MUSCLE (3.8) multiple sequence alignment

NCAS0C03560        ------------------------------------------------------------
TBLA0F00860        ------MSHNIQIYPNNIHSRPNQDNEP--------------TSSHNYMDDSDDEDNIER
KNAG0K01740        -----MSRYLSQDRRGADGNIEGAGSLSRSTSTI--------RSMVDASDDEEDEDNII-
CAGL0K01617g       ------MGNPYHSESD--------------------------QIWRISSQDSD-DGEIG-
KAFR0F02220        -----MSKYTHPSRSRLQRQH---------------------QNLSSISNDSDDDENII-
Kpol_1032.10       ------MGNNLMYKPTSIDIHKNQDLKLNSKYSRNEGMIEGNDNNKNIQDDSD-DEQIT-
TPHA0M00300        -----MVLNDNTRFSKSGGIRN--------------------DTIQTYNNDSDSDEKLT-
Skud_4.223         -----MSTNSFHDYMDS-------------------------KSKMNTRQLSD-DEEFT-
Suva_4.221         -----MSTNSFHDYMDS-------------------------KSRMNARQFSD-DEEFT-
Smik_4.207         -----MSTNSFHDYMDL-------------------------NSRTNMRQFSD-DEEFT-
YDL028C            -----MSTNSFHDYVDL-------------------------KSRTNTRQFSD-DEEFT-
KLLA0C03828g       ---------------------------------------------------------ML-
KLTH0F06468g       -------MSSYTVRSSVPGAPSNRRLEFPARRT---------SVQSLARDDSD-DENML-
Kwal_33.14167      -------MSSYSVRSNLISKPPEIRG----LDFRPRRP----NIHSTARDDSD-DENML-
SAKL0C07348g       MHNPPVASSSFGPDTGKQESHLFQRS----------------SQRVSLKDDSD-DEHPI-
ADR317C            ------MRELGTSQQYLRPASSCSQSGSVNQLLR--------RPQLHLNSDSD-DDHPL-
Ecym_5236          ------MQDSVTSHQYLHPVSNYNNGNIGSVNNIM-------RRSQGDIIDSD-DENPL-
ZYRO0B04906g       ------MLPRYNSLPGSEQRQPPRNKGTWKYSLFPEHDQKKVSTKTIFTDDSD-DEKIS-
TDEL0D04600        ------MSEYLGIYPSSLERK---------------------KSHAAYKDDSD-DEKIT-
NDAI0A06620        -----MSKYKYRPRARTHDSE---------------------QRSPTYSTDSD-DEPLS-
NCAS0I02080        -----MAKYSYHSRLSIHRREPLQN-----------------LGTNIEPDDSD-DEKVS-
                                                                               

NCAS0C03560        -----MKSNSPMLSID--------------------------------------------
TBLA0F00860        GPPKLSNFGSALLSNQ-EEQNNK------QHQQDVMESKDSLQI-------KTDKHNI--
KNAG0K01740        GPPKLSDFGSNLLNES--------------ANHSGTFTKFRGLG-------MAHSPRV--
CAGL0K01617g       NPPKLSNFGSELISDAIENINPN------RSDKKLISEETRIHE-------SHSQQLNT-
KAFR0F02220        GPPKLSNFGSALLTEN-DNSGT----------TSRFHTQFRSLN-------GNSVHSP--
Kpol_1032.10       GFPKLSNFGSALLTSE--------------------KENITK------------------
TPHA0M00300        VLPKLSNFGSALISEK--------------------------------------------
Skud_4.223         TPPKLSNFGSALLSHT-EKASTS------EALSTNKNDKIANPV-------FEEMNRS--
Suva_4.221         TPPKLSNFGSALLSHT-EKTSVS-------QELSNKNDKIANPV-------FEETNRS--
Smik_4.207         TPPKLSNFGSALLSHS-EKTSAP------ETLSSHKTNKMTNHV-------LEEMDRS--
YDL028C            TPPKLSNFGSALLSHT-EKTSAS------EILSSHNNDKIANR--------LEEMDRS--
KLLA0C03828g       GSDGVVRLNQSSFPTA-ESQHEY---------SRYQDAKTGLEE-------PTHSNPL--
KLTH0F06468g       GPPKLSNFGSALLSDK-ENVEPYPYSRNQSVSNAKRYSQPPRAA-------ARPETFGAV
Kwal_33.14167      GPPTLSNFGSALLSDK-ENVEPHRSTASSRHHPLNQMSRTHSQL-------PSRTETLAM
SAKL0C07348g       GPPKLSNFGSALLFDK-ENHTPTGTGLQRDAAAADLRKSVAFQDISTGCQRPSQVPLSRN
ADR317C            GPPKLSNFGSALLTDK-ENETP----------TYLRRSGTSLQG-------GN-------
Ecym_5236          SPPKLSNFGSALFTDK-ENETP----------TYLRKSGVVA----------QPAPYP--
ZYRO0B04906g       IPPKLSNFGSALLSEK-EKENIN----ENDLFEMLPKDSVKPSS-------LNNEPYY--
TDEL0D04600        GPPKLSDFGVALLMEK-ENMAPSMVRRGEPSPNSFKRELKTRFG-------PTNTDYF--
NDAI0A06620        DPPKLSTFASALFSVK-DSSNQ-------LDFSENYNSTTNGPI-------NKYAGLK--
NCAS0I02080        GPPVLSNFASAFLSEG-----------------DKNTSNIREEE-------TNVFNNS--
                               :                                               

