MUSCLE (3.8) multiple sequence alignment

KAFR0G02680        MSSPATENTSIRKNPNTRANKRRANQNVYNAKYTIFGVIGLLACFVFQKIVLEPRRIKWG
NCAS0H00840        ------------MKKEEKLEKKVPPTGTFSVSLGKYILIAALVLVLTVVFQFKSPTVM--
KLLA0D01243g       ------------------------------------------------------------
TDEL0G04460        ---------MLMTKKNSKKNICRNQCYGYKLGLLLLALWLGIRFSLLEESITSRKIIT--
TPHA0M00280        ------------------------------------------------------------
NDAI0D00830        -MSEPIPPTPKTKKPFYRYFKFLATLLLFLVPLIFSISMSKTKEQQPQQHQQVFTNKN--
ZYRO0C07722g       MSESEKGRVTGINYLKVLIFTLVGLIAFQSCSYLTSNKDNKQLFSFLSGQEQNPKEPI--
KNAG0M01190        MTDLLCQLCSVRFLLDSSHIKGRGTCWFIGKRSSFSQLFSLYSTQNTIQYRRVVHCYS--
KAFR0A05080        ------------------------------------------------------------
NDAI0C02620        ------------------------------------------------------------
NCAS0D02170        ------------------------------------------------------------
Kwal_56.22439      -------------------------------------------------------MFK--
SAKL0E01342g       ------------MRPTTQKTVYILALFAVLVSWASSK-----------------------
KLTH0C11154g       ------------------------------------------------------------
                                                                               

KAFR0G02680        LEDFRQNNFNEEKQEDEMSRIIHQRSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFL
NCAS0H00840        ---------DQVNEDSATAESQKERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFL
KLLA0D01243g       ---------------MGLNVVSKVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFL
TDEL0G04460        ---------DFISQSETMSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFL
TPHA0M00280        -------------------MSQNTRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFL
NDAI0D00830        ---------IVNEDIARIATTDDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFL
ZYRO0C07722g       ---------NYQFNDGIMSKSISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFL
KNAG0M01190        -------TISPTTTATTTTEMPEFRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFL
KAFR0A05080        --------------MATTENATTFRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFL
NDAI0C02620        -----------------MSKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFL
NCAS0D02170        -----------------MTKSMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFL
Kwal_56.22439      ---------SNITDIEHSELMKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFL
SAKL0E01342g       ---------YFMSNKGQENRMSKVRTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFL
KLTH0C11154g       --------------------MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFL
                                           *:: : * . :  ** ** *.*::*:    .*.***

KAFR0G02680        MLDDFDVTPPA-GFPDHPHHGQETITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIV
NCAS0H00840        MLDDFKVTPPE-GFPDHPHHGQETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIV
KLLA0D01243g       MLDNFDVSPPA-GFPEHPHHGQETITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIV
TDEL0G04460        MLDHFTVSPPA-GFPDHPHHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAII
TPHA0M00280        MLDHFNVIPPA-GFPDHPHHGQETITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVC
NDAI0D00830        MLDHFKVTPPEQGFPDHPHHGQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIV
ZYRO0C07722g       MLDDFFVKPPA-GFPDHPHHGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIV
KNAG0M01190        LLDHFTVSHPA-GFPDHPHHGQETITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIM
KAFR0A05080        LLDHFTVSHPA-GFPDHPHHGQETITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIM
NDAI0C02620        LMDHFTVSHPA-GFPDHPHHGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIM
NCAS0D02170        LMDNFTVSHPA-GFPDHPHHGQETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIM
Kwal_56.22439      MLDHFTIAPPA-GFPDHPHHGQETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTV
SAKL0E01342g       MLDHFNVTPPA-GFPDHPHHGQETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIV
KLTH0C11154g       MLDHFNVSPPA-GFPDHPHHGQETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGII
                   ::* * :  *  ***:********:*:   * :***** . .*:* .*********..  

