTKDS-EGNEYFAFSSTELLMRKLADWSMMISDFKTAYSTYESLSRDLDTFPKYLASC
LEWCATSLLMGAQSIVTVKMIKNDINPLIERALQTYENCAIT------------------
-----LIQDTTNKVF----------AEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPY
AITYLETIL-TEC-KLGPCSQIQIWERLSDCYKLRIDPRIRY------------------
-------KINDTATTTTTVTTTT---ADKVVATPSTDKPK----------------TI--
QWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVAWCLKDMESIYDA
TDLGKRDDLIVAKLRNLLDENIGGDDGNFKLKDEKLSADHIEVSS---------------
---------------------------------
>NCAS0B03880
---MNFSYEHYMNLLFHLDYGKETVP--SEIAKRIVSNAISPVIAVTSTSELDHHILETY
NIDSLYMLLRFFSGCVSDRDQANELEKSQKDKISSNN-------------TLTL------
--PTTSPLPKVR------------------------------------------------
------TRGRSRSNSLFQRDSTQSQYIRFTKPLGDVIATK-NANDMLFDYHSLEIYLQNY
LDLIQKNTDDN----------------------TPYELLKKSIYHSFFSLAISSTTILSP
YECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTH---NFPIFMNTNDMLPVVLL
CYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSY--P-SDPQVHLHQPVMSSLEEM
IYFL---------------NQP-------------KEVTLPYELIQSIYNILDSLVYNLM
IPFMKRKIAFWDETILQPRKSLFHG-AKFLKKFMTKTAL---T--------------HQE
NLLTKDA-QGNEYFTSASSEFLMRKLADWSMMLSDFKTAYATYESLTHDLESFPKYSASC
LEWCAVSLLMGAQNIVTVKMLKNDINPLIEKALSTYENCAT-------------------
-----VLPETDKRNT----------DELIVVPVRSYETRCMILASELFLSLSDTWTSTPY
AISYLETIL-VEC-KLGACSQIMIWERLSDCYELRVDPRIKH------------------
-------KAAGTIANTSSPKKSSESDMQGHVMTPSPLTKE----------------DV--
SNDANNDTD----QDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSIDDTYSK
IGLADRDDLILKKIQNKLKTAETETIDAGAEKNAEVSHHEVDSPN---------------
---------------------------------
>Suva_2.268
---MVFSYEHYMNLLFHLDHSRETVP--PEIAKRIVSNAIAPVITVTSTPLFDKHIQEAY
SVDSLYMLLRFFGGCVSDRDQANE--GKFEQDE-----------------Q---------
--NASPSIESSS---------------------KNQNLG--------VPSALK-------
------RGSRSRSNSLFQRDSTQSQYVRFTRPLGDLIETR-DTNDMLFNYHSLEVFLDNY
LKLVAGNTDEK----------------------VPHDLLKKSIYHSFFSLAISSTNNLSP
YETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTE---SFPIFMNTNEMLPVFLL
CYNDESQEEFEKCQALAKKLKKQLFVESILLPLWKDSFVDV-ENSNIQLHQPVMSSLEEI
LFFL---------------RAP-------------TQTKLSLPLINSIYDMLDYLVYDLM
IPFMKRKISFWEETILQPRKSLFNG-AKFFKKFMNKAPV-NGN--------------HQH
NSLTKDN-QGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASC
IEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYENCSR-------------------
-----MQRRNSKELT----------SSGVLEPVRSYETRCMILASELFLSLSDTWTSTPY
AIQYLETIL-DEC-KLGPCSQIMVWERLSDCYNLRVDPRVKH------------------
-------KVGG---------------MKKSVKNTEDLRND----------------DE--
YDTDHFTE-----EDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSD
IDFLHGNGLILSNLKNQLNSKDVDSAPTPTEKNPTKTSINYIE-----------------
---------------------------------
>Skud_4.369
---MVFSYEHYMNLLFHLDNSEEIVP--PEIAKRIVSNAIAPVITVTSTPLFDKHIQETY
NVDSLYMLLRFFGGCVSDRDQANE--GKVGPNE-----------------HEVS------
--DTSVSMESLS---------------------KNQNLG--------VPNALK-------
------KGSRSRSNSLFQRDSTQSQYIRFTRPLGDLIETR-DTNDMLFNYHSLEVYLDNY
