MUSCLE (3.8) multiple sequence alignment

Ecym_4317          --------------------------------------------------------MRLI
TBLA0H01450        ---------------------------------------------------MNSLLTSIL
TDEL0F03810        -------------------------------------------------------MHFFF
NCAS0B03890        -------------------------------------------------------MNYVI
NDAI0J01420        ------------------------------------------------------------
AGR097W            --------------------------------------------------------MIAL
TBLA0E04370        ----------------------------------------------------MTKLITAV
CAGL0B01683g       -------------------------------------------------------MVRQL
TPHA0A01840        -------------------------------------------------------MRCSY
Kpol_543.35        -----------------------------------------------------MMMKTIF
ZYRO0C01848g       ------------------------------------------------------MLSHSL
Skud_4.368         ------------------------------------------------------MKQSIW
YDR107C            ------------------------------------------------------MKRGVW
Smik_4.353         ------------------------------------MKFSSGCINTHVDNQYRVMKQSIW
Suva_2.267         ------------------------------------------------------MRKGIW
KNAG0G01990        ---------------------------------------------------MISHTVHLG
KAFR0B02680        -------------------------------------------------------MTRLL
Skud_12.151        ------------------------------------------------------MAYIQL
Smik_12.142        ------------------------------------------------------MAYLQL
YLR083C            --------------------------------------------------MIYKMAHVQL
Suva_10.167        ------------------------------------------------------MAYIQL
NDAI0B02370        MLHQGQEERYMSLKTSIRTAHLFEVVPKIETNYSYCIDYHTSILYLPFKLRKTMIAPSLV
NCAS0B04970        -----------------------------------------------------MLSPRLV
KLLA0F18931g       --------------------------------------------------MFTYLWRSLL
SAKL0H17248g       ---------------------------------------------------------MLL
KLTH0G13882g       ------------------------------------------------------MVSAIL
Kwal_56.23577      -----------------------------------------------------MILSATL
                                                                               

Ecym_4317          RSFLLCAGVSYGFYFPGVSPVTYHIGDEIPLLVNYLS-------------------SDFL
TBLA0H01450        CLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFL
TDEL0F03810        TALSLLWAVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYL
NCAS0B03890        LSLLFCLSVVEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDISTAKKYVV
NDAI0J01420        ---------------------------------------MHYHHKNQEGQDISTDDKRTI
AGR097W            VAWVAWLGLAQGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERYL
TBLA0E04370        SICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFL
CAGL0B01683g       LVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARML
TPHA0A01840        LLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKV-ESREKML
Kpol_543.35        CLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFL
ZYRO0C01848g       LFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHYL
Skud_4.368         LALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFL
YDR107C            LLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFL
Smik_4.353         LLLFFYIGLTKAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISSDKEHYL
Suva_2.267         LALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFL
KNAG0G01990        LALLWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKSRYL
KAFR0B02680        LLISLFLSLTRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYL
Skud_12.151        LLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFL
Smik_12.142        LLLYFLVSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFL
YLR083C            LLLYFFVSTVKAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSGDKENFL
Suva_10.167        FLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFL
NDAI0B02370        LLFAFCLSLTRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMKSDKERFL
NCAS0B04970        LFFTFFLSLTRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKS--KNKEHFL
KLLA0F18931g       VSTLIGSLLVEAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHDT-GDKEGFL
SAKL0H17248g       LLLLPLLQIASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFL
KLTH0G13882g       LLSILWASQVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-GDKESLL
Kwal_56.23577      LLSALCASRVEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDT-GDRESFL
                                                                              :

Ecym_4317          WNIDYYSDSIGLCKP--NTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI-
TBLA0H01450        YSYDYYYDKFHFCRP--EKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIP
TDEL0F03810        YSYDYYNSKLHFCKP--ENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIP
NCAS0B03890        HSYDYYYEKFHFCQP--VHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCESIIP
NDAI0J01420        YSYDYYYEKLHFCKP--EHVEKAGVSIGSVLFGDRLYNSPFQLNMLKNKTCERLCNSTII
AGR097W            YAYDYYYPRLHMCRP--DKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVP
TBLA0E04370        YSYDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIP
CAGL0B01683g       YPYDYYNEKLHFCQP--EKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIP
TPHA0A01840        YSFDYYFPKLHFCKP--EKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIP
Kpol_543.35        YSFDYYFPKLHFCKP--EHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIP
ZYRO0C01848g       YSYDYYYSKFHFCKP--ENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIP
Skud_4.368         YSYDYYNERFHFCRP--EHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIP
YDR107C            YSYDYYNKRFHFCRP--EHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIP
Smik_4.353         YSYDYYNERFHFCRP--EHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCENTIP
Suva_2.267         YSYDYYNDKFHFCKP--EHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIP
KNAG0G01990        YSYDYYYDRFHFCQP--EKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIP
KAFR0B02680        YSYDYYYDRFHFCQP--EKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIP
Skud_12.151        YSYDYYYDRFHFCRP--KHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIP
Smik_12.142        YSYDYYNSRFHFCKP--EKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIP
YLR083C            YSYDYYYNRFHFCQP--EKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCKTVIP
Suva_10.167        YSYDYYYDKFHFCKP--EHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIP
NDAI0B02370        YSYDYYYDRFHFCQP--EHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLCKTTIP
NCAS0B04970        YSFDYYFDRLHFCKP--EHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIP
KLLA0F18931g       YSYDYYYKKFHFCQP--AELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIP
SAKL0H17248g       YSYDYYYDKFHFCRP--ENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIP
KLTH0G13882g       YSYDYYYPKFHFCRP--EKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIP
Kwal_56.23577      YSYDYYYDKFHFCKP--EKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIP
                      ***   : :*.*    :     *:**::**:.:.***:.: :*       **.  : 

Ecym_4317          --DTALWNTFFGYRYSYNWLVDGLPVLGI--DGTSDANGYHNNSEL-FMGY---------
TBLA0H01450        ADDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSV------EHM
TDEL0F03810        GEDAAFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEI------MQG
NCAS0B03890        GKDAEFINKLIKNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEI------RQT
NDAI0J01420        GRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYGNGFELGLVEI------RQT
AGR097W            AEDAKFINQLIRSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRV--------IRG
TBLA0E04370        GDDAKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEM------IQV
CAGL0B01683g       GKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEV------RQA
TPHA0A01840        GSDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEI------KKN
Kpol_543.35        ADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHV------RQA
ZYRO0C01848g       GEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDV------TEG
Skud_4.368         GRDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDV------IQT
YDR107C            GKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDV------KQT
Smik_4.353         GKDAKFINKLIKSGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAV------KNT
Suva_2.267         GKDAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDV------KQT
KNAG0G01990        GKDAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEV------VQA
KAFR0B02680        GNDAKFINKLIKNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDV------VQA
Skud_12.151        GNDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEV------SQG
Smik_12.142        GNDAKFINKLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEV------TQG
YLR083C            GDDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQV------TQG
Suva_10.167        GDDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEV------AQV
NDAI0B02370        GKDAKFINKLIKNGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDV------VQG
NCAS0B04970        GKDAKFINKLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVES------FQA
KLLA0F18931g       GKDAKFINKLILNGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDV------LSD
SAKL0H17248g       KDDAKFINKLIRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDV------VDT
KLTH0G13882g       ADDAKFINKLITNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNG
Kwal_56.23577      ANDAKFINKLIANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDG
                     *: : * ::   :  **::****      :          .  *              