KAFR0G02680        HSEIPVTMENGGSCRGLQLWVDLPQDLKTIEPRYRNLRAADIPIAMPYE--NLKVYVISG
NCAS0H00840        HCEMPVTMNDSAVSTGLQFWVDLPADLKNCEPRYRNLRADTIPVVQVND--NLNVKVISG
KLLA0D01243g       HSEIPVKMDNGESTQGLQLWVDLPNDIKNVEPRYRDLRREEIPLATPSD--NLIVKVISG
TDEL0G04460        HSEIPVKMDSGQPAVGLQLWVDLPEKLKNCEPRYRDLKAKDIPVIKPSE--HLKVTVISG
TPHA0M00280        HSEMPVLMENGEILDGLQLWVDLPTNLKNTEPRYRDLHKENIPIAKPDE--NLEIEVISG
NDAI0D00830        HSEMPVLMKDGRPGIGLQLWVDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISG
ZYRO0C07722g       HSEIPVSLEDGSASNGLQLWVDLPAELKNCEPRYRDLRKKQTPEVKVND--NLTVRVISG
KNAG0M01190        HSEIPVLMENGDAGVGLQLWVDLPKDMKDCAPRYRNLRGTEIPIAEPNE--HLKIKVISG
KAFR0A05080        HSEIPVLMENGDAGVGLQLWVDLPQEMKDCEPRYRNLRGGEIPIVEPNE--HLKVKVISG
NDAI0C02620        HSEIPVKMENGTPGIGIQLWVALPIDLKNSEPRYRNLRGDKIPIIKPNE--NLTVRVISG
NCAS0D02170        HSEIPVQMNNGDAGIGIQLWVDLPKKLKNCEPRYRNLRATEIPIVKPND--DLTVRVVSG
Kwal_56.22439      HSEIPVQLESGDPTEGIQLWVDLPARLKDCQPRYRDLKRDRIPTARSKN--GLNISVISG
SAKL0E01342g       HSEIPVKMESGEPTVGLQLWVDLPERLKNCEPRYRDLRGAETPIAEPHQ--NLKVRVISG
KLTH0C11154g       HSEIPVELESGAPSVGLQLWVDLPMHLKDCEPRYRDLLNNEIPSVQPKA--GLEVRVISG
                   *.*:** :...    *:*:** **  :*   ****:*     *         : : *:**

KAFR0G02680        KSYDVESLNDLAYTPVHLYHFVTIKAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKENT
NCAS0H00840        KSYDVESVKDLAYTPIDFYYFISNKAGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHS
KLLA0D01243g       ESYGVKSLTELAYTPVEFYHFIANKKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESS
TDEL0G04460        TSYGVQSARDLAYTPVHYYHFATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFS
TPHA0M00280        KSYGIESVKDLAYTPVDFYVYKARKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHS
NDAI0D00830        NAYGVDSVRDLAYTPIHFYHYISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNT
ZYRO0C07722g       KSYGVDSVQELAYTPVHFYHFITSKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHS
KNAG0M01190        KSHGIDSVKELAYTPVDFYHYISDKKGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYS
KAFR0A05080        RSYGVESVKELAYTPVDFYHFISNKKGTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYS
NDAI0C02620        KSYGTESVKDLAYTPIDYYIFNMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYS
NCAS0D02170        KSYGVESVKDLAYTPIDYYFMNTKKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYS
Kwal_56.22439      QSYGVDSIQELAYTSVHYYHYVFSEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHS
SAKL0E01342g       ESYGVQSRSELAYTPVHFYHFISSKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYS
KLTH0C11154g       ESYGVGSMSELAYTPVHFYHYITRKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYS
                    ::.  *  :****.:  *     : .  * *  .  :. *:*: ** : :    .   :

KAFR0G02680        AIFFDVDGESIEGQFATD-DSEFVLVGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYR
NCAS0H00840        SVFFQTDGNFIRGFTASD-NTEFAVIGGKILDQQVVQHGPFVETTREKLIEVFDNYRAGI
KLLA0D01243g       AIFFKNDGDGIRGFTTSD-NAEFAIIAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGV
TDEL0G04460        TVFFDTDGDAVEGFSASD-NAEFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSI
TPHA0M00280        SIFFNTDGDNVQGIVGSD-DTEFAIIGGQILRQETVQHGPFVEETVEKLVKVFHNYESYT
NDAI0D00830        AVFFNVDGHSIKGQSATN-DTEFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGI
ZYRO0C07722g       AVFFDTDGEGVAGTSVSD-DAEFVLIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGM
KNAG0M01190        TVFYNANGDAIRGMVDDD-DTEFAIIGGLILDQPVIQHGPFVETTREKIIEVFQNFQYGI
KAFR0A05080        TIFFNADGNGIKGVVSDD-DTEFAIIGGLILDQPVIQHGPFIESTREKLIEVFQNFQYGI
NDAI0C02620        TVFFDTDGDSIKGKSAADEETEFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCI
NCAS0D02170        TIFFKTDGDAIKGCSASE-DTEFVLVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCI
Kwal_56.22439      SIFFKTDGSHVSGFSGSN-DLEFILAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGT
SAKL0E01342g       AIFFKNDGEGVEGIAASD-DTEFALVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGM
KLTH0C11154g       SVFFNTDGSRVEGSGSSE-ESEFILIGGEVLDQPILQYGPFVETSKQNMYEVIGNYQSGT
                   ::*:. :*  : *    : : ** : .*  : *  :* ***:*   : : .*: ::    