LKLVTENTNET----------------------APHDLLKKSIYHSFFSLAISSTNNLSP
YETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNTE---NFPIFMNTNEMLPVFLI
CYNDESQEEFEKCQALAKKLKKQLFVESIFLPLWKESFIDD-ENSSIKLHQPVMSSLEEI
LFFL---------------QAP-------------TQTTLSLPLINSIYDILDYLVYDLM
IPFMKRKVSFWEETILQPRKSLFNG-AKFFKKFMNKNPA-NGS--------------HQH
NSLTRDR-QGNEYFSSSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASC
IEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYEKCSQ-------------------
-----IQRHKGKELS----------SSSVTEPVRSYETRCMILASELFLSLSDTWTSTPY
AIQYLETIL-DEC-KLGPCSQIMIWERLSDCYNLRVDPRIKH------------------
-------RVGV---------------MKKSFKETEDLRNG----------------DE--
HYTDHFIE-----EDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSE
IKFLHCNDSILSKLKSQLNLKDLDSAPGPTEKNPTTTSINFIE-----------------
---------------------------------
>Smik_4.354
---MVFSYEHYMNLLFHLDNSKETVP--PEIAKRIVSNAIAPVITVTSTPLFDKHIQEAY
KVDSLYMLLRFFGGCVSDRDQANE--VKVGQDE-----------------HQVG------
--DTNASMESFS---------------------KSKNLE--------VPNLPK-------
------KGSRSRSNSLFQRDSTQSQYIRFTRPLDDLIETR-DTNDMLFNYHSLEVFLDNY
LKLVADNTDEM----------------------VPHDLLKKSIYHSFFSLAISSTNNLSP
YETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNTE---NFPLFMNTNEMLPVFLL
CYNDESQEEFEKCQALAKKLKKQLFVESVLLSLWKDSFIEA-NNSAIQLHQPVMSSLEEI
LFFL---------------QAP-------------TQTSLSLPLINSIYDMLDYLVYDLM
IPFMKRKVSFWEETILQPRKSLFNG-AKFFKKFMNKNPS-NGN--------------HHH
NSLTSDN-QGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASC
IEWCAVSLLMGAQRIVTVKMIKNDINPLIEKALATYENCSK-------------------
-----IQRSKSEKSS----------SSNTVEPVRSYETRCMILASELFLSLSDKWTSTPY
AIQYLETIL-DEC-KLGPCCQIMIWERLSDCYSLRVDPRIKH------------------
-------RVGA---------------MKKGIRDTEDLRGG----------------DG--
NSTDHFTD-----DDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSD
IKFLNGDGLILSKLHNQLNLKDLNSAPSPTEKNPTMTSVSFIG-----------------
---------------------------------
>YDR108W
---MVFSYEHYMNLLFHLDNSKETVP--PEIAKRIISNAIAPVITVTSTPLFDKHIQETY
KVDSLYMLLRFFGGCVSDRDQANE--AKVGQHE-----------------HEVC------
--DASDSTDSIP---------------------KNKNLE--------VPNLSK-------
------KGSRSRSNSLFQRDSTQSQYIRFTRPLGDLIETR-DANDMLFNYHSLEVFLDNY
LKLVAANTDEM----------------------VPHNLLKKSIYHSFFSLAISSTNNLSP
YETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNTE---NFPIFMNTNEMLPVFLL
CYNDDSQEEFEKCQALAKKLKKQLFVESILLALWKDSFIYD-ENSVIQLHQPVMSSLEEI
LFFL---------------QAP-------------TQTTLSLALINSIYDMLDYLVYDLM
IPFMKRKVSFWEETILQPRKSLFNG-AKFFKKFMNKNPV-NGN--------------HQH
NSLTRDS-QGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASC
IEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYENCSR-------------------
-----IQRGKGKESN----------SLDVTEPVRSYETRCMILASELFLSLSNTWTSTPY
AIQYLETIL-DEC-KLGPCSQIMVWERLSDCYNLRVDPRIKH------------------
-------RVGA---------------MKKDAKDTEDLRGE----------------HK--
YSTDHFTD-----EDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSE
IKFLHGNGLILSKLKNQLNLKDVDSAPRPSEKNLTRTSVSFIG-----------------
---------------------------------