NCAS0C03560        -----------------KILESADSTCSSIFTQS-NNCQIP-SDTTIP---------IYT
TBLA0F00860        ----WRNNTNINNTSNTLFGHTDEHSQTSTSTMTSVRMHDHQSVTTLY------SDNNGK
KNAG0K01740        ----TQRIDGPGGNNIVSHRNGSSPSSSSIFGSTVYNPARPSSMTTVNNLKHEDSSRIST
CAGL0K01617g       ----DINQSTRVTHSASSPLYFEDTSPSTMFVQS-QASAQP-SATTYD------ISSQDY
KAFR0F02220        -----ISLSRNNSYGSY--GIAEQSPQTSIFATT--INNRPISMTTIQ--NGSADSNVTN
Kpol_1032.10       ----NKLTNTNLTLNDDKSLAYDNYSSTLSINRAGNVNTTS-SMSKANNNYEYNNSSENI
TPHA0M00300        ----NENITRNSLTNSSISMSSNYNQINTLTKNN--------EIGTIN---------SNF
Skud_4.223         ----SSRSHPPSSMGNLTSGHTSTSSQSTLFGRYLRNSHQT-SMTTMN------TSDIEM
Suva_4.221         ----SSRSHPPSSMGNLTSGHTSTSSHSTLFGRYLKNNHQT-SMTTMN------TNDIEI
Smik_4.207         ----SSRSHPPSSMGNLTSGHTSTSSHSTLFGRYLRNNHQT-SMTTMN------TNDIEI
YDL028C            ----SSRSHPPPSMGNLTSGHTSTSSHSTLFGRYLRNNHQT-SMTTMN------TSDIEI
KLLA0C03828g       ----HFVRHFNGRNTTHTSNHTEDQSQSTVFTMV-NKQFQP-SMTTMN-TVVKEDNDISN
KLTH0F06468g       REF-SSSNTNNSVAGPYSTFHSEEHSDSTMFATS--KHNQQ-SMTTFN----PETPSEQG
Kwal_33.14167      SREFSTANTNSSYTGPHSTIHSVDHSDSTLFATF--KDNQQ-SMTTFN------PDDQLH
SAKL0C07348g       LSLNSMSNTNNTFGASYPSYNSEDPSQSTLFTTS---RHQP-SMTTVH------PEPHGL
ADR317C            ----ATATSGHTKPSTFTGTMNTEDSHSTLFSSM--SKHQP-SMTTVD--------AERT
Ecym_5236          ----NINMNANKPPTLTGTLHMDDGSHSTLFTSV--SKHQP-SMTTVN--------QEQR
ZYRO0B04906g       ----NSVNHTPG--NTYASIHSGDPSQSTLFAQY-RSHQQP-SMTTMN------STDVQD
TDEL0D04600        ----SGSNNQTSFSQTYVSANSGEPSQSTIFAQS-RFNQQP-SMTTMD------TNGIKI
NDAI0A06620        ----NVSANESHNITNNATQFDDHSSISTIFAHT-NLPRQP-SITTTN--NNVPGDDDNA
NCAS0I02080        ----NMKLSQTPNNSIEPNQADDLSLHSTLFANT-VGNRQS-SLTTMNSTNNFALNHDTN
                                              .              .  .              

NCAS0C03560        KECDIYAK---HERYND----------------------IMEMQREMKDQI---TFKTEQ
TBLA0F00860        DLNNTLVK---DSNKST----------------------FRSLKQLSREEL---PSR---
KNAG0K01740        VKNDVLNRTLERRRLSRTASSLSNPPTVNSIDLKDHEVNIEKIKQTIRDET---TSKLLE
CAGL0K01617g       SDS--------SKSFIK----------------------LKSKQDTLKQEL---TTRYSE
KAFR0F02220        NVNDKY-----ESSYNK----------------------INKIQQSIKDEL---TSRHTG
Kpol_1032.10       STGNS--------TFQR----------------------FKGLHESIKDEL---NTKNLE
TPHA0M00300        NNG--------QIASPK----------------------FKGIKNLIDQEM---TVKHNE
Skud_4.223         SVGNSL-----DKSFER----------------------IKNLRQNMKEDI---TSKYAE
Suva_4.221         NVGNSL-----DKSFEK----------------------IRSLRQNMKEDI---TSKYTE
Smik_4.207         NVGNSL-----DKSFER----------------------IRNLRQNMKEDM---TSKYAE
YDL028C            NVGNSL-----DKSFER----------------------IRNLRQNMKEDI---TAKYAE
KLLA0C03828g       SNSNH------DNKYNK----LNEESLMKDDTHSHTSQKFKVLQQSMKEELYNSTTKSSN
KLTH0F06468g       KPEDMYL----EKSRSR----------------------VKSMQQTLRDEL---SLRSSK
Kwal_33.14167      QSGLDRVSL--EQSRSK----------------------IKSLQQALRDDL---SSRNSK
SAKL0C07348g       DSSKS------EQSSHR----------------------LRALQHSLKEEL---SSRHAK
ADR317C            APGDD------GLSSHR----------------------YQVIQQSMKDEI---LSRQGT
Ecym_5236          TPGEE------GLGSYR----------------------FQMIQQSMKDEL---SSRQIM
ZYRO0B04906g       KDGNDF-----ENSFQK----------------------IKSMQQSMREEL---TSRHAE
TDEL0D04600        PASDL------ETSFGR----------------------IKSMQQNMREEL---TTRHAQ
NDAI0A06620        RLAESYNELEMESNLQR----------------------IKVLQQSMKEEL---TSRYVE
NCAS0I02080        KEHTVF-----EDNLQK----------------------IKSLQQTMKEEL---TSRYIE
                                                              .    ::      .   

