MUSCLE (3.8) multiple sequence alignment

TPHA0A04370       ----------------------------------------MHVTNGE-------------
KNAG0J01270       -------------------------------------------MVVH-------------
Kpol_1036.52      ------------------------------MADVEGPYMNQEQNPKR-------------
CAGL0K01881g      ------------------------------------------------------------
TBLA0F00720       ----------------------------------MQPSDNQRESIPSAIQQSAITTNNNS
KLLA0C04411g      ------------------------------------------------------------
TDEL0D04350       ----------------------------------MVGGSANYVGPSD-------------
KLTH0E15884g      ----------------------------------MNPEDTNMDGTP--------------
Kwal_27.9824      ----------------------------------MRPFEPPTDANS--------------
AER213C           --------------------------------------------MTD-------------
SAKL0C07964g      --------------------------MPSHATEETTPHTHGLEQHAP-------------
KAFR0A01220       --------------------------------MARSEEASTYYRNMG-------------
NDAI0A06510       MQEEQERHSSISSTATPILPSDNVAERNDDINTNENGTPSSSATSVDKNTATATHANNTE
NCAS0I01910       ------------------------------------------MSTTT-------------
ZYRO0A04994g      -------------------------------MDLRGRESPEASQEVH-------------
Suva_4.236        -------------------------------MQSAGDDRTKSDHTPS-------------
Skud_4.240        --------------------------------MHGGDGRTKSDHTPS-------------
Smik_4.221        -------------------------------MHGDTNGRTKSDHSPS-------------
YDL013W           -------------------------------MHSDTNGRTKSNNSPS-------------
                                                                              

TPHA0A04370       ----------MLRPADDFVTIVSDFEHEPRIQSVNNN-----------------DN-QVT
KNAG0J01270       ----------KMSTESPVVITDAEDDSDLE---------------------------WVR
Kpol_1036.52      ----------TKSNQDEAILIDSDLDDHLDFSDGSDSDILQLDGRTQDIAHNSSNGEVVE
CAGL0K01881g      --------MKRDGEEDPVIVLDSDNEEPANSEHEGVR---------------PLPA-IVV
TBLA0F00720       INNANSRN--GHDGHNDVIVIESDAEEDAIDKNRNVP---------WSQPRDEFHR-FAR
KLLA0C04411g      -----------MTEQGCVIEIDSDPELDAQIREEYAP-RRLIPDRRRNRPRDHLSR-FVS
TDEL0D04350       ----------PVSNSDDVILIESDDEQHSSRDSGLRS----------STTRDTMSP----
KLTH0E15884g      ----------PECSQNDVIEIESDTEDETQVLPGTLE----APDI------GQMHG-SLV
Kwal_27.9824      ----------TESGQADIIEIESGVEDNQQMLSHQDG----VPDT------LEVPR-TSE
AER213C           ----------PNAARNAVIEIESDPEEDQRIINQYRQ-TRLVPDRRLNRPRDAANR-FVS
SAKL0C07964g      ----------PSAPTQDVIEIESDPEEDERIRQQYRQ-QRLVGDRRINRPRDSLNR-FLN
KAFR0A01220       ----------SSGDQDSVILIETDEEEDERIRDENRY-RRLVPDRRIGRPRDILNR-FVS
NDAI0A06510       GSNDDRGDDNDNDNNNSAILIESDPEEDARIREESRQ-ISLVPDRRIGRPRDALHR-FIS
NCAS0I01910       ----------DHHQQDPIITIESDPEDDARIRNDQQQIIRLYPDARTDRPRDSMNR-FVD
ZYRO0A04994g      ----------INGRDEDPIIIESDQEEDQRIRDDARP-IRLHPDGRIHRPRDGLNR-FVN
Suva_4.236        ----------VSHPDNSVILIDSDKEEDASIREANLP-VRLYPDRRVGRRRDALNR-FIR
Skud_4.240        ----------VNHPDDSVILIESDKEEDASIREANLP-VRLYPDRRVGRRRDALNR-FVR
Smik_4.221        ----------ASSPDEAVILIDSDKEEDASIREANLP-VRLYPDRRVGRRRDALNR-FVR
YDL013W           ----------DNNPNETVILIDSDKEEDASIREANLP-VRLYPDRRVGRRRDALNR-FVR
                                    :   :  :                                  

TPHA0A04370       STAGSSKSTIIEHS--------------------------------NDDHHDDNDDDEIG
KNAG0J01270       C-EGDLRSTSPQVA--------------------------------------VDDDSDFA
Kpol_1036.52      SVDISNRNERYDEH-------------------------TETAVQISNSGNDSANNDDIT
CAGL0K01881g      DEEDNSGAPVEVTS---------------------------------VNADEGGDDDELT
TBLA0F00720       IYDNINERNNHSSLSATLDRGNTPTTSIPRGTLPTQTFEVGHHNNAPDNNADDDDDDDII
KLLA0C04411g      NAEDRNVAPIAPAT----------------------------------DLPVSTDGEDLE
TDEL0D04350       --NSNGSNQSEVVS-----------------------------------RESSRNADSV-
KLTH0E15884g      D-DLPSQNNASEVF-----------------------------------CNTEDDD-EIQ
Kwal_27.9824      S-DPSLRNENVETL-----------------------------------CNTDDDDDELQ
AER213C           V-SGRVAAAA------------------------------------------GEGDDEVE
SAKL0C07964g      S-QGENRNTRAALE-----------------------------------PDDDEDDDDLQ
KAFR0A01220       TRDPGDDNETTTHV--------------------------------SQEGDNNDDDDDVE
NDAI0A06510       T-NPNNTNTTSRRD------------------------------AQEENEENDENDDDFA
NCAS0I01910       A-QGSNRAIRSTPD---------------------------LSHLNDDQDQDQDDDDDIT
ZYRO0A04994g      S-EGTNVATTRSQ-------------------------------------DNGGSDDEVA
Suva_4.236        S-DTTDATPQRIGT-----------------------------TLRSDGPDTQNDIDDVT
Skud_4.240        S-DSVGINPQRIHT-----------------------------TARPNRSDPQNDNDDVT
Smik_4.221        S-DSRNRNAQRIHT-----------------------------TTTSEYSNTQGNNDDVT
YDL013W           S-DSRSRNSQRTHI-----------------------------TASSERPDFQANNDDIT
                                                                        .  .. 

TPHA0A04370       IISERVNFDTANNDNMDDLSVINEREVVDL------DREPEITS------------VANN
KNAG0J01270       ITASI---------------ERTPTDVVVV------DDEP--------------ITITST
Kpol_1036.52      IVREI--NRSPRRE----RRNESVTEYVDL------DHEPEDVE------PIGTSNLDGR
CAGL0K01881g      LLRQS-NIRVPR------RQISTPVAYINL------DDEAAHHD------ASDDIEFLGG
TBLA0F00720       ITNEIIAPVDPS------GPLNPSTEYVDL------DNEAEYSS-NNNYGHSRTLIVDGD
KLLA0C04411g      ITAEV----SLRPD----GPINDDAEYINL------DNYRASNN--------GTVVVDHR
TDEL0D04350       ------------------SPMGSTAEYIDL------EMEPAGNE-----EQDDMIVYDER
KLTH0E15884g      LLGET----VLDGN----NAAAPRLGNPNI------NRAES----------VGVAQIRPH
Kwal_27.9824      VVGES----ILSER----QTSYPETEYVDL------DRSGEGS-------------LGQR
AER213C           IVNEV----YLDDE----GPIDSTADFVDL------DEQQG---------PSSSMVINHD
SAKL0C07964g      VVGET----MLDRH----GPIGEDADFVDLSSFGGGDTGSGGSGDNRNGVPTRTAIIRHS
KAFR0A01220       IVGAIEAPRDPN------GPIDPGAEYIDL------DTEDQYASGHHGFNTPRIVVINGD
NDAI0A06510       IMDEIIDPTHNNNNINEIGPIDPTAEYVDL------DAEPEYIT----NSRPRTIIINNN
NCAS0I01910       IVREIVNPNVARDD----APINPDAEFIDL------DQEVPYAN--ATIPRPRTIQIITP
ZYRO0A04994g      IVGEI-NNTRGNEE----GPIGSDAEYVDL------DADNG----------PQVIEVNDN
Suva_4.236        IIREV--GRFFGDD----GPIDPSALYVDL------DQEPGSET----VETPRIIQVNNT
Skud_4.240        IVREV--GRFFGDD----GPIDPSAHFVDL------DHEPDSET----LETPTTLQVDNI
Smik_4.221        IIREV--GRFFGDE----GPIDPSAHYVDL------DEEPGSET----LEAPRTIRVDNA
YDL013W           IIREV--GRFFGDD----GPIDPSAHYVDL------DQEPGSET----LETPRTIQVDNT
                                               :      :                       