Ecym_4317          --------------------------------------------------------QADE
TBLA0H01450        SGGSKVT---------------------IPGVSKLVNEAVKAYKKREAKNVPAGLITAEE
TDEL0F03810        VHNGAMA----------------------------TPREETGISAHGS-----NVVVNLE
NCAS0B03890        TGDKLLP---------------------------DSVHDISDLAKRDAKNLVQNLIKEVE
NDAI0J01420        TGEKLLP---------------------------NSADTFRDLHKRDAKNIVQNLMQDIE
AGR097W            TEDRNQE-----------------------------EPGEIELQTR---RVLQPGESVVA
TBLA0E04370        VDEAPSH------------------TTPKQPIVEDVLSQELDEEQATEKRANQMLVSSVE
CAGL0B01683g       VGGKIVSESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVE
TPHA0A01840        VGGLGIPMDAKTKDSGKKNSNSDKKKDSKKKDDSQKKEDSNKKEKREPKRIS-KLVHNVE
Kpol_543.35        VGGLASS------------------------------KLNLENPAREAKNVN-NMVHNVE
ZYRO0C01848g       FSDSNDE--------------------------------------------EKKIMKTLE
Skud_4.368         VGDETVP-------------------NTMEEADMDASNAGATLHIRSPKNIRPNPVKTVE
YDR107C            VDGKAVP-------------------STMEELTSEASNEDVILDARLPKNVKPNLVKTVE
Smik_4.353         IDGKVIP-------------------STMEELDSETSNTGAALDAREPKNIKPNLVKTVE
Suva_2.267         VGGKTIP-------------------STMEELDSEDSKTGATLDARDPKNIKPNLVQTIE
KNAG0G01990        VAQAKTH-------------------------PKEDDSGSAKLSTRDAKNV--QMLKNVE
KAFR0B02680        VDETEAR------------------------TKVAAANQGAELDARDAKNV--KTIKNVE
Skud_12.151        TRSKTAP------------------------KQAETTNEGLELGTRAEDY---SIVETFE
Smik_12.142        TASEATP------------------------NTAETTNQGVELDTRDGH----NMVQTYE
YLR083C            TDIEATP------------------------KGAETTDKDVELETRNDR----NMVKTYE
Suva_10.167        VDSETEQ----VQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGK---NMVKTRE
NDAI0B02370        TTTGDNA---------------------NTVAKKPTTNEGLELDTRDAKNV--QMLKNFE
NCAS0B04970        IDGQAPA----------------------TTKPKQTTNEGLELETREAKNV--QMVKNIE
KLLA0F18931g       YEPDTRS-----------------------------LHDELELQLNAKKNVLSPGDKVTE
SAKL0H17248g       IEDPDTK-------------------KVSESDYIEIADADKELKERSA--------KLTE
KLTH0G13882g       QGGSQDG---------DDSGSHGSTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLE
Kwal_56.23577      QGEEDAH--------------PKGATKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLE
                                                                               

Ecym_4317          QKYIYNHFDIYIHYNDRGKGEYRVVFAEAKPISLPRTGSELCS-KDAKPVPIGSGNHENI
TBLA0H01450        VEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDFESCT-PTGNQLHLNENAENQV
TDEL0F03810        LPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQTS-NSCE-FTGEQISLSEDQDNEV
NCAS0B03890        VPYFVNHFDIVIEYHERGNGNYRVVGATVNPVSIARKSAGDCT-PTGKSLTLNEEEDNNV
NDAI0J01420        VPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCK-PTGKALSLSESEVNYI
AGR097W            VPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCA-NSGNGLVLSETADTKV
TBLA0E04370        RTYFANHFDIHIEYHDRGNNEYRIVGVTVNPISMKRDS-AICD-TNLGKLALSEVSDTDV
CAGL0B01683g       VPVFANHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEV
TPHA0A01840        FPYLANHYVINVEVHDRGEGNYRVVGVTVDPYS---TTDSANP-EKGNKLFLDEKKDNEV
Kpol_543.35        IPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKS---STGDICT-KKSGGLILLETEDNEV
ZYRO0C01848g       VPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQ-YNSGSLTLSETEENEV
Skud_4.368         LPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIERSSPGSCS-RTRKPLTLHEDRDNEV
YDR107C            LPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSIERSSPGACS-TTGKPLILDEDKDNEV
Smik_4.353         LPYFVNHFDIEVEFHDRGDDNYRVVGVTVNPMSIERSSPDSCS-KATKPLILDEEGDNEI
Suva_2.267         LTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSIERSSPGACS-TTGEPLTLVEDKDNDV
KNAG0G01990        LPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPGTCQ-TSGDPLMLDEKNDNEV
KAFR0B02680        LVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCE-STGQPLTLQEDEDNDV
Skud_12.151        HPYFANHFDIMIEYHDRGGGDYRVVGVIVNPLSIKRSITGTCE-TDASPLILDEERDNEV
Smik_12.142        HPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCE-TDGSPLMLDEENDNEV
YLR083C            LPYFANHFDIMIEYHDRGEGNYRVVGVIVEPVSIKRSSPGTCE-TTGSPLMLDEGNDNEV
Suva_10.167        FPYFANHFDIKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCE-TNGSPLVLDEANDNEV
NDAI0B02370        LPYFANHFDIQVEYHDRGENNYRVVGVIVNPVSIKRSTPGTCE-TSGAPLMLSEDQDNDV
NCAS0B04970        IAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTCE-TTGDPLVLSEDADNDV
KLLA0F18931g       IPYFVNHYDIQIEYHDRGENNYRIVGVTVNPASIKRDSPDSCE-STGKSLVLSETEDNEV
SAKL0H17248g       LSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCD-TEGEPLVLSEDADNTV
KLTH0G13882g       TPYFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCD-KTGELLKLSETEATEV
Kwal_56.23577      TAYFANHFNIEVQYHDRGNGDYRVVGVIVNPQSIKRDSSNSCA-ATGELLKLSEEEETTV
                      : **. * :  :.   .  *:* . . * *                : : .     :