NCAS0C03560        KR-LYRWRT-RSKSHVLGPARRST----QALNKTTAKSHLS----------DLENINEPK
TBLA0F00860        QR-NRRLLQ-NLKAGNLGPASRTSSLLTNESFNSSMPLSTNTPEARQNNDNNDNDNDNTT
KNAG0K01740        RR-AKRFLN-LERRNRLGPAKRTSMT--SSLITSEMDDLLI-------------------
CAGL0K01617g       RR-TRRFLHATNRTTKLGPALRNLT---SPALAINDNNSID----------NKMNETSKV
KAFR0F02220        R--IKRFLN-TNRMNKLGPAKRAS----TMEVDIPLPANTN----------DSYNS----
Kpol_1032.10       RRKTRRFFN-RTKMGVLGPAMRTNLE--NEKLGKNSKHETI---------EEKINKYDQP
TPHA0M00300        RRKGRRIFR-KIELNSLGKAKRTNL---DYTIAPSHMTEVNYDQYQENDHKTFESMNDME
Skud_4.223         RR-SKRFLI-SNRTTKLGPAKRATTL--KSVFDDDVADSSN----------QLISISRET
Suva_4.221         RR-SKRFLI-SNRTTKLGPAKRASTL--TNVFDDDVPNSSN----------QLISNLRET
Smik_4.207         RR-SKRFLI-SNRTTKLGPAKRATTL--TNVFDEEVPNSSN----------LPINPRETI
YDL028C            RR-SKRFLI-SNRTTKLGPAKRAMTL--TNIFDEDVPNSPN----------QPINA-RET
KLLA0C03828g       KR-NRRFI--TSRLSSLGPAKRNLST--SFNVDSPSESRVDNSQINSSIINDTSNISQQD
KLTH0F06468g       RR-NRRFV--SSRFNLLGPAKRA-----SSNTGTPNHSELA----------DESNVSQQE
Kwal_33.14167      RR-TRRFA--SSRLSLLGPAKRA-----SSTSGTPNRSELI----------EESNISQPE
SAKL0C07348g       RR-NRRFV--SSRLGLLGPAKRA-----SSTAGLAYTDSGN----------DDASISQQE
ADR317C            RR-SRRFI--TSRLATLGPAKRNST---TTNFEFSSNISHD----------EPRDVSHQE
Ecym_5236          RR-SRRFI--TSRLSTLGPAKRNTTL--TANLDFSSNMSHE----------DSRDLSHQD
ZYRO0B04906g       RR-SRRFLN-SSRKEFLGPAKRA-----SAIFPEALDRRFS----------GTTNSNGTN
TDEL0D04600        RR-SRRFLH-GTRIGVLGPAKRA-----SSTNGADMSDLSI----------GNVQMVQQT
NDAI0A06620        RR-NRRFL--TSRLTRLGPAKRAS----SAVSEKDILRSID----------NNTQHLLPE
NCAS0I02080        RR-NKRFL--TSRRNNLGPAKRAST---SAISASTEDRYQE----------NDKHSNNEK
                   .    *          ** * *                                      

NCAS0C03560        RESILG------------------------------------------------------
TBLA0F00860        TTTTTTTTTNNNNNNNNNNLRNKSINNHTHTRTLPLDEIKPPTSTDIGRSYIHSSIENIP
KNAG0K01740        ------------------------------------------------------------
CAGL0K01617g       NSSFDTNNAYVDFHQT--------------------------------------------
KAFR0F02220        ------------------------------------------------------------
Kpol_1032.10       AHLISSSSTVASS-----------------------------------------------
TPHA0M00300        NDIPKYKTTTDSILSNNKSTDNLAGKNSKNHVTTP-------------------------
Skud_4.223         TESPLADS----------------------------------------------------
Suva_4.221         TESPLDDP----------------------------------------------------
Smik_4.207         ETLLEDS-----------------------------------------------------
YDL028C            VELPLEDS----------------------------------------------------
KLLA0C03828g       IENSHTSNSSNTGYRYH-------------------------------------------
KLTH0F06468g       ANFSHSSSAGATAHQN--------------------------------------------
Kwal_33.14167      GNISNSSTRTASANLN--------------------------------------------
SAKL0C07348g       ANVSGSSSTSGFVGNNE-------------------------------------------
ADR317C            GNVSTSSNSNSGVLNNN-------------------------------------------
Ecym_5236          GNISSSSNNHSGLLQNQ-------------------------------------------
ZYRO0B04906g       DNNN--------------------------------------------------------
TDEL0D04600        DNTPLEEHREVQS-----------------------------------------------
NDAI0A06620        YHTP--------------------------------------------------------
NCAS0I02080        YSTQDDSNILAKQ-----------------------------------------------
                                                                               

NCAS0C03560        ------EETGLKET----------------------------ELGELNPFQYLKKNNLPT
TBLA0F00860        LRIATTETNINTKLTNRNNNDATISNDYNHNSKPIISDYSSIEFNGLNPMQYWRKHDLPP
KNAG0K01740        ------QRDAKGEVEQQDR------------EMTPQVDYSNIVFGDLNPFQYVNKYNIPM
CAGL0K01617g       ------KQDIYTSGEEHN-----NTKDNGKIGATQQNDYSDINIHECNPIQYMKMHNLPT
KAFR0F02220        ------SSDVFSGQAIEEA---------NDIKEVQNYDYSNINFGDLNPFQFLRKYNLPT
Kpol_1032.10       ------SYTSYHDTHQSIN-----------QTSQTTINYDLIDFGELNPVQYIKKNNLPT
TPHA0M00300        ---SSSFGSTLYSSTTNPFTDSNTYNHSNTSLPNTMIDYNLIEIGDLNPFQVLKKYNLPS
Skud_4.223         ------YQAGFRGTRKKD------------------MKYESIDFEDLNPIQYIKKHNLST
Suva_4.221         ------SETEFKETKKNS-------------------DYESINFGDLNPIQYIKKHNLPT
Smik_4.207         ------NKSGFRESKKNM-------------------DYESIEFGDLNPIQYIKKHNLPT
YDL028C            ------HQTNFKETKRNT-------------------DYDSIDFGDLNPIQYIKKHNLPT
KLLA0C03828g       ------DHNIFLETHRQHSTPSHDENKDPSANLQPNINYENIDFGDLNPYQYLKKYNLPS
KLTH0F06468g       ------EYNVFYESQNSSS----PQKDSAAPTDHTSINYDNIEFGDLNPYQYLKKHNIPT
Kwal_33.14167      ------EHNIFYEPQNSNQ----AIQSSHSPFISSTINYEDVEFGDLNPYQYLKKYNLPT
SAKL0C07348g       ------GYNVFLESHTGA-----GERQHHTSSKDTGVDYRDVDFGDLNPYQYLKKHNLPT
ADR317C            ------GYNVFLDTEERAR--HDDKESHSAARQSGLSDYGNISFGDLNPYQYLKKHNLPT
Ecym_5236          ------DYNVFLDTEPNCR---PDSKENDGLKSASSIDYDNISFGDLNPYQYLKKHNLPT
ZYRO0B04906g       ------STDGLLQLNREE------------SPEEKLSLSSQVDLGDLNPVQYLKKHDLPT
TDEL0D04600        ------PAEIKPDLTKKE------------TRTRDVLDYKSIDFGDMNPVQYLKLHNLSS
NDAI0A06620        ------PLSVLDQKEISTV---------PESAARGNIDYSSIDFGRLKPFEYLKKKKLPT
NCAS0I02080        ------VGRLSSPLNRQNR--AFQSSNGDDTNMKEPVDYSSIEFGELTPFEYLKKHDLPT
                                                              :   .* :  .  .:. 