TPHA0A04370       T-----------------NDDDLMIVGEQVIENP---HILLNLPGGRTFELSTTTNDLPF
KNAG0J01270       RGND--------------DTDEITVLEERP-APPPPNTTELYLPGRNVMHIRTAQSDNPI
Kpol_1036.52      SSGSNVNDRDRNNS----NIDDLIIISEQH-PQPSANSIFLTIPGRQLMELQVASTDIPT
CAGL0K01881g      NLVPNAGDN---------DEDAVTLLEERL-ADG---LVPLNLPGGRRIIVNAANGEAPV
TBLA0F00720       NDNADVIDDGN-------GADDLVIVQERT-SAP---TVTLTLPGNRSIQINAAPTDRPV
KLLA0C04411g      E-----------------GDDDLMLVEERI-QES-GRPVLLQLPAGQTLQVDASWNELPV
TDEL0D04350       LSTPRDA-----------EDDELIFVQEQT-RPS---TIQLNLPGRNPMRITATEYDRPA
KLTH0E15884g      QPSAA-------------GEEDLVILEERN-NSP---SFVLNLPGGEHLQISGSPLDQPV
Kwal_27.9824      RPQAAS------------SEEDLVILEERT-SSP---SFVLNLPGGEYLRINGSPLDQPV
AER213C           GG----------------GDDDVAIIEERT-THP---TFLLNLPNGQTLRISGSVHDRPL
SAKL0C07964g      TGANGSD-----------RGDDIEILEERT-TAP---NFVLNLPGGESLRISGTTADQPV
KAFR0A01220       SNNGNN------------EDDGLEIIEERT-TRP---TVTLNLPGGESLQINASDSDRPA
NDAI0A06510       SSNNNIENSNGDANDD--DDDEVMILEERT-STP---TVTLNLPGGERLRINADPNERPT
NCAS0I01910       SPPQQQ------------QDDDLVITQERT-MRP---TVTLNLPGGQTLQVDATPTDQLA
ZYRO0A04994g      NRNNNENS----------DDDGLVIVQERT-TAP---RVTLNLPGGESLQIDASPTDRPY
Suva_4.236        NGYLNENSNENNNDNDNDNDDGLTIVEERT-ARP---RITLNLPGGERLEVNATPRDIPI
Skud_4.240        NGYLNDNFNDNDN-----NDDGLTIVEERT-TRP---RVTLNLPGGERLEVNATTTDMPI
Smik_4.221        NGYLNDSHDDNE------NDDGLTIVEERT-TRP---RITLNLPGGERLEVNATTTDIPI
YDL013W           NGYLNDNGNNNE------SDDGLTIVEERT-TRP---RVTLNLPGGERLEVTATTTDIPI
                                      : : .  *.           * :*    : :     :   

TPHA0A04370       RSSFEMLQN-----LGRNINLAGQ-DYMNLTDSTSPI--RIVPSVNTPETEGILNNTRTN
KNAG0J01270       PTSFRNLRR--DDGGSGVGEELRRSRRLRERPRWGGR--MTPRATERGQRRRRSLFVNDD
Kpol_1036.52      RSSFE-YQN------------DRRPVRLGNSGRPRIN----------------------R
CAGL0K01881g      RSSFERLMRNNQLRYLRTVPAERQNQRVQRNYRPVRNDGMFVPESDDSQDDEWE------
TBLA0F00720       RSSFG-WQG--------GVPDSRR-GMLARRYNSVRQ--LFFNSDEDASRNGSDSDSYDD
KLLA0C04411g      GRSFQ-NQV--------YRNPNQL-RRLRRHIDHATA--MFMGGYNQSGTGDSDFSDNDA
TDEL0D04350       RRSFE-QQASNRQLRHQT-RVARR-QPMRRAARRA-N--HSMNGYESDDGGLTS-NRNQI
KLTH0E15884g      RRSFQ-TQG----NRHTNSANGRR-RLLRRTARRASS--LFLHPSDEEDEGFAY---ENT
Kwal_27.9824      RRSFQ-AQA----PRQFDSAGARR-RLARRTARTASN--LFMQPSDDEQEESVE---GNT
AER213C           RRSFE------------TQRTARA-NMLRRAARSAQR--LFMNENDGEPSEREA---SDR
SAKL0C07964g      RRSFQ-NQQPSRTRAVSAAAAARR-RLLNRTARSATN--LFFSSGQGPQDGYSE--ENDP
KAFR0A01220       HRSFE-WQD--------ALPEPRR-RLLRRSAGRIRS--LFLNNSDDENNDTAA-GRQNN
NDAI0A06510       RSSFESLNE-------NIVPLSRR-QLLRRATRRATN-SLFFHGSDENESDNDT----DE
NCAS0I01910       RSSFE-WQE--------NIPLARR-QLLRRSTNRANS--LFFHDDHESDNDNGS------
ZYRO0A04994g      RRSFE-WQQ---------QDRTRR-QAMERSARRASR--LLFHTSDDDDDDSGN-GTVEN
Suva_4.236        RRSFE-FQE--------DLAASRR-QLLRRSAARARN--LFVERSDEDDENDEE-WTENT
Skud_4.240        RRSFE-FQD--------DLAVSRR-QLLRRSAARART--LFVDRSDENDEEWTE----DT
Smik_4.221        RRSFE-FQE--------DLAASRR-QLLRRSATRARS--LFVDRSDENDEDWTE----HT
YDL013W           RRSFE-FQE--------DLGASRR-QLLRRSATRARN--LFVDRSDENDEDWTD----DT
                    **                                                        

TPHA0A04370       QNISGRLSRQPRMPS---RREIRARNIRNLRITRQRNRLNRFEAQRRERKKAFRINHRRF
KNAG0J01270       G---EDISQNPRFMS---MLMTMDPEYTS-----GNHPAALDEDP-----QRRRIRAR--
Kpol_1036.52      QYMQNSFSRVRRQLL---GILRVRQSNP----------------------EIDEIARE--
CAGL0K01881g      ------------------------------------------------------------
TBLA0F00720       DYTPARLQRIQNRER---NAVRQRMMQQRRQQQILRQEQSRNESP-----IMAELRRR--
KLLA0C04411g      DYIPPDIVNERNQYT---MQTRMREQRER---QNQMQRLQRAAD------------ET--
TDEL0D04350       NYDP----------------------------------------------EFAAIQRR--
KLTH0E15884g      DLLPTGVRLRRQRNS---MMQRRPNPPRR-------QLLGTGDDVDDP--ELLSLEAQ--
Kwal_27.9824      YQLPSTVMARRQRNA---LLMQRRPQPSR------RQPVRGFGMIQSP--ELSALEAQ--
AER213C           EYLPQSVLRQRQQAL---MQERLQRQREH-----ARQHEHIADPQ---------------
SAKL0C07964g      DYIPAGVRQLRQQNA---MRDRQASLEQR----REQQRLNGMDPGANA--ELTALRSR--
KAFR0A01220       RYLPSNIRRLRQEEQ---AQMRQLAQRRRRMNEQRPEMISGNP-------RFDEIRNR--
NDAI0A06510       VSLPASILGMRQRARMMAMQERQRQRQGQGQGHSAPDTSGNSVDNTSTNRNLINLRER--
NCAS0I01910       VPLPPNVIRLRQRQQ---QQNREEPPPPP--------PPQDDANP-----IMTRLRTR--
ZYRO0A04994g      GRLPPSVLQLRRQEE---ERSRLRNITRR------RDQMRSDAMQGNP--VLMRLRER--
Suva_4.236        NDLPETIQRARRESH---MRMSRRVAERQHRIRAQQQRMVSNENMGTAI-RLQSIRER--
Skud_4.240        DNVPEAIQRARRESH---MRMSRRIAERQ--LRAQQHRMASNENMNTSI-RFQSIRER--
Smik_4.221        HSLPETIQRARRESH---MRMNRRIAERQ--LMAQQQRISRDENTSTSF-RLQSIRER--
YDL013W           HNLPEAIQRARRESR---MRMSRRIAERQ--RRVQQQRVSSDENISTSI-RLQSIRER--
                                                                              