Ecym_4317          TFTYSVIFKKSDISWSTRWDQYLHVYDFDIQLAELISFSLVVLLLSSVLVHSLFRVLKRD
TBLA0H01450        LFTYSVDFIKSETAWATRWDKYLHTYDPSIQWFSLINFTIVVVLLSTIVIHALLRALKKD
TDEL0F03810        LYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFSLISCVIVVIGLSSVVLHMLLRALKSD
NCAS0B03890        HSTYSVTFVPSKTSWVTRWDKYLHVYDPKIQWFSLINFSLIVILLSVILINSLLKALKSD
NDAI0J01420        HFTYSVEFIPSETAWVTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQALKSD
AGR097W            TFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYSLINFSLVVLLLSSIMVHSLFRALKTD
TBLA0E04370        IFTYSVTFEKSDTVWATRWDKYLHIYDPTIQWFSLINFTVIVVVLSIIVVHFLTKALKND
CAGL0B01683g       MFTYSVKFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSD
TPHA0A01840        TFSYSVNFIESETVWATRWDKYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSD
Kpol_543.35        QFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLINFSVVVILLSMVVIHSLMRALKSD
ZYRO0C01848g       HFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCSVIVVALSSVVLHMLLRALKND
Skud_4.368         YFTYSVKFVASATVWATRWDKYLHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSD
YDR107C            YFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFSLINFSVIVILLSSVVMHSLLRALKSD
Smik_4.353         YFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFSLINFSVIIVLLSSVVMHSLLRALNSD
Suva_2.267         YFTYSVKFIASDTVWATRWDKYLHVYDPQIQWFSLINFSIIVILLSSVVIHSILRAVRSD
KNAG0G01990        YFTYSVRFVASDTVWATRWDKYLHTYDPTIQWFSLVNFSIVVVLLSSVVIHMLLKALRSD
KAFR0B02680        YFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFSLIVLLLSTVVLHSLLKALKND
Skud_12.151        SFTYSVKFKESATSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSD
Smik_12.142        YFTYSVKFVESETSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSD
YLR083C            YFTYSVKFNESATSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSD
Suva_10.167        YFTYSVKFEESPTSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSD
NDAI0B02370        YFTYSVKFIPSETIWATRWDKYLHIYDPAIQWFSLINFSVVVLLLSSVVIHSLLKALKSD
NCAS0B04970        YFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFSLVNFSIIVLLLSSVVIHSLMKALKSD
KLLA0F18931g       YFTYSVKFIKSDTVWATRWDKYLHVYDPKIQWFSLINFSTIVVLLSSVMLHSLYSALKND
SAKL0H17248g       HFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFSLISFSLIVILLSSVMVHSLFRALKND
KLTH0G13882g       HFSYSVKFTPSETVWATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDD
Kwal_56.23577      HFSYSVKFTPSDTVWATRWDKYLHVYDPKIQWYSLINFSIVVIVLSSVVIHSLYRTLRDD
                     :*** :      * ***.:* . *:  :*  .::.   ::: **      :  .:  *

Ecym_4317          IAAYSEFNLDDEFQQDYCWKIIHGEVFRSPSKALLLSVFVGSGSQLFFMALCTVLLGSCG
TBLA0H01450        ISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALG
TDEL0F03810        FARYNELNLDDEFHEESGWKLSHGDVFRMPNKSLLLSVLVGSGVQLLLLAVGGIVIAAIA
NCAS0B03890        FARYNNINLDDDVKEESGWKLVHGYVFRIPKNPMILSILVGSGFQLFLVIVCTVFLAAID
NDAI0J01420        FSRYGELNLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVG
AGR097W            LDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQLFLMSACTLFIAMLG
TBLA0E04370        FVRYNEFNLNDSFDEDSGWKLAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALG
CAGL0B01683g       ISRYNEFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALG
TPHA0A01840        FARYEEFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIG
Kpol_543.35        FARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIG
ZYRO0C01848g       LSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRSLLLSILVGSGVQLFLMIACSIIFAALG
Skud_4.368         LTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFG
YDR107C            LARYNELNLDNEFHEDSGWKLGHGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVG
Smik_4.353         LSRYNELNLDNEFHEDSGWKLGHGDVFRTPTKSMLLSVLVGSGVQLFLMIICSIFLAALG
Suva_2.267         FARYNELNLDNEFHEDAGWKLGHGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALG
KNAG0G01990        FARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALG
KAFR0B02680        FARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMLLSVLVGSGVQLFIMISTTIFFAALG
Skud_12.151        FARYNELNLEDDFQEDSGWKLNHGDVFRPPSHSLLLSILVGSGVQLFLMVTCSIFFAALG
Smik_12.142        FARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSGVQLFFMVTCSIFFAALG
YLR083C            FARYNELNLDDDFQEDSGWKLNHGDVFRSPSQSLTLSILVGSGVQLFLMVTCSIFFAALG
Suva_10.167        FARYNELNLDDDFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALG
NDAI0B02370        FARYNELNLDDDFQEEAGWKLGHGDVFRIPHRSLLLSVLVGSGVQLFLMIICSIFFAALG
NCAS0B04970        FARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMLLSVLVGSGVQLFLMISCSIFFAALG
KLLA0F18931g       LARYNELNLDTDFEEETGWKLIHGDVFRSPNKALLLSVLVGSGGQLALMLTTTILFACLG
SAKL0H17248g       LSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGAQLFLMAGFTILFALLG
KLTH0G13882g       LSRYNQINLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLG
Kwal_56.23577      LSRYNQLNLDDDFQEETGWKLVHGDVFRTPTKSLLLSVLVGSGTQLFVMAACTIAFALLG
                   :  * ::**   . ::  **: *. *** * ..: **: **** *: .:    : .    