NCAS0C03560        KELSRLTKLYCNRKLDETRSKKTQ------------------------------------
TBLA0F00860        SELPKLNKAYLQKQREENRKAVLKQRSTSRMILSNKMTN---------------------
KNAG0K01740        EELPQISKVYIEKRKEENRRVALRKHSSSSLNVVSN------------------------
CAGL0K01617g       SELSKISKAYFEKQKEENRKKALKNVNMKQSLNYDLKHYSN-------------------
KAFR0F02220        TELPNISKIYFERQKEENRLSILKKHTNNNTGAKTN------------------------
Kpol_1032.10       TELPTISKLYFERQRAESRKIALKKHSSSKELLF--------------------------
TPHA0M00300        TELATISKLYFEKQKEENRKNIMKKRSVSKEG----------------------------
Skud_4.223         SDLPIISQIYFDRQREENKQAALRK-HSSRELLSRN------------------------
Suva_4.221         SDLPMISQIYFDKQREENRQAALRK-HSSRELLSKN------------------------
Smik_4.207         SDLPLISQIYFDKQREENRQAALRK-HSSRELLYKN------------------------
YDL028C            SDLPLISQIYFDKQREENRQAALRK-HSSRELLYKS------------------------
KLLA0C03828g       GELPYISKVYFERQKEENRKTVLRKA----------------------------------
KLTH0F06468g       TELPNISRLYFERQKGENRKTALRKNIAAKDAFQTRLTSA--------------------
Kwal_33.14167      TELPNISRIYFERQKGQNRKAALRKSIASKDAIQNRIAT---------------------
SAKL0C07348g       SELPNISKIYFERQKEENRRTALRKNVVTRETLHER------------------------
ADR317C            SELPNISRIYFEMQKRENRRAAVRKNVLNGSGGQVAQL----------------------
Ecym_5236          SELPNISRIYFEIQKKENRRAAVRKNIFTNNSINSSSTAKDYGGDNKHNNKHNNNNNNNN
ZYRO0B04906g       SELPRISRLYFEKQKPRKMELARLKQEILRESRTS-------------------------
TDEL0D04600        SELPKLSKVYFERQREEIHQMALQKSISSREALTNKV-----------------------
NDAI0A06620        SELPSISKAYFQKQKEESLQNTLKKRHRTLNEDPKI------------------------
NCAS0I02080        SELPYISRIYFEKQKLENRQTVLRKRRFSSKESLSLGTTSSL------------------
                    :*. :.. * : .                                              

NCAS0C03560        ---------------AIDAHEMNSSSDQLEK-----------------------------
TBLA0F00860        ---------------STSSTNNGSIKLSDNRFNSFDANNTNNDNLHKINRTKNYTKDNSL
KNAG0K01740        ---------------SSQYWANKGNYDDKSEENEKPVADLLG------------------
CAGL0K01617g       ---------------SFPSIESGKENNLIHNTEIEDF-----------------------
KAFR0F02220        ---------------GNDIKDFSISKNLTSED----------------------------
Kpol_1032.10       ---------------SSSSSALKNSFNQISDAQNESKCI---------------------
TPHA0M00300        ---------------FMTSISSNSVSSKISRQSSFHTT----------------------
Skud_4.223         ---------------RSSSTSLSSGNSLANKDASITFNS---------------------
Suva_4.221         ---------------RSSSTPLSNSYSLVNKDHSITSNS---------------------
Smik_4.207         ---------------RSSSTSLSSNNLLPSKDNSITFIN---------------------
YDL028C            ---------------RSSSSSLSSNNLLANKDNSITSNN---------------------
KLLA0C03828g       ---------------TSGTLALKREFTQYRRTQT--------------------------
KLTH0F06468g       ---------------SLSNSPLLKHVDLIKREQSIP------------------------
Kwal_33.14167      ---------------TSSPHSPPVDADAIRRDNSAF------------------------
SAKL0C07348g       ---------------VASMPNVSFGAALQQREHAGASTSTNTSNSASNSNIT--------
ADR317C            ---------------PTNNSAIASTAVALKEANGIASIS-----SGSNKLTPPQAANSMI
Ecym_5236          NNNNNNNKSNNNNNDSVNNNNIGNIHLNISNRNGNQNHNTHGNTMGTNKWTPTQTL-SVP
ZYRO0B04906g       ---------------SSGNNGSGVQHIPIRRENSLSA-----------------------
TDEL0D04600        ---------------QRSFSSISSSGNSIRRESSMPLY----------------------
NDAI0A06620        ---------------GTFNDEGGSSGNIVSKGTPRIPNL---------------------
NCAS0I02080        ---------------APYSNSKNNTTNQVSRDLSL-------------------------
                                                                               