TPHA0A04370       IFRPEFLRYYPDEIKPLFYQSPDIDTFFNQANIIIDRYHFDKQILKDIFIEFRYGLDHGL
KNAG0J01270       ------INSYPPNIQSTFHYAQSLPEF--------------TYIVQNT------------
Kpol_1036.52      ------ISLYHTNIRSAFIHANSFNEF--------------MAIIEVA------------
CAGL0K01881g      ----------TPDLSSGYQSSASNYPS--------------RP-----------------
TBLA0F00720       ------INAYPPDVRSIFDHATTLNEF--------------LALMQST------------
KLLA0C04411g      ------IDSLDPDLRSLFFESQSLSQF--------------R---EGL------------
TDEL0D04350       ------LDSYPLDIRSAFLHAQNMNEF--------------SSIIENV------------
KLTH0E15884g      ------INSFPFEVRSAFDHAQSIHEF--------------RSILQSV------------
Kwal_27.9824      ------INRLPPNVRSAFDHAQSVHEF--------------RSILQSI------------
AER213C           ------VDALAPELRSIFYHAETLHEV--------------RTMLNAS------------
SAKL0C07964g      ------INGYPLDIQSAFDHAQSLYEF--------------EGIIQSV------------
KAFR0A01220       ------INAYSPDIRSAFDHAQTIHEF--------------KSILENI------------
NDAI0A06510       ------IHTYPPDVRGAFDHAQSLQEF--------------TSIVQSV------------
NCAS0I01910       ------INTYSPDIQSAFNHAHSLHEF--------------TSILQNV------------
ZYRO0A04994g      ------IDSFPPDVRSAFVHAQSLYEF--------------RSILQSV------------
Suva_4.236        ------IQAYVPDIRSAFHHAESLHEF--------------RSILQNV------------
Skud_4.240        ------IQAYAPDIRSAFYHAESLHEF--------------RSILQNV------------
Smik_4.221        ------IQSYTPDVRSAFHHAESLHEF--------------RSILQNV------------
YDL013W           ------IQSYTPDIRSAFHRAESLHEF--------------RSILQNV------------
                              ::   :  :                                       

TPHA0A04370       FDLPGLVTGYSDEGFIRLWYDFNYDDLNDFEIHSNSLNMLEMF----VNEEHLETNTNRV
KNAG0J01270       --DPITFAECR-DDLTNLFSQYQSMQHD------DRMRNVGQQ----GSRQS-EPRHGTN
Kpol_1036.52      --PRLGIT----DDLVDLY--LRLEDLRNRTH--QANSLFVPD----IDNISSNSETTRY
CAGL0K01881g      ----------------------SSALINDWAI--ARARNA-------ARRRTRAMTESRI
TBLA0F00720       --APITLEDNR-TDLIDIFTLYRGNLTQNWMI--NRMNSSRDN----SARTA-SSTPMRN
KLLA0C04411g      --ARFNFPPARLEQLLGQYRDFRARAMQSWAE--GRRTRSMSY----QNRNSLRPQRTRS
TDEL0D04350       --DPLTWQDCR-YDLERLFMDYRRMMARRAAQIGQNMPGYRSP----PNRTQGNADLLRR
KLTH0E15884g      --DRQSYEQRQ-DELTHLFTVYRGHVMRSWAN--DRLRRARDA----ASGMN-TRTTDRT
Kwal_27.9824      --DWQNYHQRQ-DDLTSLFSEYRANLLRSRSN--QRIRRPGE-----RSRLD-SRMAGQD
AER213C           --GLGTSAAAM-QDLLQLYMQFRSRQINNWAR--QRAQEFRHG----SAREADHAQDDSA
SAKL0C07964g      --EPRMNENRK-QELRELYSRYRGHVMHSWAQ--NRRRTYREQ----AARAQQTRAREQE
KAFR0A01220       --APVTLQDCG-AELISLYTEYRSYLLQNWAT--RRVQNSAAPATAGRARTDGRDRRRRT
NDAI0A06510       --APTTFAECS-DDLISLFTQYRGQVMADWTL--RRIRQ--------SQRDNERLLRERH
NCAS0I01910       --APLTLQECG-DELLSLFTQYRSQLMVNWAT--RRVRSSQQN----TSSSNHRQRNLRN
ZYRO0A04994g      --APLTLQECD-NELVPLFTEYRSRMVQNWAT--NRVQSNQQE----SRRLN-EENHERQ
Suva_4.236        --APVTLQECE-GELMALFTEFRNQLLQNWAI--DRVRNTQEE----ALRLHREALEGQE
Skud_4.240        --APVTLQECE-GELMALFTEFRNQLLQDWAI--DRVRNTQEE----ALRLH-REALERQ
Smik_4.221        --APVTLQECE-EELMALFTEFRNQLLQNWAI--ERVRNTQEE----ALRLH-REALERQ
YDL013W           --APITLQECE-EELMALFTEFRNQLLQNWAI--DRVRNTQEE----ALRLH-REALERQ
                                                                              

TPHA0A04370       RPYDADYQFPNRN----NGLYDRAITTSISSDSYPSAMQG----------LFVNSNDFGY
KNAG0J01270       YSQRS-AVSHSN-----NRYFYPEFNQYESDEARAQS-LL-PRIHDFLQMRLMGYPN---
Kpol_1036.52      DEGWNPVTHPV------TNRFIEDSFHSPMIRRIFGN-YG--------GRHHQDYDD---
CAGL0K01881g      SAALG-QLAGLS-----GSDLVNGYINFPVLPQSMAS-YM--------HNHVYGTPITGS
TBLA0F00720       MPAHT--------------RFVQGFLHSIMGLGGDFP-YG-------------GTE----
KLLA0C04411g      GTQQN-HSRGSNGDSRDNALYQQMLFGMPDDDENMDG-NNFTGTTQSLQRIISNTMNRRF
TDEL0D04350       LGPLG-VRIGI------GTGMGESLTHYILEPGIF-G-YG-------SFRMIGNPGGFDD
KLTH0E15884g      SQAHN-LRYSPTLAGIIARTFNPILGHMHMAYEPGLG-TG-----------MAAYND---
Kwal_27.9824      PSAQN-LPYSPSLVGIMAQTFNPVLGRMHMGYDARTH-GG-----------IMGYGE---
AER213C           SRAR--LRNPAL-----NAQRRNSFTSYVLARSLG-G-FG----------VWPNDFF---
SAKL0C07964g      QRQRE-LENQVF-------HNRHSLTEFLIARA-----FG--------PFHWGGQQ----
KAFR0A01220       RNQRL-ARLRFDMESNEGGLTANNLARIFLANNGFQNVFDGGDIRDDEDGDYYGYMNEYD
NDAI0A06510       ARVRSTIRAN-------NRHFGSNLASFFLMNQLGLG-YGDVGAADDEDDGDYGIGEEDN
NCAS0I01910       LRRNGALRVTPN-----ANGFNVNLARLFLMNQLGIN-NG-----NDEDQYFTGAYNSED
ZYRO0A04994g      RRLWH-NRRHFRIHMGVGGGFGESLANYILMNANGMG-SN--------DAAWLYNGYVGD
Suva_4.236        RVAGGALHHGP---------YRESISSYLNFNGED-G-FL--------TRLWGGPVLNE-
Skud_4.240        ERATG-RVFH-------RGPFRESITNYLNFSGEN-G-FL--------TRLWGSPVLND-
Smik_4.221        GRTTG-RNFH-------RGVFRESIANYLNFNGDD-G-FL--------SRLWSGSVLND-
YDL013W           ERTAG-RVFH-------RGTLRESITNYLNFNGED-G-FL--------SRLWSGPALSD-
                                                                              