KAFR0G02680        NGFERAENWESNIRKGIKEAEARELRT------
NCAS0H00840        NGFEKALGWKSSISNGIDEQTAREWYS------
KLLA0D01243g       NGFENARTWSPVIKNGVTEAEVQQYLPKGN---
TDEL0G04460        NGFDRGRNWRSTIAGGITESEAKKDFRNSKGIK
TPHA0M00280        GGFERALNWRSSIRNGIDESQAANHK-------
NDAI0D00830        NGFERAVNWRSSIADGIDEDTANALLN------
ZYRO0C07722g       NGFENAHSWDSKIAGGISEAEARKLYKE-----
KNAG0M01190        NGFERAVGWKSSIRNGILEKDVPAFEAAGEAKK
KAFR0A05080        NGFERAVGWKSSIRNGILEKDVPKFEGSA----
NDAI0C02620        NGFERARGWRSSIADGILEKDVPAFEKSSKD--
NCAS0D02170        NGFERARGWRSRIADGIHEDDVEAFEKSNPE--
Kwal_56.22439      NGFEKAAGWTSSIANGIVESDISDFVKSSG---
SAKL0E01342g       NGFERAHNWKSSISDGISQQNAEKQLKSE----
KLTH0C11154g       NGFERAQGWSSSIARGVVFSDVAKIESCE----
                   .**:..  * . *  *:                