NCAS0C03560        -----RQRKVTTTTRSIYDKNRI--------------IPSNVKNRLK-------------
TBLA0F00860        PTARANRNNTDTSPMGKSSRKNLSSPVVSTRNVFLEDIDPPFSNEKKFRIDKENNSKSGQ
KNAG0K01740        -----PAIRHSDQTGTSGPLPPR--------------TPVQLNESNH-------------
CAGL0K01617g       -----NGRGHSTNNHSSSYLSNSHS------------HPVSTQFVES-------------
KAFR0F02220        -----KTDLKNTVNTGLVSRTLLNSTLSSRKTNSSL-SPKSKDNNEF-------------
Kpol_1032.10       --SNNTGDTDALSEPKISDKENSRSTWSRNG------YAILKDDYIN-------------
TPHA0M00300        -----TNNRHSSMVSKQDTNA----------------ILMNTTSTRS-------------
Skud_4.223         --SSQPRRKVSTGSFSSKSSVEIRKTFKENV------NASNINSPNG-------------
Suva_4.221         --NSQPRRKISTGSSSSKSSIEIRKVLKENI------DTDNYSNLKS-------------
Smik_4.207         --SSLPRRKISTGSSSSKSSIEIRRALKENI------DTSNNSSFNS-------------
YDL028C            --GSQPRRKVSTGSSSSKSSIEIRRALKENI------DTSNNSNFNS-------------
KLLA0C03828g       --ARQPRRKHNFGTDKTSLQDPLSSPLQ--------------------------------
KLTH0F06468g       --KRQPRRKISDHATNNDSKAWSSPVSSSKGLK----TAPSRDGTSP-------------
Kwal_33.14167      --KRQPRRKISESATSNDPKAWSSPFSGINNP-----TVASARRTDQ-------------
SAKL0C07348g       --TRQPRRKASDTPSSAFSKSLSSPLTTSNSS-----TYAVAATAAK-------------
ADR317C            KRDRQPRRKHSDASVSSFSKLLSSPISA---------GAPNYADSQK-------------
Ecym_5236          KRDRQPRRKTSDASVSSFSKILSSPITG---------AANNYVESQK-------------
ZYRO0B04906g       --ATQPRRKLSDTSSRNIFQRGFSSPVARSV------DSQRNILSDK-------------
TDEL0D04600        -----PRRKLSDTSVSSAAKTSFQSSFSSPLA-----YPKKNFLIDQ-------------
NDAI0A06620        -----PRRKFSQASARPSAPHNL-------------------------------------
NCAS0I02080        -----PRRKISDTSSKISKQI----------------LKSNINLSES-------------
                                                                               

NCAS0C03560        -------------KGTSGKLQSGRIHQPYHLSVRN----------EQKALSQCQQEMPTA
TBLA0F00860        TRNRLGSFGSEIDNIHNRHNAIKYISRQNSSEDLHSSNRYTEN--RRTALTSIDINKR-S
KNAG0K01740        -------------NVMKQELPAHNNENYNVNKLIR----------KREVLANLNVNQK--
CAGL0K01617g       ------------ANIELEKPTLKKSLSNADSYRHT----------QREALQNIDVNSN-V
KAFR0F02220        -------------NSLDVEEPKHLTSNNDEIRPNK----------RREPLVDLSTNRK--
Kpol_1032.10       -------------NLEYYKNPSGYSSSLNK---------------KREALSSINVNTNHN
TPHA0M00300        -------------DEKVMKPLNEYEPD-------------------RKVLASIDINKNIN
Skud_4.223         -------------PVHKIYKEISRNKDPDCE--------------KREVLRNISINAN-H
Suva_4.221         -------------PINKIYRESSRNKDSDSE--------------KREALRNISINTS-H
Smik_4.207         -------------PIHNIHKEISRNKDSDSE--------------KRGVLRNISINAN-H
YDL028C            -------------PIHKIYKGISRNKDSDSE--------------KREVLRNISINAN-H
KLLA0C03828g       -------------KNQLVFQEVDRELAN-----------------KREALKPLDVNNP--
KLTH0F06468g       -------------RASEMYENIERPERDTFGSIR-----------RREALSNININSN--
Kwal_33.14167      -------------YQADEKYSNTEIPDPNAFDSFR----------RREALSNININSY--
SAKL0C07348g       -------------HPYIDHPQQKYDTPPATDTPIHK---------KREALANIDTNSQ-R
ADR317C            -------------HTPVQKNSTPYEPLLINQNTK-----------KREALNSLDVNAN-R
Ecym_5236          -------------QIQPPMQRSPVSLGPLQLNPNTK---------KREALNKLDVNST-N
ZYRO0B04906g       -------------SSLKHNEYDSYPHSNTLLYSHR----------KREALANIDVNRN-N
TDEL0D04600        -------------PVVTSKPAADHGKNLTKQYAQREQYTLESSFKKREALANIDINRN-S
NDAI0A06620        -------------PPTDKYGPIQYS--------------------SRDVLTSLDINNQ--
NCAS0I02080        -------------GSHGFPPDLQSIQRQHESAEKL----------SRAPLIDLNVNNV--
                                                                 .  *   . :    