TPHA0A04370       A---------------QAGEQETQDLIAMIQEREEREHDIRTRKFTKKNEKLQQLIREKA
KNAG0J01270       ----------------DDEETTTQNIISMIQEREDTERDTRVKNFTDKSKPLLKSILKEA
Kpol_1036.52      ----------------DDEEGRTQSIITMIQEREEVEKDLRTKKYSESTKEKQDEFERRA
CAGL0K01881g      E---------------DDEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEA
TBLA0F00720       ----------------SDEEATTQNIIRMIEEREANERDSKVKQLMKKTKKQQEDFENKA
KLLA0C04411g      GNLPFGVGPEFGFYEDGDDAANTELIIRMIQEREERDASTRTKKLNEVTKSQQQKYIDKA
TDEL0D04350       G---------------MEEEARTQSILNAIQEREEQERDAQTKSNMEKTRSQEENFIEKC
KLTH0E15884g      ----------------ADEERQTQNIIQMIQEREEREFESRKRKYMEDTKPKQSGYLQKA
Kwal_27.9824      ----------------VDEEQQTQNIIQMIQEREEQEYEARKRKYMEDTKSKQLGYLEKA
AER213C           ----------------GDDDEVTQNIIDIIQAREERDLDSRKRKYMEDTKSQQQAFVARA
SAKL0C07964g      ----------------ADEEIETQNIIEMIQAREEREQDTRKKRYMEDTKFQQQGFLRRA
KAFR0A01220       DYMGEHGENE------DEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKA
NDAI0A06510       DTGRAAGAYGYEY---EDDDAHTQNIINMIQRREDAERDSRTKGFMSKTKPQQDGFKKRA
NCAS0I01910       DADHNGD---------DEDDTQTQNIINMIQRREEQEHDTRTKSFMARTKPQQDAFKKRA
ZYRO0A04994g      ----------------MDEEESTQSIVSMIQEREEREHDSRTKKYMEKTQDQQQSYVQRA
Suva_4.236        ----------------ADEERHTQNIIDMIQEREERERDVVMKNLMNKTKAQQDEFEERA
Skud_4.240        ----------------ADEERHTQNIIDMIQEREERERDVVMKNLMSKTKAQQEEFEDRA
Smik_4.221        ----------------ADEERHTQNIIDMIQEREERERDVVMKNLMNKTKAQQEEFEARA
YDL013W           ----------------ADEERHTQNIIDMIQEREERERDVVMKNLMNKTRAQQEEFEARA
                                        *: ::  *: **  : .   .     .          .

TPHA0A04370       KTIPEGYSSSFSTEVPVKLIDKQDKNGNNVIMLEEQQVEVDDEFGNKKNESVIEVPVCCL
KNAG0J01270       KSLPSNYSASFHY--PSSPSKPQIPGGSTSETAES-----------------EEVSCCVL
Kpol_1036.52      TELPDGYSSSFNTE-P-KAKVDMTKNGVNGSVSVVDD-TMAEDW--------EEIPICCL
CAGL0K01881g      KQLPPGYSASFAT--P-----EVIRENDDEDNSNNDD-D-------------EDMIVCNL
TBLA0F00720       KYLPKGFSASFSLV-P-KKIISIDGDDSKREI-VTDE-FLAEEY--------EELPVCCL
KLLA0C04411g      NSLPEGYSASFNTA-P-LMSMTMENEGREETVMVTDD-VAAKTY--------IDVPVCVL
TDEL0D04350       KNLPEGYSASFDTT-PTTVRLEPLNDGNKQAIVVEDE-SAIAEW--------EEIAVCCL
KLTH0E15884g      AKLPDGYSASFDTT-P-RMNISIMKNGQNEELTVVDD-HADALY--------MDIPACCL
Kwal_27.9824      VKLPEGYSSSFDTT-P-KMNITIKKNGKEEELTVTDD-QAAAFY--------MDLPSCSL
AER213C           QRLPEGYYASFDPT-P-KMKMTLEKNGKTEEVVVADD-LAAKSY--------VEVPVCCL
SAKL0C07964g      EGVPEGYSASFDTA-P-KMKIAMTRNGREEEVTVTDD-HAAKQY--------EDVPACCL
KAFR0A01220       RNLPDGYSANFDST-P-KTVVKAMKNGKEEEIIVDDDVAVRNNL--------MEVPICTL
NDAI0A06510       LALPEGYSSSFSTE-P-KVKMTVKKNGKDETVIMEDV-DLAKYW--------MDVPACIL
NCAS0I01910       NELPENYSANFNTE-P-TMKLDIKKNGKEETIIVEDN-DAAKNY--------IEVPACTL
ZYRO0A04994g      MELPDGYSASFDTE-P-KIKLDIVRDGKEETVVVKDD-SVSDQW--------QEVPVCTL
Suva_4.236        ANLPEGYSASFDTT-P-KMKLDIMKNGKEETITVLDD-DLAKTL--------EDVSVCCL
Skud_4.240        ARLPEGYSASFDTT-P-KMKLDIMKNDKEETITVTDD-DLARTL--------EVIPVCCL
Smik_4.221        ASLPEGYSASFDTT-P-KMKLDIMKNGKEETIIVTDD-DLAKTL--------DDIPVCCL
YDL013W           ASLPEGYSASFDTT-P-KMKLDITKNGKEETIIVTDD-DLAKTL--------EDIPVCCL
                    :* .: :.*    *          .                           :  * *

TPHA0A04370       CGVELGIGIPETFAGISAEDKKLECFKDIATKYGFSCPYQTMVRPTELDRDLSRRTFISN
KNAG0J01270       CGSELGVGIPDSFIGRSAEDRDL-DFSSLISKYSFPCPYQSLIRPNQLDRDLSKRTFMSK
Kpol_1036.52      CGVTLSEGIPDEFQGMSNEDRFL-PFEELKEKYDSFCPYQCLIRPSQSDRDFSKRVYVAN
CAGL0K01881g      CGVELGIGIPEEFTGISKEDFAL-SFAELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSN
TBLA0F00720       CGVELGVGIPDSFRGITPEESKV-SFDSLVKKYNIPCPYNALSAPGDIDRDLSRRTYVAS
KLLA0C04411g      CGVELGVGIPDDWKGVSEEDKGV-SFEALQSHYKFHCPYQTLARPTLVDRDLSRRTYVSS
TDEL0D04350       CGVELGVGLPDDFTGISADDRHL-SFDELVTKYCSHCPYQSLTSANGTERALSMKTFVAS
KLTH0E15884g      CGVELGVGIPDGFQGLYEEDRGV-SFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQ
Kwal_27.9824      CGVELGVGIPDEFQGLSTQDRGV-SFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAA
AER213C           CGVELGLGIPDDFAGISAVDRGV-SFESLVSKYDFHCPYQALAHPSIADRDLSRKTFVAH
SAKL0C07964g      CGIELGVGIPDEFSGITKEDRGV-SFESLVAKYGFHCPYQSLARPSVADRDLSKRTYVAS
KAFR0A01220       CGAELGIGIPDDFKGIGEEDRGL-SFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAK
NDAI0A06510       CGVELGVGIPKDFVGTSDKDHGV-SFEFLVSKYDFHCPYQSLSKPSQLDRDLSQKVYVAS
NCAS0I01910       CGVELGVGIPKDFQGINDTDRGG-SFESLVSKYKFHCPYQSLAKPSQLDKDLSQRVFMAS
ZYRO0A04994g      CGVELGVGIPDEFEGITKMDRGV-SFECLVYKYQFHCPYQTLARPSQLDRDLSRRTFVAP
Suva_4.236        CGVELGVGIPDDFVGMSQKDRGI-SFEGLVSRYKFHCPYQTLARPSVLDRDLSKRTFVAS
Skud_4.240        CGVELGVGIPDDFIGMNQKDRGI-SFEGLVSKYKFHCPYQTLARPSMLDRDLSRRTFIAA
Smik_4.221        CGAELGVGIPDDFTGMSQRDRGI-SFEGLVSKYKFHCPYQTLARPSVLDRDLSKRTFIAS
YDL013W           CGAELGVGIPDDFTGISQKDRGV-SFEGLVSKYKFHCPYQTLARPSMLDRDLSKRTFIAS
                  **  *. *:*. : *    :     *  :  .*   ***: :  .   :. :* ..::: 