Ecym_4317          FLSPSARGSLGTVMFVLYALFGGVGSYTSMSIYKFFGGQNWKLNLILTPLLIPVFLFVTT
TBLA0H01450        FMSPSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFFHGPYWKANMILTPLLVPGSMLLLI
TDEL0F03810        FNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKVNMILTPFLIPGLILLTI
NCAS0B03890        ILSPIYRGALPTAMIILYILFGFISSYVSMGVYKFFKGPYWKVNMLLTPILVPGLIIITF
NDAI0J01420        LITPGSRGTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGLLLLVI
AGR097W            FLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVNMVLTPLLVPGIIFATM
TBLA0E04370        FLSPSARGSLPTIMFILYAVFGFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFI
CAGL0B01683g       ILSPSSRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTV
TPHA0A01840        IISPSSRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSI
Kpol_543.35        ILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISI
ZYRO0C01848g       FLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTI
Skud_4.368         LVSPISRGSLQTVMFLLYALFGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAILLLI
YDR107C            LVSPVSRGSLPTVMFVLYALFGFVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLI
Smik_4.353         LVSPVSRGSLPTVMFVFYALFGFVGSYTSMGVYKFFHGPYWKANLILTPILLPGGIFVLI
Suva_2.267         LVSPASRGSLPTVMFVLYALFGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLI
KNAG0G01990        FLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKANMILTPLLVPGCLLLSI
KAFR0B02680        FLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKANMVLTPILVPGSIFITI
Skud_12.151        FLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLLLTPLLVPGAILLII
Smik_12.142        FLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKANLILTPLLVPGTILIII
YLR083C            FLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLILTPLLVPGAILLII
Suva_10.167        FLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVI
NDAI0B02370        FLSPSSRGSLATVMFILYALFGFVGSYTSMGVYKFFGGPYWKVNMLLTPILVPGLIFCGI
NCAS0B04970        FLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTI
KLLA0F18931g       FLSPSSRGSLSTVMFLLYAIFGSFGSFTSMATYKFFNGKAWRLNLVLTPLLVPGSILTVV
SAKL0H17248g       LLSPSSRGSLTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKLNMILTPILIPSMIFISM
KLTH0G13882g       LLSPSSRGSLTTVMFILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVM
Kwal_56.23577      LLSPSSRGSLTTVMFILYALFGSLGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVV
                   : ..  *  * : :: :*  *.  .*: **. *.:* *   . * ::**.::*  ::   

Ecym_4317          VLLNFFLIYAKSSGAMPFGTMVTIIILWFILSVPVSIIGSLLSWKLNRWDEHPAKTNQIA
TBLA0H01450        IFLNFFLLGVHSSGTIPASTIILMICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIP
TDEL0F03810        ISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAIKTCSWDQHPTKTNQIA
NCAS0B03890        LALNLFLMFSESSSVVPAKTIMTLILLWFAVSIPLSVAGSLMAQKKCHWDEHPTVTNQIA
NDAI0J01420        IGLNIFLIFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVS
AGR097W            LLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARKKNTWDQHPTKTSQIA
TBLA0E04370        ISMNLFLVFVHSSDVVPIGTLSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVL
CAGL0B01683g       IFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIP
TPHA0A01840        LGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIA
Kpol_543.35        VGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIA
ZYRO0C01848g       ILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIA
Skud_4.368         VAMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIA
YDR107C            VIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIA
Smik_4.353         VAMNFFLLFAHSSGVIPASTLFFIIFLWFAVSIPLSFAGSMIAHKWCNWDEHPTKTNQIA
Suva_2.267         VAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIA
KNAG0G01990        VGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVA
KAFR0B02680        IAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVANKKCNWNEHPTKTEQIA
Skud_12.151        VALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARKKCGWDEHPTKTNQIA
Smik_12.142        IALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIA
YLR083C            IALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLIARKRCHWDEHPTKTNQIA
Suva_10.167        IALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIA
NDAI0B02370        VALNIFLLFVHSSGVIPAVTLFFMILLWFVFSIPLALAGSLIAHKKCNWDEHPTKTNQIA
NCAS0B04970        VGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIA
KLLA0F18931g       LGLNFFLIFVHSSGAIPFQTMLVLVLLWFVISIPLSAIGSVIAWKKCNWNEHPTKTNQIA
SAKL0H17248g       LGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISRKKSQWD-RPTNTNQIA
KLTH0G13882g       LALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIP
Kwal_56.23577      LGLNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIP
                   : :* :*    *:..:*  ::  :: :*: ..:* :  **  : *      .*: .  : 

Ecym_4317          RQVPSQPWYIKTWVATFLAGMFPFGAMAVELYYIYASIWGEIIFFMYGFLFVAFILLTLT
TBLA0H01450        REIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFT
TDEL0F03810        RQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQFFYMFGFSMVSLFLLVLT
NCAS0B03890        KVIPPQKWYLKTIPASLIGGLFSFGSISVQLYFIYTSLWFNNIFYMYGFLLFSICLFTMT
NDAI0J01420        KVIPPQKWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAILFTLT
AGR097W            KQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWFNTMFYMFGFLFFTFLLLTLT
TBLA0E04370        RQIPFQPWYLKTVPATLIGGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMT
CAGL0B01683g       RQIPFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFT
TPHA0A01840        RQIPFQSWYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLT
Kpol_543.35        RQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLT
ZYRO0C01848g       RQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTFT
Skud_4.368         RQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLT
YDR107C            RQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLT
Smik_4.353         RQVPYQPWYLRTIQATLIAGIFCFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLT
Suva_2.267         RQSPRQPWYLRTIQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLA
KNAG0G01990        RQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWYNKIFYMFGFLFVSFLLLTLT
KAFR0B02680        RQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKIFYMFGFLFVSLLLLALT
Skud_12.151        RQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLT
Smik_12.142        RQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLT
YLR083C            RQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLT
Suva_10.167        RQIPFQPWYLKTLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLT
NDAI0B02370        RQIPFQPWYLKTWPATLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFFLLTLT
NCAS0B04970        RQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTLT
KLLA0F18931g       RQIPFQPWYLKTIPVALLAGIFPFGSIAVELYFIYSSLWFNKIYYMFGFLFFSFILLALT
SAKL0H17248g       RQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIFYMFGFLFFSFLLLTLT
KLTH0G13882g       RQIPFQPWYLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLT
Kwal_56.23577      RQIPFQPWYLKTAPAALIAGIFPFGSIAVELYFVYSSLWFNKIFYMFGFLFVSFLLLTLT
                   .  * * *::.:  .  :.* . *.:: *::*::* *:*   :::*:** : :  *: ::