NCAS0C03560        NEQAKLISKKLVSERVDYLIRDY-------------------------------------
TBLA0F00860        GYASPSREHKRSKTTDNYKMDVSVLESNSRIPSSANRINYRSKSALADYN-------NPM
KNAG0K01740        -----EPELKKPKNNLEQLD----------------------------------------
CAGL0K01617g       RDGAIDYKRQKIALKDSE------------------------------------------
KAFR0F02220        -----EPELKRFKTFEENKKRDEIIN----------------------------------
Kpol_1032.10       HSYQELGDNKRNKISTKGIESEIEHVAAR-------------------------------
TPHA0M00300        VNAIEKKRPVEHQYSYEKSKIHISESRESQSSTVE-----K-------------------
Skud_4.223         ADNILQQENKRLKRSLDDAIINENEDVNVKN-----------------------------
Suva_4.221         ADSGLQQDNKRLKRSLDDAIIHDNENMKN-------------------------------
Smik_4.207         ADNILQQDNKRLKRSLDDVITNENENKKI-------------------------------
YDL028C            ADNLLQQENKRLKRSLDDAITNENINSKN-------------------------------
KLLA0C03828g       ---SSSQEAKRPKYENDHVPEDYR------------------------------------
KLTH0F06468g       ---YHQLQNKRTKYSTENLEEARGIHRPPFEHSVQEERFA--------------------
Kwal_33.14167      --SAAQPQHKKPKYSDYNPQEFGRLPRPSLENRSPISNKE--------------------
SAKL0C07348g       HSHAQTKMHRSSAASLRNEVHQHRQQQLGS------------------------------
ADR317C            HPSIITKKQKVDELHD--------------------------------------------
Ecym_5236          QQAIVHKKHKSDE-----------------------------------------------
ZYRO0B04906g       NDQIYEPELKRYKYFDEHHNNNRNNDYEPESKRYDLFEDHRNGNNNKDEKPISLERLPSE
TDEL0D04600        QESLQQPKRFKPIRTQEQLSESHLPEPYVN------------------------------
NDAI0A06620        -----SPSKADHKFGYDIQIGKPYTVKTP-------------------------------
NCAS0I02080        SPKRMDKLRETHKFSDSRLNVQDFSKKT--------------------------------
                                                                               

NCAS0C03560        --------------NSKIQNKKHQTIP------------KIEAPVPQSVPSQANLM----
TBLA0F00860        QDIDHLPSSQPPVRPPPHFIPSLSQPQPQQVR------KKVEIIEPEAKIHNY-------
KNAG0K01740        ------------------------KPA---II------KRVEIQEPKPSK----------
CAGL0K01617g       --------------FDGILDKKKYRGI-----------KRVEIVEPPTSTRPPS------
KAFR0F02220        --------------EKENVVQDVPKSM-----------KRVEIMEPKMSHR---------
Kpol_1032.10       --------------NSMLEQQKVEQLNSANIH--KHGKKKVEIIEPKSASANRIA-----
TPHA0M00300        --------------PHTFQDNKEGQK----IV------KKVEIVEPPTSMTNRKS-----
Skud_4.223         --------------QEVFYHRPAPKPP---VT------KKVEIVEPARTATSSS------
Suva_4.221         --------------QDVFYHRPAPKPP---VT------KKVEIVEPIKSASLSN------
Smik_4.207         --------------QEVFYHRPAPKPP---VT------KKVEIVEPAKSASSSN------
YDL028C            --------------LEVFYHRPAPKPP---VT------KKVEIVEPAKSASLSN------
KLLA0C03828g       --------------PPFFSHRKAPSPHDSKPF------KKVEIVEPPK-STVEVIPLKSE
KLTH0F06468g       --------------NHGFKHRSPPAVP---ER------KHVEIVEPLK--TTESIPLKPP
Kwal_33.14167      --------------EPQFKHRSPPLIPG----------KHVEIVEPIR--TKESIPLKPP
SAKL0C07348g       --------------QQEFLHRRAPAPPPPPPSLPTDSDRRGELTKAAR---VETVPLKPP
ADR317C            ------------------YLKKAPAAA---SV------KKVEIVEPVRDPVITTIPLKPP
Ecym_5236          --------------QNFYHIRKAPNPP---AV------KKVEIIEPVKDTVITTIPLKPP
ZYRO0B04906g       APPVAIPIHPSVIQENEFHHREAPKPP---VV------KKVEIVEPEKRTDSKGKSSNGE
TDEL0D04600        --------------KEEYLNREPPKPR---AT------KRVEILEPKPSQGQS-------
NDAI0A06620        --------------LNESYKRLSPK-------------KKVEIIEPFIYAQKKKTG----
NCAS0I02080        --------------DVVVYEKQAPR-------------KKVEIVEPKRSHSKLA------
                                                          . *   .              

NCAS0C03560        ------------------------SK-----QWSRITDEELSIVELLGKGGSSKVYKVQD
TBLA0F00860        ------------------------QK-----PIIIVNNIEYEKVALLGRGGSSKVYKVKG
KNAG0K01740        ------------------------KN-----TSIVINNEEYEKIELLGSGGSSKVYKVRD
CAGL0K01617g       ------------------------RK-----NVVSVNGTEYERVELLGRGGSSNVYKVRG
KAFR0F02220        ------------------------QR-----NVINVNETEYEKIELLGRGGSSKVYKVKG
Kpol_1032.10       ------------------------SK-----SVVSVNGVEYEKIELLGRGGSSKVYKVKN
TPHA0M00300        ------------------------SK-----SIVSVNDIEYERIELLGRGGSSKVYKVKN
Skud_4.223         ------------------------NR-----NMITVNDSQYEKIELLGRGGSSRVYKVKG
Suva_4.221         ------------------------SR-----NIITVNDSQYEKIELLGRGGSSRVYKVKG
Smik_4.207         ------------------------NR-----SMITVNDSQYEKIELLGRGGSSRVYKVKG
YDL028C            ------------------------NR-----NIITVNDSQYEKIELLGRGGSSRVYKVKG
KLLA0C03828g       GCDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELLGKGGSGKVYKVKS
KLTH0F06468g       ATSG-------DSY--------NRRK-----PTIYVNGTEYEKLELLGRGGSSKVYKVKN
Kwal_33.14167      ASSD-------DIN--------GRKR-----PVVYVNGTEYEKLELLGRGGTSKVYKVKN
SAKL0C07348g       ATGSLKPPASLDSH--------ARRK-----PTIQVNGTEYEKMELLGRGGSSKVYKVRT
ADR317C            SAEV--PANVHQLP--------QRKR-----QVITVNGSEYEKVELLGRGGSSKVYKVRN
Ecym_5236          STE----NGSYQTP--------QRKR-----QIIQVNGSEYEKVELLGRGGSSKVYKVRS
ZYRO0B04906g       ALT---------------------RR-----NATTVNDVEYEKIELLGRGGSSKVYKVKD
TDEL0D04600        ------------------------RK-----NVVKVNDVEYEKVELLGRGGSSKVYKVRD
NDAI0A06620        ------------------------KK-----LSITVNGIDYEKIELLGRGGSSKVYKVKN
NCAS0I02080        ------------------------KR-----NTITVNDTEYEKIELLGRGGSSRVYKVKN
                                            .         :.    . : *** **:..****. 