TPHA0A04370       CGHAFCGRCYNRIHLAKAETKKNNGRDITNKLTRLSQSNRISPVILGSLNPDNYGPKICP
KNAG0J01270       CGHVYCGRCFARIDNAKAKSKISK--------------KELASLK-GCSNPNIYGPRICV
Kpol_1036.52      CGHTYCGRCYRRIQNSKEKSKLPK--------------SQLAKLK-GACHPDNYGPKKCP
CAGL0K01881g      CGHLFCGRCWRRYLNARSLMKTKA--------------GKSLNVKLGASHPDNFAPKVCP
TBLA0F00720       CGHSFCGRCVRRINHAKESGKISK--------------QKLKELV-GPENPDIYGPKTCP
KLLA0C04411g      CGHTFCGRCQVRIKNARDISAKEK--------------NKLKNSQ-GPSHPDNYGPKKCP
TDEL0D04350       CGHTFCGRCVVRIENARTHSKSSK--------------KELSKFK-GPLHPDNYGPRLCP
KLTH0E15884g      CGHSFCGRCFARIDNARSFNRASK--------------KKLSELK-GASNPDNYGPKNCP
Kwal_27.9824      CGHSFCGRCFARIDNARSFNRASK--------------QKLKDLK-GASHPDNYGPKKCP
AER213C           CGHTFCGRCFARINNAKRFSKISK--------------KRLAELH-GPSHPDNYGPRVCP
SAKL0C07964g      CGHTFCGRCFARVDNARAYSRASK--------------KKLAGLQ-GASHPDNYGPKTCP
KAFR0A01220       CGHLYCGRCVARISNAKENSRKPK--------------KELAKLI-GSSHPENYGPKKCP
NDAI0A06510       CGHTFCGRCYVRIDNAKSKSKLPK--------------KKLAELK-GSSHPDNYGPKTCP
NCAS0I01910       CGHTFCGRCYARIDNAKSKSKLPK--------------KTLKQLK-GSSHPDNYGPRVCP
ZYRO0A04994g      CGHTYCGRCFARIDNARGKSRMAK--------------RKLAQLK-GSAHPDNYGPKICP
Suva_4.236        CGHTYCGRCYARIDNAKKKSKSPK--------------KKLAELK-GSAHPDNYGPKLCP
Skud_4.240        CGHAYCGRCFARIDNAKKKSKTPK--------------KKLASLR-GSAHPDNYGPKFCP
Smik_4.221        CGHAYCGRCFARIDNAKKKSKTPK--------------KKLAQLK-GSAHPDNYGPKLCP
YDL013W           CGHAFCGRCFARIDNAKKKSKMPK--------------KKLAQLK-GSAHPDNYGPKLCP
                  *** :****  *   :.                             *  :*: :.*. * 

TPHA0A04370       GSDCKYQIR-ART-KMREAYF
KNAG0J01270       ADGCTAVIR-AKA-RLRELYF
Kpol_1036.52      VTSCNRLLRISRGVAFREAYF
CAGL0K01881g      ADNCKYQIR-SKG-KMREVYF
TBLA0F00720       ATDCTGKLR-RKG-QMREVYF
KLLA0C04411g      AEGCNSNLR-KKG-IMREVYF
TDEL0D04350       ATGCKQNIRLGRT-KMREAFF
KLTH0E15884g      AKDCNNRLR-SRG-KMREVYF
Kwal_27.9824      AKDCNNQLR-NRG-KMREVYF
AER213C           AEGCRGQLR-TRG-KMREVFF
SAKL0C07964g      AEGCSMQLR-SKG-RMKEVFF
KAFR0A01220       ADNCKGLLR-SRG-KLSEVYF
NDAI0A06510       GPSCKTLLR-SRG-RMREIYF
NCAS0I01910       ADSCRSLLR-VKT-KMREVFF
ZYRO0A04994g      AKGCKSPIR-TRG-KMREAFF
Suva_4.236        ADSCKKLIR-SRG-RLKEVYF
Skud_4.240        AESCKKPIR-SRG-RLKEVYF
Smik_4.221        AESCKKLIR-SRG-KLKEVYF
YDL013W           ADSCKKLIR-SRG-RLKEVYF
                    .*   :*  .   : * :*