Ecym_4317          TSLVTILLTYYSLCMENWKWQWRSFIIGGVGCSVYVFLHSLFFIKFKFPGFVSMVLYLGY
TBLA0H01450        SVLVSIIVVYHSLCLENWRWQWRSFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGY
TDEL0F03810        TALVTVMITYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFFTEFKLRGFTTIVLYVGY
NCAS0B03890        ITLVTILFTYHSLCQENWKWQWRGFFIGGLGCSIYVLLHSLFFIELKLGGFTNILLYMGY
NDAI0J01420        VSLVTVLFTYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGY
AGR097W            TALVTILLTYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFTKFRLGGFVTIVLYVGY
TBLA0E04370        TSLVTIIVTYHSLCLENWRWQWRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGY
CAGL0B01683g       TGLINVIITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGY
TPHA0A01840        TSLVTVLITYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGY
Kpol_543.35        TTLVTILITYYSLNLENWRWQWRSFIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGY
ZYRO0C01848g       TALVTILTTYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGY
Skud_4.368         TSLITVLITYHSLCLENWLWQWRSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGY
YDR107C            TSLVTILITYYSLCLENWLWQWRSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGY
Smik_4.353         TSLVTVLITYHSLCLENWQWQWRSFIIGGLGCSVYMFIHSILFTKFKLGGFITIVLYFGY
Suva_2.267         TSLVTVFITYHSLCLENWSWQWRSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGY
KNAG0G01990        TVLVTILITYHSLSLENWQWQWRSFIVGGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGY
KAFR0B02680        TSLVTVLITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFTKFKLGGFTTVVLYLGY
Skud_12.151        TSLVTILITYHSLCLENWKWQWRGFIVGGVGCALYVFIHSILFTKFKLGGFVTIVLYVGY
Smik_12.142        TSLVTILITYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGY
YLR083C            SSLVTILITYHSLCLENWKWQWRGFIIGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGY
Suva_10.167        TSLVTVMITYHSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGY
NDAI0B02370        TSLVTILITYHSLCLENWMWQWRGFIIGGVGCAIYVFIHSILFTKFKLGGFTTIVLYVGY
NCAS0B04970        TSLVTILITYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSILFTKFKLGGFATIVLYVGY
KLLA0F18931g       TSLITVLLTYHSLCMENWKWQWRSFVIGGCGCAFYVFCHSILFTKFRLGGLTTIVLYLGY
SAKL0H17248g       TTLVTVLLTYYSLCMENWKWQWRGFWIGGAGCAFYVFVHAILFTKFKLGGLTTVVLYLGY
KLTH0G13882g       TSLITVLLTYYSLCLENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGY
Kwal_56.23577      TALVTVLLTYYSLCLENWKWQWRGFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGY
                     *:.:: .* :*  *** ****.*  .* *.: * :  :: *  ..: *. . :**.**

Ecym_4317          SAMVSIVCCLVTGSIGFLANLWFVRKIYSNIKVD
TBLA0H01450        SSLICVVSCLITGAVSFMCNMFFVKRIFTSIKVH
TDEL0F03810        SMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD
NCAS0B03890        SSVVTALIFLVTGSVGFLSSMFFIKRIFSSVKVD
NDAI0J01420        SFVITSLAFVVTGALGFLSSMLFVRTIYSAVKVD
AGR097W            SLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD
TBLA0E04370        SALIAILCAMVTGAIGFISNMFFVKKIYSSIKVE
CAGL0B01683g       SFLISFLTCIVTGAIGFICSMFFVRRIFASIKVD
TPHA0A01840        TLLLSILSCIVTGAVGFISSMIFVRKIYSNVRVD
Kpol_543.35        SLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD
ZYRO0C01848g       SGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD
Skud_4.368         SFIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKVE
YDR107C            SLIISALCCVVTGAIGFFSSMFFIRKIYSAIKVE
Smik_4.353         SFIISALCCVVTGAIGFFSCMLFIRKIYSAVKIE
Suva_2.267         SFIISALCCVVTGAIGFFSSMIFIRKIYSRIKVE
KNAG0G01990        SAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE
KAFR0B02680        SSIISLLCCIVTGSIGFLSSMFFVRKIFSSIKVD
Skud_12.151        SYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD
Smik_12.142        SSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD
YLR083C            SSVISLLCCLVTGSIGFISSMLFVRKIYSSIKVD
Suva_10.167        SSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD
NDAI0B02370        STIISLLFCIVTGAIGFLSSMFFIRKIYSSIKVE
NCAS0B04970        STMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD
KLLA0F18931g       SILISGLCCLVTGAIGFLSSLILVRKIYSCVKVD
SAKL0H17248g       SVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD
KLTH0G13882g       SLVMSLLSCLITGTVGFLSSLWFVRRIYSSVKVD
Kwal_56.23577      SLVISLLTCLITGAVGFMSSLWFVRRIYSSIKVD
                   : ::  :  : **::.*.. : ::. *:  :.: 