NCAS0C03560        -RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMEC
TBLA0F00860        -PKNSYYALKRVLFDEFDDSSIEGFKGEIELLKKLEHEERVVRLFDYKMENGTLHLIMEC
KNAG0K01740        -SSKKVFALKRVAIDMFEESSVESFKGEIALLEKLKNQERVVQLYNYALESSVLYLIMEC
CAGL0K01617g       -LKNRVYALKKVSFDEFDESSVEGFKGEISLLKQLQNQNRVVQLYDFEMGSGVLYLLMEC
KAFR0F02220        -PSNKVFALKRVVFDEFDDSSINGFKGEIKLLNKLRNENRVVKLFDYEMNQGLLYLIMEC
Kpol_1032.10       VHNNKIFALKRVMFDEFDESSIDSFKGEIELLKKLENEKRVVTLIQHQMESGVLLLIMEC
TPHA0M00300        TNNNRVYALKRVVFDEFDDTSVDAFKGEIELLKKLENEKRVVKLIQYQMDNGVLYLVMEC
Skud_4.223         -SGNKVYALKRVSFDAFDDSSIDGFKGEIELLEKLKDEKRVIQLLDYEMGDGLLYLIMEC
Suva_4.221         -AGNKVYALKRVSFDAFDDSSVDGFKGEIELLEKLKDQKRVIQLLDYEMGDGLLYLIMEC
Smik_4.207         -SGNKIYALKRVSFDAFDDSSVDGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMEC
YDL028C            -SGNRVYALKRVSFDAFDDSSIDGFKGEIELLEKLKDQKRVIQLLDYEMGDGLLYLIMEC
KLLA0C03828g       -SDHKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMEC
KLTH0F06468g       VANNKVYALKRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMEC
Kwal_33.14167      ANNNKVYALKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMEC
SAKL0C07348g       -PNNKVYALKRVAFDEFDESSVDGFKGEIELLKKLENQPRVVRLVDYEMAHGVLFVVMEC
ADR317C            -SSNRIYALKRVSFDEFDDASADGFKGEIELLKKLENQTRVVKLIDHEMNHGVLYVVMEC
Ecym_5236          -SNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMEC
ZYRO0B04906g       -NNNKLYALKRVVFDEFDDSSVNGFKGEIELLNKLKDKTRVVKLFDYEMEHGVLYLIMEC
TDEL0D04600        -RSNNVYALKRVVFDEFDDSSVSGFKGEIELLKKLENQNRVVQLVDHEMEHGVLYLIMEC
NDAI0A06620        -DQNKIFALKRVSFDEFDDSSIAGFKGEIELLEKLCKEPRVVRLFDYQMSSGVLYLIMEC
NCAS0I02080        -SQNKVFALKRVSFDEFDDSSVDGFKGEIELLEKLSNESRVVKLFDYQMDSGVLFLIMEC
                         :***.: :: :::     :: ** **:.*  : **: * :. :    :  :***

NCAS0C03560        GNFDLSHVLHERV--NRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTL
TBLA0F00860        GDLDLSRILHQRS--KQPLDLEFIRYYSREMLKCVQVVHNNDIVHSDLKPANFVLVGSVL
KNAG0K01740        GDYDLSVMLRERL--NKPLDTEFVRYYAREISHCVKVVHDVGIVHSDLKPANFIFVKGTL
CAGL0K01617g       GDYDLSQVLHQRA--NQPFDMEFIRYHAREMVTCVKVVHDAGIVHSDLKPANFVFVKGIL
KAFR0F02220        GDVDLSQILNQKINLNLPFDIEFIRYYTREMIKCVKVVHDNGIVHSDLKPANFVLVKGVL
Kpol_1032.10       GDHDLSQILNQRM--NMPLDIEFIRFHAREMLKCVKVVHDAGIVHSDLKPANFVFVKGIL
TPHA0M00300        GDHDLSQILNQRA--NMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGIL
Skud_4.223         GDHDLSQILNQRG--NMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGIL
Suva_4.221         GDHDLSQILNQRS--NMSLDFNFIRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGIL
Smik_4.207         GDHDLSQILNQRS--NMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGIL
YDL028C            GDHDLSQILNQRS--GMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGIL
KLLA0C03828g       GEHDLSQVLTQRS--KIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGML
KLTH0F06468g       GDHDLSHTLALRS--GMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGIL
Kwal_33.14167      GDHDLSQTLAHRS--GMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGIL
SAKL0C07348g       GDHDLSSILAHRA--SLPLDIEFVRYHAQEMLRCVKVVHDADIVHSDLKPANFVFVKGIL
ADR317C            GDHDLSQVLAQRS--SMPLDIEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGIL
Ecym_5236          GDHDLSQVLAQRA--NMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGIL
ZYRO0B04906g       GDHDLSQILNQRA--GMPLDIEFVRYHAREMLKCVKVVHDAGIVHSDLKPANFVFVKGIL
TDEL0D04600        GDHDLSRILNHRA--GMPLDMEFVRYHAREMLRCVKVVHDSGIVHSDLKPANFVFVKGIL
NDAI0A06620        GDNDLSQVLNQRM--GFPLDMDFLRYHVRELLKCVKAVHDAGIVHSDLKPANFVFIKGLL
NCAS0I02080        GDHDLSQILSQRS--DMPLDMDFVRYHAREVVRCIKIVHDAGIVHSDLKPANFVFVKGIL
                   *: ***  *  .      :* :*:*   .*:  *:: **: .***********::: . *