FASTA FORMAT for MUSCLE Version 3.6

>TPHA0A04370
----------------------------------------MHVTNGE-------------
----------MLRPADDFVTIVSDFEHEPRIQSVNNN-----------------DN-QVT
STAGSSKSTIIEHS--------------------------------NDDHHDDNDDDEIG
IISERVNFDTANNDNMDDLSVINEREVVDL------DREPEITS------------VANN
T-----------------NDDDLMIVGEQVIENP---HILLNLPGGRTFELSTTTNDLPF
RSSFEMLQN-----LGRNINLAGQ-DYMNLTDSTSPI--RIVPSVNTPETEGILNNTRTN
QNISGRLSRQPRMPS---RREIRARNIRNLRITRQRNRLNRFEAQRRERKKAFRINHRRF
IFRPEFLRYYPDEIKPLFYQSPDIDTFFNQANIIIDRYHFDKQILKDIFIEFRYGLDHGL
FDLPGLVTGYSDEGFIRLWYDFNYDDLNDFEIHSNSLNMLEMF----VNEEHLETNTNRV
RPYDADYQFPNRN----NGLYDRAITTSISSDSYPSAMQG----------LFVNSNDFGY
A---------------QAGEQETQDLIAMIQEREEREHDIRTRKFTKKNEKLQQLIREKA
KTIPEGYSSSFSTEVPVKLIDKQDKNGNNVIMLEEQQVEVDDEFGNKKNESVIEVPVCCL
CGVELGIGIPETFAGISAEDKKLECFKDIATKYGFSCPYQTMVRPTELDRDLSRRTFISN
CGHAFCGRCYNRIHLAKAETKKNNGRDITNKLTRLSQSNRISPVILGSLNPDNYGPKICP
GSDCKYQIR-ART-KMREAYF
>KNAG0J01270
-------------------------------------------MVVH-------------
----------KMSTESPVVITDAEDDSDLE---------------------------WVR
C-EGDLRSTSPQVA--------------------------------------VDDDSDFA
ITASI---------------ERTPTDVVVV------DDEP--------------ITITST
RGND--------------DTDEITVLEERP-APPPPNTTELYLPGRNVMHIRTAQSDNPI
PTSFRNLRR--DDGGSGVGEELRRSRRLRERPRWGGR--MTPRATERGQRRRRSLFVNDD
G---EDISQNPRFMS---MLMTMDPEYTS-----GNHPAALDEDP-----QRRRIRAR--
------INSYPPNIQSTFHYAQSLPEF--------------TYIVQNT------------
--DPITFAECR-DDLTNLFSQYQSMQHD------DRMRNVGQQ----GSRQS-EPRHGTN
YSQRS-AVSHSN-----NRYFYPEFNQYESDEARAQS-LL-PRIHDFLQMRLMGYPN---
----------------DDEETTTQNIISMIQEREDTERDTRVKNFTDKSKPLLKSILKEA
KSLPSNYSASFHY--PSSPSKPQIPGGSTSETAES-----------------EEVSCCVL
CGSELGVGIPDSFIGRSAEDRDL-DFSSLISKYSFPCPYQSLIRPNQLDRDLSKRTFMSK
CGHVYCGRCFARIDNAKAKSKISK--------------KELASLK-GCSNPNIYGPRICV
ADGCTAVIR-AKA-RLRELYF
>Kpol_1036.52
------------------------------MADVEGPYMNQEQNPKR-------------
----------TKSNQDEAILIDSDLDDHLDFSDGSDSDILQLDGRTQDIAHNSSNGEVVE
SVDISNRNERYDEH-------------------------TETAVQISNSGNDSANNDDIT
IVREI--NRSPRRE----RRNESVTEYVDL------DHEPEDVE------PIGTSNLDGR
SSGSNVNDRDRNNS----NIDDLIIISEQH-PQPSANSIFLTIPGRQLMELQVASTDIPT
RSSFE-YQN------------DRRPVRLGNSGRPRIN----------------------R
QYMQNSFSRVRRQLL---GILRVRQSNP----------------------EIDEIARE--
------ISLYHTNIRSAFIHANSFNEF--------------MAIIEVA------------
--PRLGIT----DDLVDLY--LRLEDLRNRTH--QANSLFVPD----IDNISSNSETTRY
DEGWNPVTHPV------TNRFIEDSFHSPMIRRIFGN-YG--------GRHHQDYDD---
----------------DDEEGRTQSIITMIQEREEVEKDLRTKKYSESTKEKQDEFERRA
TELPDGYSSSFNTE-P-KAKVDMTKNGVNGSVSVVDD-TMAEDW--------EEIPICCL
CGVTLSEGIPDEFQGMSNEDRFL-PFEELKEKYDSFCPYQCLIRPSQSDRDFSKRVYVAN
CGHTYCGRCYRRIQNSKEKSKLPK--------------SQLAKLK-GACHPDNYGPKKCP
VTSCNRLLRISRGVAFREAYF
>CAGL0K01881g
------------------------------------------------------------
--------MKRDGEEDPVIVLDSDNEEPANSEHEGVR---------------PLPA-IVV
DEEDNSGAPVEVTS---------------------------------VNADEGGDDDELT
LLRQS-NIRVPR------RQISTPVAYINL------DDEAAHHD------ASDDIEFLGG
NLVPNAGDN---------DEDAVTLLEERL-ADG---LVPLNLPGGRRIIVNAANGEAPV
RSSFERLMRNNQLRYLRTVPAERQNQRVQRNYRPVRNDGMFVPESDDSQDDEWE------
------------------------------------------------------------
----------TPDLSSGYQSSASNYPS--------------RP-----------------
----------------------SSALINDWAI--ARARNA-------ARRRTRAMTESRI
SAALG-QLAGLS-----GSDLVNGYINFPVLPQSMAS-YM--------HNHVYGTPITGS
E---------------DDEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFYEEA
KQLPPGYSASFAT--P-----EVIRENDDEDNSNNDD-D-------------EDMIVCNL
CGVELGIGIPEEFTGISKEDFAL-SFAELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSN
CGHLFCGRCWRRYLNARSLMKTKA--------------GKSLNVKLGASHPDNFAPKVCP
ADNCKYQIR-SKG-KMREVYF
>TBLA0F00720
----------------------------------MQPSDNQRESIPSAIQQSAITTNNNS
INNANSRN--GHDGHNDVIVIESDAEEDAIDKNRNVP---------WSQPRDEFHR-FAR
IYDNINERNNHSSLSATLDRGNTPTTSIPRGTLPTQTFEVGHHNNAPDNNADDDDDDDII
ITNEIIAPVDPS------GPLNPSTEYVDL------DNEAEYSS-NNNYGHSRTLIVDGD
NDNADVIDDGN-------GADDLVIVQERT-SAP---TVTLTLPGNRSIQINAAPTDRPV
RSSFG-WQG--------GVPDSRR-GMLARRYNSVRQ--LFFNSDEDASRNGSDSDSYDD
DYTPARLQRIQNRER---NAVRQRMMQQRRQQQILRQEQSRNESP-----IMAELRRR--
------INAYPPDVRSIFDHATTLNEF--------------LALMQST------------
--APITLEDNR-TDLIDIFTLYRGNLTQNWMI--NRMNSSRDN----SARTA-SSTPMRN
MPAHT--------------RFVQGFLHSIMGLGGDFP-YG-------------GTE----
----------------SDEEATTQNIIRMIEEREANERDSKVKQLMKKTKKQQEDFENKA
KYLPKGFSASFSLV-P-KKIISIDGDDSKREI-VTDE-FLAEEY--------EELPVCCL
CGVELGVGIPDSFRGITPEESKV-SFDSLVKKYNIPCPYNALSAPGDIDRDLSRRTYVAS
CGHSFCGRCVRRINHAKESGKISK--------------QKLKELV-GPENPDIYGPKTCP
ATDCTGKLR-RKG-QMREVYF
>KLLA0C04411g
------------------------------------------------------------
-----------MTEQGCVIEIDSDPELDAQIREEYAP-RRLIPDRRRNRPRDHLSR-FVS
NAEDRNVAPIAPAT----------------------------------DLPVSTDGEDLE
ITAEV----SLRPD----GPINDDAEYINL------DNYRASNN--------GTVVVDHR
E-----------------GDDDLMLVEERI-QES-GRPVLLQLPAGQTLQVDASWNELPV
GRSFQ-NQV--------YRNPNQL-RRLRRHIDHATA--MFMGGYNQSGTGDSDFSDNDA
DYIPPDIVNERNQYT---MQTRMREQRER---QNQMQRLQRAAD------------ET--
------IDSLDPDLRSLFFESQSLSQF--------------R---EGL------------
--ARFNFPPARLEQLLGQYRDFRARAMQSWAE--GRRTRSMSY----QNRNSLRPQRTRS
GTQQN-HSRGSNGDSRDNALYQQMLFGMPDDDENMDG-NNFTGTTQSLQRIISNTMNRRF
GNLPFGVGPEFGFYEDGDDAANTELIIRMIQEREERDASTRTKKLNEVTKSQQQKYIDKA
NSLPEGYSASFNTA-P-LMSMTMENEGREETVMVTDD-VAAKTY--------IDVPVCVL
CGVELGVGIPDDWKGVSEEDKGV-SFEALQSHYKFHCPYQTLARPTLVDRDLSRRTYVSS
CGHTFCGRCQVRIKNARDISAKEK--------------NKLKNSQ-GPSHPDNYGPKKCP
AEGCNSNLR-KKG-IMREVYF
>TDEL0D04350
----------------------------------MVGGSANYVGPSD-------------
----------PVSNSDDVILIESDDEQHSSRDSGLRS----------STTRDTMSP----
--NSNGSNQSEVVS-----------------------------------RESSRNADSV-
------------------SPMGSTAEYIDL------EMEPAGNE-----EQDDMIVYDER