FASTA FORMAT for MUSCLE Version 3.6

>Ecym_4317
--------------------------------------------------------MRLI
RSFLLCAGVSYGFYFPGVSPVTYHIGDEIPLLVNYLS-------------------SDFL
WNIDYYSDSIGLCKP--NTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI-
--DTALWNTFFGYRYSYNWLVDGLPVLGI--DGTSDANGYHNNSEL-FMGY---------
--------------------------------------------------------QADE
QKYIYNHFDIYIHYNDRGKGEYRVVFAEAKPISLPRTGSELCS-KDAKPVPIGSGNHENI
TFTYSVIFKKSDISWSTRWDQYLHVYDFDIQLAELISFSLVVLLLSSVLVHSLFRVLKRD
IAAYSEFNLDDEFQQDYCWKIIHGEVFRSPSKALLLSVFVGSGSQLFFMALCTVLLGSCG
FLSPSARGSLGTVMFVLYALFGGVGSYTSMSIYKFFGGQNWKLNLILTPLLIPVFLFVTT
VLLNFFLIYAKSSGAMPFGTMVTIIILWFILSVPVSIIGSLLSWKLNRWDEHPAKTNQIA
RQVPSQPWYIKTWVATFLAGMFPFGAMAVELYYIYASIWGEIIFFMYGFLFVAFILLTLT
TSLVTILLTYYSLCMENWKWQWRSFIIGGVGCSVYVFLHSLFFIKFKFPGFVSMVLYLGY
SAMVSIVCCLVTGSIGFLANLWFVRKIYSNIKVD
>TBLA0H01450
---------------------------------------------------MNSLLTSIL
CLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFL
YSYDYYYDKFHFCRP--EKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIP
ADDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSV------EHM
SGGSKVT---------------------IPGVSKLVNEAVKAYKKREAKNVPAGLITAEE
VEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDFESCT-PTGNQLHLNENAENQV
LFTYSVDFIKSETAWATRWDKYLHTYDPSIQWFSLINFTIVVVLLSTIVIHALLRALKKD
ISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALG
FMSPSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFFHGPYWKANMILTPLLVPGSMLLLI
IFLNFFLLGVHSSGTIPASTIILMICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIP
REIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFT
SVLVSIIVVYHSLCLENWRWQWRSFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGY
SSLICVVSCLITGAVSFMCNMFFVKRIFTSIKVH
>TDEL0F03810
-------------------------------------------------------MHFFF
TALSLLWAVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYL
YSYDYYNSKLHFCKP--ENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIP
GEDAAFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEI------MQG
VHNGAMA----------------------------TPREETGISAHGS-----NVVVNLE
LPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQTS-NSCE-FTGEQISLSEDQDNEV
LYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFSLISCVIVVIGLSSVVLHMLLRALKSD
FARYNELNLDDEFHEESGWKLSHGDVFRMPNKSLLLSVLVGSGVQLLLLAVGGIVIAAIA
FNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKVNMILTPFLIPGLILLTI
ISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAIKTCSWDQHPTKTNQIA
RQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQFFYMFGFSMVSLFLLVLT
TALVTVMITYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFFTEFKLRGFTTIVLYVGY
SMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD
>NCAS0B03890
-------------------------------------------------------MNYVI
LSLLFCLSVVEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDISTAKKYVV
HSYDYYYEKFHFCQP--VHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCESIIP
GKDAEFINKLIKNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEI------RQT
TGDKLLP---------------------------DSVHDISDLAKRDAKNLVQNLIKEVE
VPYFVNHFDIVIEYHERGNGNYRVVGATVNPVSIARKSAGDCT-PTGKSLTLNEEEDNNV
HSTYSVTFVPSKTSWVTRWDKYLHVYDPKIQWFSLINFSLIVILLSVILINSLLKALKSD
FARYNNINLDDDVKEESGWKLVHGYVFRIPKNPMILSILVGSGFQLFLVIVCTVFLAAID
ILSPIYRGALPTAMIILYILFGFISSYVSMGVYKFFKGPYWKVNMLLTPILVPGLIIITF
LALNLFLMFSESSSVVPAKTIMTLILLWFAVSIPLSVAGSLMAQKKCHWDEHPTVTNQIA
KVIPPQKWYLKTIPASLIGGLFSFGSISVQLYFIYTSLWFNNIFYMYGFLLFSICLFTMT
ITLVTILFTYHSLCQENWKWQWRGFFIGGLGCSIYVLLHSLFFIELKLGGFTNILLYMGY
SSVVTALIFLVTGSVGFLSSMFFIKRIFSSVKVD
>NDAI0J01420
------------------------------------------------------------
---------------------------------------MHYHHKNQEGQDISTDDKRTI
YSYDYYYEKLHFCKP--EHVEKAGVSIGSVLFGDRLYNSPFQLNMLKNKTCERLCNSTII
GRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYGNGFELGLVEI------RQT
TGEKLLP---------------------------NSADTFRDLHKRDAKNIVQNLMQDIE
VPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCK-PTGKALSLSESEVNYI
HFTYSVEFIPSETAWVTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQALKSD
FSRYGELNLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVG
LITPGSRGTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGLLLLVI
IGLNIFLIFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVS
KVIPPQKWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAILFTLT
VSLVTVLFTYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGY
SFVITSLAFVVTGALGFLSSMLFVRTIYSAVKVD
>AGR097W
--------------------------------------------------------MIAL
VAWVAWLGLAQGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERYL
YAYDYYYPRLHMCRP--DKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVP
AEDAKFINQLIRSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRV--------IRG
TEDRNQE-----------------------------EPGEIELQTR---RVLQPGESVVA
VPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCA-NSGNGLVLSETADTKV
TFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYSLINFSLVVLLLSSIMVHSLFRALKTD
LDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQLFLMSACTLFIAMLG
FLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVNMVLTPLLVPGIIFATM
LLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARKKNTWDQHPTKTSQIA
KQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWFNTMFYMFGFLFFTFLLLTLT
TALVTILLTYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFTKFRLGGFVTIVLYVGY
SLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD
>TBLA0E04370
----------------------------------------------------MTKLITAV
SICLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFL
YSYDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIP
GDDAKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEM------IQV
VDEAPSH------------------TTPKQPIVEDVLSQELDEEQATEKRANQMLVSSVE
RTYFANHFDIHIEYHDRGNNEYRIVGVTVNPISMKRDS-AICD-TNLGKLALSEVSDTDV
IFTYSVTFEKSDTVWATRWDKYLHIYDPTIQWFSLINFTVIVVVLSIIVVHFLTKALKND
FVRYNEFNLNDSFDEDSGWKLAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALG
FLSPSARGSLPTIMFILYAVFGFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFI
ISMNLFLVFVHSSDVVPIGTLSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVL
RQIPFQPWYLKTVPATLIGGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMT
TSLVTIIVTYHSLCLENWRWQWRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGY
SALIAILCAMVTGAIGFISNMFFVKKIYSSIKVE
>CAGL0B01683g
-------------------------------------------------------MVRQL
LVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARML
YPYDYYNEKLHFCQP--EKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIP
GKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEV------RQA
VGGKIVSESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVE
VPVFANHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEV
MFTYSVKFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSD
ISRYNEFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALG
ILSPSSRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTV
IFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIP
RQIPFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFT
TGLINVIITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGY
SFLISFLTCIVTGAIGFICSMFFVRRIFASIKVD
>TPHA0A01840
-------------------------------------------------------MRCSY
LLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKV-ESREKML
YSFDYYFPKLHFCKP--EKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIP
GSDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEI------KKN
VGGLGIPMDAKTKDSGKKNSNSDKKKDSKKKDDSQKKEDSNKKEKREPKRIS-KLVHNVE
FPYLANHYVINVEVHDRGEGNYRVVGVTVDPYS---TTDSANP-EKGNKLFLDEKKDNEV
TFSYSVNFIESETVWATRWDKYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSD
FARYEEFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIG
IISPSSRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSI
LGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIA
RQIPFQSWYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLT
TSLVTVLITYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGY
TLLLSILSCIVTGAVGFISSMIFVRKIYSNVRVD
>Kpol_543.35
-----------------------------------------------------MMMKTIF
CLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFL
YSFDYYFPKLHFCKP--EHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIP
ADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHV------RQA
VGGLASS------------------------------KLNLENPAREAKNVN-NMVHNVE
IPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKS---STGDICT-KKSGGLILLETEDNEV
QFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLINFSVVVILLSMVVIHSLMRALKSD
FARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIG
ILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISI
VGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIA
RQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLT
TTLVTILITYYSLNLENWRWQWRSFIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGY
SLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD
>ZYRO0C01848g
------------------------------------------------------MLSHSL
LFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHYL
YSYDYYYSKFHFCKP--ENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIP
GEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDV------TEG
FSDSNDE--------------------------------------------EKKIMKTLE
VPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQ-YNSGSLTLSETEENEV
HFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCSVIVVALSSVVLHMLLRALKND
LSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRSLLLSILVGSGVQLFLMIACSIIFAALG
FLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTI
ILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIA
RQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTFT
TALVTILTTYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGY
SGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD
>Skud_4.368
------------------------------------------------------MKQSIW
LALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFL
YSYDYYNERFHFCRP--EHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIP
GRDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDV------IQT
VGDETVP-------------------NTMEEADMDASNAGATLHIRSPKNIRPNPVKTVE
LPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIERSSPGSCS-RTRKPLTLHEDRDNEV
YFTYSVKFVASATVWATRWDKYLHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSD
LTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFG
LVSPISRGSLQTVMFLLYALFGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAILLLI
VAMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIA
RQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLT
TSLITVLITYHSLCLENWLWQWRSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGY
SFIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKVE
>YDR107C
------------------------------------------------------MKRGVW
LLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFL
YSYDYYNKRFHFCRP--EHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIP
GKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDV------KQT
VDGKAVP-------------------STMEELTSEASNEDVILDARLPKNVKPNLVKTVE
LPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSIERSSPGACS-TTGKPLILDEDKDNEV
YFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFSLINFSVIVILLSSVVMHSLLRALKSD
LARYNELNLDNEFHEDSGWKLGHGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVG
LVSPVSRGSLPTVMFVLYALFGFVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLI
VIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIA
RQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLT
TSLVTILITYYSLCLENWLWQWRSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGY
SLIISALCCVVTGAIGFFSSMFFIRKIYSAIKVE
>Smik_4.353
------------------------------------MKFSSGCINTHVDNQYRVMKQSIW
LLLFFYIGLTKAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISSDKEHYL
YSYDYYNERFHFCRP--EHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCENTIP
GKDAKFINKLIKSGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAV------KNT
IDGKVIP-------------------STMEELDSETSNTGAALDAREPKNIKPNLVKTVE
LPYFVNHFDIEVEFHDRGDDNYRVVGVTVNPMSIERSSPDSCS-KATKPLILDEEGDNEI
YFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFSLINFSVIIVLLSSVVMHSLLRALNSD
LSRYNELNLDNEFHEDSGWKLGHGDVFRTPTKSMLLSVLVGSGVQLFLMIICSIFLAALG
LVSPVSRGSLPTVMFVFYALFGFVGSYTSMGVYKFFHGPYWKANLILTPILLPGGIFVLI
VAMNFFLLFAHSSGVIPASTLFFIIFLWFAVSIPLSFAGSMIAHKWCNWDEHPTKTNQIA
RQVPYQPWYLRTIQATLIAGIFCFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLT
TSLVTVLITYHSLCLENWQWQWRSFIIGGLGCSVYMFIHSILFTKFKLGGFITIVLYFGY
SFIISALCCVVTGAIGFFSCMLFIRKIYSAVKIE
>Suva_2.267
------------------------------------------------------MRKGIW
LALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFL
YSYDYYNDKFHFCKP--EHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIP
GKDAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDV------KQT
VGGKTIP-------------------STMEELDSEDSKTGATLDARDPKNIKPNLVQTIE
LTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSIERSSPGACS-TTGEPLTLVEDKDNDV
YFTYSVKFIASDTVWATRWDKYLHVYDPQIQWFSLINFSIIVILLSSVVIHSILRAVRSD
FARYNELNLDNEFHEDAGWKLGHGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALG
LVSPASRGSLPTVMFVLYALFGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLI
VAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIA
RQSPRQPWYLRTIQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLA
TSLVTVFITYHSLCLENWSWQWRSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGY
SFIISALCCVVTGAIGFFSSMIFIRKIYSRIKVE
>KNAG0G01990
---------------------------------------------------MISHTVHLG
LALLWACGQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKSRYL
YSYDYYYDRFHFCQP--EKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIP
GKDAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEV------VQA
VAQAKTH-------------------------PKEDDSGSAKLSTRDAKNV--QMLKNVE
LPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPGTCQ-TSGDPLMLDEKNDNEV
YFTYSVRFVASDTVWATRWDKYLHTYDPTIQWFSLVNFSIVVVLLSSVVIHMLLKALRSD
FARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALG
FLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKANMILTPLLVPGCLLLSI
VGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVA
RQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWYNKIFYMFGFLFVSFLLLTLT
TVLVTILITYHSLSLENWQWQWRSFIVGGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGY
SAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE
>KAFR0B02680
-------------------------------------------------------MTRLL
LLISLFLSLTRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYL
YSYDYYYDRFHFCQP--EKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIP
GNDAKFINKLIKNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDV------VQA
VDETEAR------------------------TKVAAANQGAELDARDAKNV--KTIKNVE
LVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCE-STGQPLTLQEDEDNDV
YFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFSLIVLLLSTVVLHSLLKALKND
FARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMLLSVLVGSGVQLFIMISTTIFFAALG
FLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKANMVLTPILVPGSIFITI
IAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVANKKCNWNEHPTKTEQIA
RQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKIFYMFGFLFVSLLLLALT
TSLVTVLITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFTKFKLGGFTTVVLYLGY
SSIISLLCCIVTGSIGFLSSMFFVRKIFSSIKVD
>Skud_12.151
------------------------------------------------------MAYIQL
LLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFL
YSYDYYYDRFHFCRP--KHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIP
GNDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEV------SQG
TRSKTAP------------------------KQAETTNEGLELGTRAEDY---SIVETFE
HPYFANHFDIMIEYHDRGGGDYRVVGVIVNPLSIKRSITGTCE-TDASPLILDEERDNEV
SFTYSVKFKESATSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSD
FARYNELNLEDDFQEDSGWKLNHGDVFRPPSHSLLLSILVGSGVQLFLMVTCSIFFAALG
FLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLLLTPLLVPGAILLII
VALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARKKCGWDEHPTKTNQIA
RQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLT
TSLVTILITYHSLCLENWKWQWRGFIVGGVGCALYVFIHSILFTKFKLGGFVTIVLYVGY
SYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD
>Smik_12.142
------------------------------------------------------MAYLQL
LLLYFLVSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFL
YSYDYYNSRFHFCKP--EKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIP
GNDAKFINKLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEV------TQG
TASEATP------------------------NTAETTNQGVELDTRDGH----NMVQTYE
HPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCE-TDGSPLMLDEENDNEV
YFTYSVKFVESETSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSD
FARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSGVQLFFMVTCSIFFAALG
FLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKANLILTPLLVPGTILIII
IALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIA
RQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLT
TSLVTILITYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGY
SSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD
>YLR083C
--------------------------------------------------MIYKMAHVQL
LLLYFFVSTVKAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSGDKENFL
YSYDYYYNRFHFCQP--EKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCKTVIP
GDDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQV------TQG
TDIEATP------------------------KGAETTDKDVELETRNDR----NMVKTYE
LPYFANHFDIMIEYHDRGEGNYRVVGVIVEPVSIKRSSPGTCE-TTGSPLMLDEGNDNEV
YFTYSVKFNESATSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSD
FARYNELNLDDDFQEDSGWKLNHGDVFRSPSQSLTLSILVGSGVQLFLMVTCSIFFAALG
FLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLILTPLLVPGAILLII
IALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLIARKRCHWDEHPTKTNQIA
RQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLT
SSLVTILITYHSLCLENWKWQWRGFIIGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGY
SSVISLLCCLVTGSIGFISSMLFVRKIYSSIKVD
>Suva_10.167
------------------------------------------------------MAYIQL
FLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFL
YSYDYYYDKFHFCKP--EHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIP
GDDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEV------AQV
VDSETEQ----VQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGK---NMVKTRE
FPYFANHFDIKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCE-TNGSPLVLDEANDNEV
YFTYSVKFEESPTSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSD
FARYNELNLDDDFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALG
FLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVI
IALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIA
RQIPFQPWYLKTLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLT
TSLVTVMITYHSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGY
SSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD
>NDAI0B02370
MLHQGQEERYMSLKTSIRTAHLFEVVPKIETNYSYCIDYHTSILYLPFKLRKTMIAPSLV
LLFAFCLSLTRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMKSDKERFL
YSYDYYYDRFHFCQP--EHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLCKTTIP
GKDAKFINKLIKNGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDV------VQG
TTTGDNA---------------------NTVAKKPTTNEGLELDTRDAKNV--QMLKNFE
LPYFANHFDIQVEYHDRGENNYRVVGVIVNPVSIKRSTPGTCE-TSGAPLMLSEDQDNDV
YFTYSVKFIPSETIWATRWDKYLHIYDPAIQWFSLINFSVVVLLLSSVVIHSLLKALKSD
FARYNELNLDDDFQEEAGWKLGHGDVFRIPHRSLLLSVLVGSGVQLFLMIICSIFFAALG
FLSPSSRGSLATVMFILYALFGFVGSYTSMGVYKFFGGPYWKVNMLLTPILVPGLIFCGI
VALNIFLLFVHSSGVIPAVTLFFMILLWFVFSIPLALAGSLIAHKKCNWDEHPTKTNQIA
RQIPFQPWYLKTWPATLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFFLLTLT
TSLVTILITYHSLCLENWMWQWRGFIIGGVGCAIYVFIHSILFTKFKLGGFTTIVLYVGY
STIISLLFCIVTGAIGFLSSMFFIRKIYSSIKVE
>NCAS0B04970
-----------------------------------------------------MLSPRLV
LFFTFFLSLTRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKS--KNKEHFL
YSFDYYFDRLHFCKP--EHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIP
GKDAKFINKLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVES------FQA
IDGQAPA----------------------TTKPKQTTNEGLELETREAKNV--QMVKNIE
IAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTCE-TTGDPLVLSEDADNDV
YFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFSLVNFSIIVLLLSSVVIHSLMKALKSD
FARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMLLSVLVGSGVQLFLMISCSIFFAALG
FLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTI
VGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIA
RQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTLT
TSLVTILITYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSILFTKFKLGGFATIVLYVGY
STMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD
>KLLA0F18931g
--------------------------------------------------MFTYLWRSLL
VSTLIGSLLVEAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHDT-GDKEGFL
YSYDYYYKKFHFCQP--AELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIP
GKDAKFINKLILNGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDV------LSD
YEPDTRS-----------------------------LHDELELQLNAKKNVLSPGDKVTE
IPYFVNHYDIQIEYHDRGENNYRIVGVTVNPASIKRDSPDSCE-STGKSLVLSETEDNEV
YFTYSVKFIKSDTVWATRWDKYLHVYDPKIQWFSLINFSTIVVLLSSVMLHSLYSALKND
LARYNELNLDTDFEEETGWKLIHGDVFRSPNKALLLSVLVGSGGQLALMLTTTILFACLG
FLSPSSRGSLSTVMFLLYAIFGSFGSFTSMATYKFFNGKAWRLNLVLTPLLVPGSILTVV
LGLNFFLIFVHSSGAIPFQTMLVLVLLWFVISIPLSAIGSVIAWKKCNWNEHPTKTNQIA
RQIPFQPWYLKTIPVALLAGIFPFGSIAVELYFIYSSLWFNKIYYMFGFLFFSFILLALT
TSLITVLLTYHSLCMENWKWQWRSFVIGGCGCAFYVFCHSILFTKFRLGGLTTIVLYLGY
SILISGLCCLVTGAIGFLSSLILVRKIYSCVKVD
>SAKL0H17248g
---------------------------------------------------------MLL
LLLLPLLQIASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFL
YSYDYYYDKFHFCRP--ENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIP
KDDAKFINKLIRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDV------VDT
IEDPDTK-------------------KVSESDYIEIADADKELKERSA--------KLTE
LSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCD-TEGEPLVLSEDADNTV
HFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFSLISFSLIVILLSSVMVHSLFRALKND
LSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGAQLFLMAGFTILFALLG
LLSPSSRGSLTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKLNMILTPILIPSMIFISM
LGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISRKKSQWD-RPTNTNQIA
RQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIFYMFGFLFFSFLLLTLT
TTLVTVLLTYYSLCMENWKWQWRGFWIGGAGCAFYVFVHAILFTKFKLGGLTTVVLYLGY
SVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD
>KLTH0G13882g
------------------------------------------------------MVSAIL
LLSILWASQVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-GDKESLL
YSYDYYYPKFHFCRP--EKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIP
ADDAKFINKLITNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNG
QGGSQDG---------DDSGSHGSTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLE
TPYFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCD-KTGELLKLSETEATEV
HFSYSVKFTPSETVWATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDD
LSRYNQINLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLG
LLSPSSRGSLTTVMFILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVM
LALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIP
RQIPFQPWYLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLT
TSLITVLLTYYSLCLENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGY
SLVMSLLSCLITGTVGFLSSLWFVRRIYSSVKVD
>Kwal_56.23577
-----------------------------------------------------MILSATL
LLSALCASRVEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDT-GDRESFL
YSYDYYYDKFHFCKP--EKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIP
ANDAKFINKLIANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDG
QGEEDAH--------------PKGATKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLE
TAYFANHFNIEVQYHDRGNGDYRVVGVIVNPQSIKRDSSNSCA-ATGELLKLSEEEETTV
HFSYSVKFTPSDTVWATRWDKYLHVYDPKIQWYSLINFSIVVIVLSSVVIHSLYRTLRDD
LSRYNQLNLDDDFQEETGWKLVHGDVFRTPTKSLLLSVLVGSGTQLFVMAACTIAFALLG
LLSPSSRGSLTTVMFILYALFGSLGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVV
LGLNFFLIMVESAGAIPFGTMCAIVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIP
RQIPFQPWYLKTAPAALIAGIFPFGSIAVELYFVYSSLWFNKIFYMFGFLFVSFLLLTLT
TALVTVLLTYYSLCLENWKWQWRGFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGY
SLVISLLTCLITGAVGFMSSLWFVRRIYSSIKVD