FASTA FORMAT for MUSCLE Version 3.6

>KAFR0G02680
MSSPATENTSIRKNPNTRANKRRANQNVYNAKYTIFGVIGLLACFVFQKIVLEPRRIKWG
LEDFRQNNFNEEKQEDEMSRIIHQRSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFL
MLDDFDVTPPA-GFPDHPHHGQETITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIV
HSEIPVTMENGGSCRGLQLWVDLPQDLKTIEPRYRNLRAADIPIAMPYE--NLKVYVISG
KSYDVESLNDLAYTPVHLYHFVTIKAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKENT
AIFFDVDGESIEGQFATD-DSEFVLVGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYR
NGFERAENWESNIRKGIKEAEARELRT------
>NCAS0H00840
------------MKKEEKLEKKVPPTGTFSVSLGKYILIAALVLVLTVVFQFKSPTVM--
---------DQVNEDSATAESQKERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFL
MLDDFKVTPPE-GFPDHPHHGQETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIV
HCEMPVTMNDSAVSTGLQFWVDLPADLKNCEPRYRNLRADTIPVVQVND--NLNVKVISG
KSYDVESVKDLAYTPIDFYYFISNKAGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHS
SVFFQTDGNFIRGFTASD-NTEFAVIGGKILDQQVVQHGPFVETTREKLIEVFDNYRAGI
NGFEKALGWKSSISNGIDEQTAREWYS------
>KLLA0D01243g
------------------------------------------------------------
---------------MGLNVVSKVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFL
MLDNFDVSPPA-GFPEHPHHGQETITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIV
HSEIPVKMDNGESTQGLQLWVDLPNDIKNVEPRYRDLRREEIPLATPSD--NLIVKVISG
ESYGVKSLTELAYTPVEFYHFIANKKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESS
AIFFKNDGDGIRGFTTSD-NAEFAIIAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGV
NGFENARTWSPVIKNGVTEAEVQQYLPKGN---
>TDEL0G04460
---------MLMTKKNSKKNICRNQCYGYKLGLLLLALWLGIRFSLLEESITSRKIIT--
---------DFISQSETMSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFL
MLDHFTVSPPA-GFPDHPHHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAII
HSEIPVKMDSGQPAVGLQLWVDLPEKLKNCEPRYRDLKAKDIPVIKPSE--HLKVTVISG
TSYGVQSARDLAYTPVHYYHFATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFS
TVFFDTDGDAVEGFSASD-NAEFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSI
NGFDRGRNWRSTIAGGITESEAKKDFRNSKGIK
>TPHA0M00280
------------------------------------------------------------
-------------------MSQNTRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFL
MLDHFNVIPPA-GFPDHPHHGQETITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVC
HSEMPVLMENGEILDGLQLWVDLPTNLKNTEPRYRDLHKENIPIAKPDE--NLEIEVISG
KSYGIESVKDLAYTPVDFYVYKARKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHS
SIFFNTDGDNVQGIVGSD-DTEFAIIGGQILRQETVQHGPFVEETVEKLVKVFHNYESYT
GGFERALNWRSSIRNGIDESQAANHK-------
>NDAI0D00830
-MSEPIPPTPKTKKPFYRYFKFLATLLLFLVPLIFSISMSKTKEQQPQQHQQVFTNKN--
---------IVNEDIARIATTDDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFL
MLDHFKVTPPEQGFPDHPHHGQETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIV
HSEMPVLMKDGRPGIGLQLWVDLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISG
NAYGVDSVRDLAYTPIHFYHYISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNT
AVFFNVDGHSIKGQSATN-DTEFAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGI
NGFERAVNWRSSIADGIDEDTANALLN------
>ZYRO0C07722g
MSESEKGRVTGINYLKVLIFTLVGLIAFQSCSYLTSNKDNKQLFSFLSGQEQNPKEPI--
---------NYQFNDGIMSKSISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFL
MLDDFFVKPPA-GFPDHPHHGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIV
HSEIPVSLEDGSASNGLQLWVDLPAELKNCEPRYRDLRKKQTPEVKVND--NLTVRVISG
KSYGVDSVQELAYTPVHFYHFITSKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHS
AVFFDTDGEGVAGTSVSD-DAEFVLIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGM
NGFENAHSWDSKIAGGISEAEARKLYKE-----
>KNAG0M01190
MTDLLCQLCSVRFLLDSSHIKGRGTCWFIGKRSSFSQLFSLYSTQNTIQYRRVVHCYS--
-------TISPTTTATTTTEMPEFRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFL
LLDHFTVSHPA-GFPDHPHHGQETITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIM
HSEIPVLMENGDAGVGLQLWVDLPKDMKDCAPRYRNLRGTEIPIAEPNE--HLKIKVISG
KSHGIDSVKELAYTPVDFYHYISDKKGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYS
TVFYNANGDAIRGMVDDD-DTEFAIIGGLILDQPVIQHGPFVETTREKIIEVFQNFQYGI
NGFERAVGWKSSIRNGILEKDVPAFEAAGEAKK
>KAFR0A05080
------------------------------------------------------------
--------------MATTENATTFRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFL
LLDHFTVSHPA-GFPDHPHHGQETITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIM
HSEIPVLMENGDAGVGLQLWVDLPQEMKDCEPRYRNLRGGEIPIVEPNE--HLKVKVISG
RSYGVESVKELAYTPVDFYHFISNKKGTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYS
TIFFNADGNGIKGVVSDD-DTEFAIIGGLILDQPVIQHGPFIESTREKLIEVFQNFQYGI
NGFERAVGWKSSIRNGILEKDVPKFEGSA----
>NDAI0C02620
------------------------------------------------------------
-----------------MSKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFL
LMDHFTVSHPA-GFPDHPHHGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIM
HSEIPVKMENGTPGIGIQLWVALPIDLKNSEPRYRNLRGDKIPIIKPNE--NLTVRVISG
KSYGTESVKDLAYTPIDYYIFNMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYS
TVFFDTDGDSIKGKSAADEETEFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCI
NGFERARGWRSSIADGILEKDVPAFEKSSKD--
>NCAS0D02170
------------------------------------------------------------
-----------------MTKSMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFL
LMDNFTVSHPA-GFPDHPHHGQETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIM
HSEIPVQMNNGDAGIGIQLWVDLPKKLKNCEPRYRNLRATEIPIVKPND--DLTVRVVSG
KSYGVESVKDLAYTPIDYYFMNTKKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYS
TIFFKTDGDAIKGCSASE-DTEFVLVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCI
NGFERARGWRSRIADGIHEDDVEAFEKSNPE--
>Kwal_56.22439
-------------------------------------------------------MFK--
---------SNITDIEHSELMKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFL
MLDHFTIAPPA-GFPDHPHHGQETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTV
HSEIPVQLESGDPTEGIQLWVDLPARLKDCQPRYRDLKRDRIPTARSKN--GLNISVISG
QSYGVDSIQELAYTSVHYYHYVFSEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHS
SIFFKTDGSHVSGFSGSN-DLEFILAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGT
NGFEKAAGWTSSIANGIVESDISDFVKSSG---
>SAKL0E01342g
------------MRPTTQKTVYILALFAVLVSWASSK-----------------------
---------YFMSNKGQENRMSKVRTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFL
MLDHFNVTPPA-GFPDHPHHGQETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIV
HSEIPVKMESGEPTVGLQLWVDLPERLKNCEPRYRDLRGAETPIAEPHQ--NLKVRVISG
ESYGVQSRSELAYTPVHFYHFISSKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYS
AIFFKNDGEGVEGIAASD-DTEFALVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGM
NGFERAHNWKSSISDGISQQNAEKQLKSE----
>KLTH0C11154g
------------------------------------------------------------
--------------------MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFL
MLDHFNVSPPA-GFPDHPHHGQETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGII
HSEIPVELESGAPSVGLQLWVDLPMHLKDCEPRYRDLLNNEIPSVQPKA--GLEVRVISG
ESYGVGSMSELAYTPVHFYHYITRKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYS
SVFFNTDGSRVEGSGSSE-ESEFILIGGEVLDQPILQYGPFVETSKQNMYEVIGNYQSGT
NGFERAQGWSSSIARGVVFSDVAKIESCE----