LSTPRDA-----------EDDELIFVQEQT-RPS---TIQLNLPGRNPMRITATEYDRPA
RRSFE-QQASNRQLRHQT-RVARR-QPMRRAARRA-N--HSMNGYESDDGGLTS-NRNQI
NYDP----------------------------------------------EFAAIQRR--
------LDSYPLDIRSAFLHAQNMNEF--------------SSIIENV------------
--DPLTWQDCR-YDLERLFMDYRRMMARRAAQIGQNMPGYRSP----PNRTQGNADLLRR
LGPLG-VRIGI------GTGMGESLTHYILEPGIF-G-YG-------SFRMIGNPGGFDD
G---------------MEEEARTQSILNAIQEREEQERDAQTKSNMEKTRSQEENFIEKC
KNLPEGYSASFDTT-PTTVRLEPLNDGNKQAIVVEDE-SAIAEW--------EEIAVCCL
CGVELGVGLPDDFTGISADDRHL-SFDELVTKYCSHCPYQSLTSANGTERALSMKTFVAS
CGHTFCGRCVVRIENARTHSKSSK--------------KELSKFK-GPLHPDNYGPRLCP
ATGCKQNIRLGRT-KMREAFF
>KLTH0E15884g
----------------------------------MNPEDTNMDGTP--------------
----------PECSQNDVIEIESDTEDETQVLPGTLE----APDI------GQMHG-SLV
D-DLPSQNNASEVF-----------------------------------CNTEDDD-EIQ
LLGET----VLDGN----NAAAPRLGNPNI------NRAES----------VGVAQIRPH
QPSAA-------------GEEDLVILEERN-NSP---SFVLNLPGGEHLQISGSPLDQPV
RRSFQ-TQG----NRHTNSANGRR-RLLRRTARRASS--LFLHPSDEEDEGFAY---ENT
DLLPTGVRLRRQRNS---MMQRRPNPPRR-------QLLGTGDDVDDP--ELLSLEAQ--
------INSFPFEVRSAFDHAQSIHEF--------------RSILQSV------------
--DRQSYEQRQ-DELTHLFTVYRGHVMRSWAN--DRLRRARDA----ASGMN-TRTTDRT
SQAHN-LRYSPTLAGIIARTFNPILGHMHMAYEPGLG-TG-----------MAAYND---
----------------ADEERQTQNIIQMIQEREEREFESRKRKYMEDTKPKQSGYLQKA
AKLPDGYSASFDTT-P-RMNISIMKNGQNEELTVVDD-HADALY--------MDIPACCL
CGVELGVGIPDGFQGLYEEDRGV-SFEALKAKYNFHCPYQTLSKPSVADRDLSRRTYVAQ
CGHSFCGRCFARIDNARSFNRASK--------------KKLSELK-GASNPDNYGPKNCP
AKDCNNRLR-SRG-KMREVYF
>Kwal_27.9824
----------------------------------MRPFEPPTDANS--------------
----------TESGQADIIEIESGVEDNQQMLSHQDG----VPDT------LEVPR-TSE
S-DPSLRNENVETL-----------------------------------CNTDDDDDELQ
VVGES----ILSER----QTSYPETEYVDL------DRSGEGS-------------LGQR
RPQAAS------------SEEDLVILEERT-SSP---SFVLNLPGGEYLRINGSPLDQPV
RRSFQ-AQA----PRQFDSAGARR-RLARRTARTASN--LFMQPSDDEQEESVE---GNT
YQLPSTVMARRQRNA---LLMQRRPQPSR------RQPVRGFGMIQSP--ELSALEAQ--
------INRLPPNVRSAFDHAQSVHEF--------------RSILQSI------------
--DWQNYHQRQ-DDLTSLFSEYRANLLRSRSN--QRIRRPGE-----RSRLD-SRMAGQD
PSAQN-LPYSPSLVGIMAQTFNPVLGRMHMGYDARTH-GG-----------IMGYGE---
----------------VDEEQQTQNIIQMIQEREEQEYEARKRKYMEDTKSKQLGYLEKA
VKLPEGYSSSFDTT-P-KMNITIKKNGKEEELTVTDD-QAAAFY--------MDLPSCSL
CGVELGVGIPDEFQGLSTQDRGV-SFEALKAKYEFHCPYQALSKPSLVDRDLSRRTYVAA
CGHSFCGRCFARIDNARSFNRASK--------------QKLKDLK-GASHPDNYGPKKCP
AKDCNNQLR-NRG-KMREVYF
>AER213C
--------------------------------------------MTD-------------
----------PNAARNAVIEIESDPEEDQRIINQYRQ-TRLVPDRRLNRPRDAANR-FVS
V-SGRVAAAA------------------------------------------GEGDDEVE
IVNEV----YLDDE----GPIDSTADFVDL------DEQQG---------PSSSMVINHD
GG----------------GDDDVAIIEERT-THP---TFLLNLPNGQTLRISGSVHDRPL
RRSFE------------TQRTARA-NMLRRAARSAQR--LFMNENDGEPSEREA---SDR
EYLPQSVLRQRQQAL---MQERLQRQREH-----ARQHEHIADPQ---------------
------VDALAPELRSIFYHAETLHEV--------------RTMLNAS------------
--GLGTSAAAM-QDLLQLYMQFRSRQINNWAR--QRAQEFRHG----SAREADHAQDDSA
SRAR--LRNPAL-----NAQRRNSFTSYVLARSLG-G-FG----------VWPNDFF---
----------------GDDDEVTQNIIDIIQAREERDLDSRKRKYMEDTKSQQQAFVARA
QRLPEGYYASFDPT-P-KMKMTLEKNGKTEEVVVADD-LAAKSY--------VEVPVCCL
CGVELGLGIPDDFAGISAVDRGV-SFESLVSKYDFHCPYQALAHPSIADRDLSRKTFVAH
CGHTFCGRCFARINNAKRFSKISK--------------KRLAELH-GPSHPDNYGPRVCP
AEGCRGQLR-TRG-KMREVFF
>SAKL0C07964g
--------------------------MPSHATEETTPHTHGLEQHAP-------------
----------PSAPTQDVIEIESDPEEDERIRQQYRQ-QRLVGDRRINRPRDSLNR-FLN
S-QGENRNTRAALE-----------------------------------PDDDEDDDDLQ
VVGET----MLDRH----GPIGEDADFVDLSSFGGGDTGSGGSGDNRNGVPTRTAIIRHS
TGANGSD-----------RGDDIEILEERT-TAP---NFVLNLPGGESLRISGTTADQPV
RRSFQ-NQQPSRTRAVSAAAAARR-RLLNRTARSATN--LFFSSGQGPQDGYSE--ENDP
DYIPAGVRQLRQQNA---MRDRQASLEQR----REQQRLNGMDPGANA--ELTALRSR--
------INGYPLDIQSAFDHAQSLYEF--------------EGIIQSV------------
--EPRMNENRK-QELRELYSRYRGHVMHSWAQ--NRRRTYREQ----AARAQQTRAREQE
QRQRE-LENQVF-------HNRHSLTEFLIARA-----FG--------PFHWGGQQ----
----------------ADEEIETQNIIEMIQAREEREQDTRKKRYMEDTKFQQQGFLRRA
EGVPEGYSASFDTA-P-KMKIAMTRNGREEEVTVTDD-HAAKQY--------EDVPACCL
CGIELGVGIPDEFSGITKEDRGV-SFESLVAKYGFHCPYQSLARPSVADRDLSKRTYVAS
CGHTFCGRCFARVDNARAYSRASK--------------KKLAGLQ-GASHPDNYGPKTCP
AEGCSMQLR-SKG-RMKEVFF
>KAFR0A01220
--------------------------------MARSEEASTYYRNMG-------------
----------SSGDQDSVILIETDEEEDERIRDENRY-RRLVPDRRIGRPRDILNR-FVS
TRDPGDDNETTTHV--------------------------------SQEGDNNDDDDDVE
IVGAIEAPRDPN------GPIDPGAEYIDL------DTEDQYASGHHGFNTPRIVVINGD
SNNGNN------------EDDGLEIIEERT-TRP---TVTLNLPGGESLQINASDSDRPA
HRSFE-WQD--------ALPEPRR-RLLRRSAGRIRS--LFLNNSDDENNDTAA-GRQNN
RYLPSNIRRLRQEEQ---AQMRQLAQRRRRMNEQRPEMISGNP-------RFDEIRNR--
------INAYSPDIRSAFDHAQTIHEF--------------KSILENI------------
--APVTLQDCG-AELISLYTEYRSYLLQNWAT--RRVQNSAAPATAGRARTDGRDRRRRT
RNQRL-ARLRFDMESNEGGLTANNLARIFLANNGFQNVFDGGDIRDDEDGDYYGYMNEYD
DYMGEHGENE------DEEAQRTQNIINMIQEREEREHDSRTKGFMANTKSQREANHKKA
RNLPDGYSANFDST-P-KTVVKAMKNGKEEEIIVDDDVAVRNNL--------MEVPICTL
CGAELGIGIPDDFKGIGEEDRGL-SFQFLVSKYKSYCPYQSLAKPSEIDRHLSKRTFVAK
CGHLYCGRCVARISNAKENSRKPK--------------KELAKLI-GSSHPENYGPKKCP
ADNCKGLLR-SRG-KLSEVYF
>NDAI0A06510
MQEEQERHSSISSTATPILPSDNVAERNDDINTNENGTPSSSATSVDKNTATATHANNTE
GSNDDRGDDNDNDNNNSAILIESDPEEDARIREESRQ-ISLVPDRRIGRPRDALHR-FIS
T-NPNNTNTTSRRD------------------------------AQEENEENDENDDDFA
IMDEIIDPTHNNNNINEIGPIDPTAEYVDL------DAEPEYIT----NSRPRTIIINNN
SSNNNIENSNGDANDD--DDDEVMILEERT-STP---TVTLNLPGGERLRINADPNERPT
RSSFESLNE-------NIVPLSRR-QLLRRATRRATN-SLFFHGSDENESDNDT----DE
VSLPASILGMRQRARMMAMQERQRQRQGQGQGHSAPDTSGNSVDNTSTNRNLINLRER--
------IHTYPPDVRGAFDHAQSLQEF--------------TSIVQSV------------
--APTTFAECS-DDLISLFTQYRGQVMADWTL--RRIRQ--------SQRDNERLLRERH
ARVRSTIRAN-------NRHFGSNLASFFLMNQLGLG-YGDVGAADDEDDGDYGIGEEDN
DTGRAAGAYGYEY---EDDDAHTQNIINMIQRREDAERDSRTKGFMSKTKPQQDGFKKRA
LALPEGYSSSFSTE-P-KVKMTVKKNGKDETVIMEDV-DLAKYW--------MDVPACIL
CGVELGVGIPKDFVGTSDKDHGV-SFEFLVSKYDFHCPYQSLSKPSQLDRDLSQKVYVAS
CGHTFCGRCYVRIDNAKSKSKLPK--------------KKLAELK-GSSHPDNYGPKTCP
GPSCKTLLR-SRG-RMREIYF
>NCAS0I01910
------------------------------------------MSTTT-------------
----------DHHQQDPIITIESDPEDDARIRNDQQQIIRLYPDARTDRPRDSMNR-FVD
A-QGSNRAIRSTPD---------------------------LSHLNDDQDQDQDDDDDIT
IVREIVNPNVARDD----APINPDAEFIDL------DQEVPYAN--ATIPRPRTIQIITP
SPPQQQ------------QDDDLVITQERT-MRP---TVTLNLPGGQTLQVDATPTDQLA
RSSFE-WQE--------NIPLARR-QLLRRSTNRANS--LFFHDDHESDNDNGS------
VPLPPNVIRLRQRQQ---QQNREEPPPPP--------PPQDDANP-----IMTRLRTR--
------INTYSPDIQSAFNHAHSLHEF--------------TSILQNV------------
--APLTLQECG-DELLSLFTQYRSQLMVNWAT--RRVRSSQQN----TSSSNHRQRNLRN
LRRNGALRVTPN-----ANGFNVNLARLFLMNQLGIN-NG-----NDEDQYFTGAYNSED
DADHNGD---------DEDDTQTQNIINMIQRREEQEHDTRTKSFMARTKPQQDAFKKRA
NELPENYSANFNTE-P-TMKLDIKKNGKEETIIVEDN-DAAKNY--------IEVPACTL
CGVELGVGIPKDFQGINDTDRGG-SFESLVSKYKFHCPYQSLAKPSQLDKDLSQRVFMAS
CGHTFCGRCYARIDNAKSKSKLPK--------------KTLKQLK-GSSHPDNYGPRVCP
ADSCRSLLR-VKT-KMREVFF
>ZYRO0A04994g
-------------------------------MDLRGRESPEASQEVH-------------
----------INGRDEDPIIIESDQEEDQRIRDDARP-IRLHPDGRIHRPRDGLNR-FVN
S-EGTNVATTRSQ-------------------------------------DNGGSDDEVA
IVGEI-NNTRGNEE----GPIGSDAEYVDL------DADNG----------PQVIEVNDN
NRNNNENS----------DDDGLVIVQERT-TAP---RVTLNLPGGESLQIDASPTDRPY
RRSFE-WQQ---------QDRTRR-QAMERSARRASR--LLFHTSDDDDDDSGN-GTVEN
GRLPPSVLQLRRQEE---ERSRLRNITRR------RDQMRSDAMQGNP--VLMRLRER--
------IDSFPPDVRSAFVHAQSLYEF--------------RSILQSV------------
--APLTLQECD-NELVPLFTEYRSRMVQNWAT--NRVQSNQQE----SRRLN-EENHERQ
RRLWH-NRRHFRIHMGVGGGFGESLANYILMNANGMG-SN--------DAAWLYNGYVGD
----------------MDEEESTQSIVSMIQEREEREHDSRTKKYMEKTQDQQQSYVQRA
MELPDGYSASFDTE-P-KIKLDIVRDGKEETVVVKDD-SVSDQW--------QEVPVCTL
CGVELGVGIPDEFEGITKMDRGV-SFECLVYKYQFHCPYQTLARPSQLDRDLSRRTFVAP
CGHTYCGRCFARIDNARGKSRMAK--------------RKLAQLK-GSAHPDNYGPKICP
AKGCKSPIR-TRG-KMREAFF
>Suva_4.236
-------------------------------MQSAGDDRTKSDHTPS-------------
----------VSHPDNSVILIDSDKEEDASIREANLP-VRLYPDRRVGRRRDALNR-FIR
S-DTTDATPQRIGT-----------------------------TLRSDGPDTQNDIDDVT
IIREV--GRFFGDD----GPIDPSALYVDL------DQEPGSET----VETPRIIQVNNT
NGYLNENSNENNNDNDNDNDDGLTIVEERT-ARP---RITLNLPGGERLEVNATPRDIPI
RRSFE-FQE--------DLAASRR-QLLRRSAARARN--LFVERSDEDDENDEE-WTENT
NDLPETIQRARRESH---MRMSRRVAERQHRIRAQQQRMVSNENMGTAI-RLQSIRER--
------IQAYVPDIRSAFHHAESLHEF--------------RSILQNV------------
--APVTLQECE-GELMALFTEFRNQLLQNWAI--DRVRNTQEE----ALRLHREALEGQE
RVAGGALHHGP---------YRESISSYLNFNGED-G-FL--------TRLWGGPVLNE-
----------------ADEERHTQNIIDMIQEREERERDVVMKNLMNKTKAQQDEFEERA
ANLPEGYSASFDTT-P-KMKLDIMKNGKEETITVLDD-DLAKTL--------EDVSVCCL
CGVELGVGIPDDFVGMSQKDRGI-SFEGLVSRYKFHCPYQTLARPSVLDRDLSKRTFVAS
CGHTYCGRCYARIDNAKKKSKSPK--------------KKLAELK-GSAHPDNYGPKLCP
ADSCKKLIR-SRG-RLKEVYF
>Skud_4.240
--------------------------------MHGGDGRTKSDHTPS-------------
----------VNHPDDSVILIESDKEEDASIREANLP-VRLYPDRRVGRRRDALNR-FVR
S-DSVGINPQRIHT-----------------------------TARPNRSDPQNDNDDVT
IVREV--GRFFGDD----GPIDPSAHFVDL------DHEPDSET----LETPTTLQVDNI
NGYLNDNFNDNDN-----NDDGLTIVEERT-TRP---RVTLNLPGGERLEVNATTTDMPI
RRSFE-FQD--------DLAVSRR-QLLRRSAARART--LFVDRSDENDEEWTE----DT
DNVPEAIQRARRESH---MRMSRRIAERQ--LRAQQHRMASNENMNTSI-RFQSIRER--
------IQAYAPDIRSAFYHAESLHEF--------------RSILQNV------------
--APVTLQECE-GELMALFTEFRNQLLQDWAI--DRVRNTQEE----ALRLH-REALERQ
ERATG-RVFH-------RGPFRESITNYLNFSGEN-G-FL--------TRLWGSPVLND-
----------------ADEERHTQNIIDMIQEREERERDVVMKNLMSKTKAQQEEFEDRA
ARLPEGYSASFDTT-P-KMKLDIMKNDKEETITVTDD-DLARTL--------EVIPVCCL
CGVELGVGIPDDFIGMNQKDRGI-SFEGLVSKYKFHCPYQTLARPSMLDRDLSRRTFIAA
CGHAYCGRCFARIDNAKKKSKTPK--------------KKLASLR-GSAHPDNYGPKFCP
AESCKKPIR-SRG-RLKEVYF
>Smik_4.221
-------------------------------MHGDTNGRTKSDHSPS-------------
----------ASSPDEAVILIDSDKEEDASIREANLP-VRLYPDRRVGRRRDALNR-FVR
S-DSRNRNAQRIHT-----------------------------TTTSEYSNTQGNNDDVT
IIREV--GRFFGDE----GPIDPSAHYVDL------DEEPGSET----LEAPRTIRVDNA
NGYLNDSHDDNE------NDDGLTIVEERT-TRP---RITLNLPGGERLEVNATTTDIPI
RRSFE-FQE--------DLAASRR-QLLRRSATRARS--LFVDRSDENDEDWTE----HT
HSLPETIQRARRESH---MRMNRRIAERQ--LMAQQQRISRDENTSTSF-RLQSIRER--
------IQSYTPDVRSAFHHAESLHEF--------------RSILQNV------------
--APVTLQECE-EELMALFTEFRNQLLQNWAI--ERVRNTQEE----ALRLH-REALERQ
GRTTG-RNFH-------RGVFRESIANYLNFNGDD-G-FL--------SRLWSGSVLND-
----------------ADEERHTQNIIDMIQEREERERDVVMKNLMNKTKAQQEEFEARA
ASLPEGYSASFDTT-P-KMKLDIMKNGKEETIIVTDD-DLAKTL--------DDIPVCCL
CGAELGVGIPDDFTGMSQRDRGI-SFEGLVSKYKFHCPYQTLARPSVLDRDLSKRTFIAS
CGHAYCGRCFARIDNAKKKSKTPK--------------KKLAQLK-GSAHPDNYGPKLCP
AESCKKLIR-SRG-KLKEVYF
>YDL013W
-------------------------------MHSDTNGRTKSNNSPS-------------
----------DNNPNETVILIDSDKEEDASIREANLP-VRLYPDRRVGRRRDALNR-FVR
S-DSRSRNSQRTHI-----------------------------TASSERPDFQANNDDIT
IIREV--GRFFGDD----GPIDPSAHYVDL------DQEPGSET----LETPRTIQVDNT
NGYLNDNGNNNE------SDDGLTIVEERT-TRP---RVTLNLPGGERLEVTATTTDIPI
RRSFE-FQE--------DLGASRR-QLLRRSATRARN--LFVDRSDENDEDWTD----DT
HNLPEAIQRARRESR---MRMSRRIAERQ--RRVQQQRVSSDENISTSI-RLQSIRER--
------IQSYTPDIRSAFHRAESLHEF--------------RSILQNV------------
--APITLQECE-EELMALFTEFRNQLLQNWAI--DRVRNTQEE----ALRLH-REALERQ
ERTAG-RVFH-------RGTLRESITNYLNFNGED-G-FL--------SRLWSGPALSD-
----------------ADEERHTQNIIDMIQEREERERDVVMKNLMNKTRAQQEEFEARA
ASLPEGYSASFDTT-P-KMKLDITKNGKEETIIVTDD-DLAKTL--------EDIPVCCL
CGAELGVGIPDDFTGISQKDRGV-SFEGLVSKYKFHCPYQTLARPSMLDRDLSKRTFIAS
CGHAFCGRCFARIDNAKKKSKMPK--------------KKLAQLK-GSAHPDNYGPKLCP
ADSCKKLIR-SRG-RLKEVYF