NCAS0C03560        KLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSNNN-------NNLLWKIGK
TBLA0F00860        KIIDFGIANAVPDHTVNIYRECQIGTPNYMAPEALVSMNLTSNENENAQK-PVNRWKVGK
KNAG0K01740        KIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTNGES------NVSRWKVGK
CAGL0K01617g       KIIDFGIANAVPDHTVNIYRDMQIGTPNYMAPEALVANNYTADNDGKYDQ-KTNKWKIGK
KAFR0F02220        KIIDFGIADAVPDHTVNIYRETQTGTPNYMAPETLIAMNYTNNGA------KDLKWKVGK
Kpol_1032.10       KIIDFGIANAVPDHTVNIYRETQIGTPNYMAPEALVAMNSQQDSD------QQNKWKVGK
TPHA0M00300        KIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVE------KKNRWRVGK
Skud_4.223         KIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRH---DGNKWKVGR
Suva_4.221         KIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQTNENRQ---EGNKWKVGR
Smik_4.207         KIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQH---EGNKWKVGR
YDL028C            KIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNSENQH---EGNKWKVGR
KLLA0C03828g       KIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDG------EQAKWKVGK
KLTH0F06468g       KIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPA-----EQNRWKVGK
Kwal_33.14167      KIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAP-----EQSRWKVGK
SAKL0C07348g       KIIDFGIANAVPDHTVNIYRETQIGTPNYMAPEALVAMNYAQGQPH-----QQNRWKVGK
ADR317C            KIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTQDSDQIQQEMHHNRWKVGK
Ecym_5236          KIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGK
ZYRO0B04906g       KIIDFGIANAVPDHTVNIYRETQIGTPNYMAPEALVAMNYTGQNDGDKYK-QQNRWKVGK
TDEL0D04600        KIIDFGIANAVPDHTVNIYRENQIGTPNYMAPEALVAMNYTQDDEKYQ---QQNRWKVGK
NDAI0A06620        KLIDFGIANVIPDHTVNVYRESQIGTPNYMAPETLIATNHSIEQSDLNK--EMSKWKVGK
NCAS0I02080        KIIDFGIANAIPDHTVNIYRENQIGTPNYMAPEALVAMNYTNEND------GGNKWKVGK
                   *:******: :.::*:*:**: * *********:*:: *                *.:*.

NCAS0C03560        PSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALI
TBLA0F00860        PSDVWSCGCILYQMFYGKPPYGHYQGQNRLLAIMNPEVEIKYPEFTPNNEPIPRSAIDTM
KNAG0K01740        PSDVWSLGCIIYQMVYGKPPYASFQGNDRIRAIIKPSVKIEYPS-VKEGVTVPNSIIELI
CAGL0K01617g       PADIWSCGCIIYQMIYGKPPYAKYQGQERLLSIMDPNVKIEYKEVLPDKTVIPSLALELM
KAFR0F02220        PSDVWSCGCIIYQMIYGKAPYAGFQGQHRIFAIMNSDVKIVYPEKTNEEELIPKTMVELM
Kpol_1032.10       PSDIWSCGCILYQMFYGRPPYGSFQGQNRLLAIMNPNVKIVFSEKTSNNERIPRSALETM
TPHA0M00300        PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTM
Skud_4.223         PSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELM
Suva_4.221         PSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPDHTSNNERIPKSAIELM
Smik_4.207         PSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELM
YDL028C            PSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNNEKIPKSAIELM
KLLA0C03828g       PSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTI
KLTH0F06468g       PSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTM
Kwal_33.14167      PSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTM
SAKL0C07348g       PSDIWSCGCILYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTPSGDVVPRTALDTM
ADR317C            PSDIWSCGCIMYQMIYGKPPYGSFQGQNRLLAIMNPEVKIVYPEKTPTGDFVPRTALDTI
Ecym_5236          PSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTI
ZYRO0B04906g       PSDVWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIIFSEKTANDEAVPRSILDTM
TDEL0D04600        PSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPDVKIIFSDKTSRDETIPRSALDTM
NDAI0A06620        PSDVWSCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPEVKVIFSERTAKDEKIPTSLIDLM
NCAS0I02080        PSDIWSCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPDVKVIFSEKTANNESIPRSLIDLM
                   *:*:** ***:*** **..**. : .: *: :*:...::: : .       :*   :  :

NCAS0C03560        KTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLIDNAINYGIENQNITQDRIKLLSN
TBLA0F00860        KACLYRDPSKRFTIEELLNNPFFSPIMVTPFFLQDLIKNSVRYGIDRKNISNEELEKMSD
KNAG0K01740        KVCLNRDPNKRVDVDGMLNSTFLSPILVSEAFVRDLVKNAVEYGIKQGDVSITTIDALAN
CAGL0K01617g       QYCLMRNPEERWSALQILDSPFLNPLMVSQDFIKNLITTAVSYGAREGDVSPSRLEALTD
KAFR0F02220        KNCLRRDPGKRWTVDDILSSTFLNPIVTSQSFIRDLIKNAITFGSQQKIVSEDKINDLTN
Kpol_1032.10       KACLIRNPDKRWAVDQVLEGSFFNPVMVTSFIIRDLIKNAVNYGADQRYVTDEKITELAD
TPHA0M00300        KACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELAD
Skud_4.223         KACLYRNPDKRWTVDKVLNSTFLQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVE
Suva_4.221         KACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIRNAVRYGSEKPQISHDDLNDVVE
Smik_4.207         KACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVE
YDL028C            KACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIRNAVRYGSEKPHISQDDLNDVVD
KLLA0C03828g       RSCLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEELSE
KLTH0F06468g       KACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIKNSVKYGANQREISNEKIEELAE
Kwal_33.14167      KACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAE
SAKL0C07348g       KACLERNPDKRCTVDEVLNGAFIRPVSVTHFFVRDLIKNAVKYGSEQREVSSEKVEELAD
ADR317C            KACLERNPERRWTVDELLRGPFIKPITVTHFFIRDLIKNAVKYGSDQRYVSKEKVENLAD
Ecym_5236          KACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVSKEKVEDLAD
ZYRO0B04906g       KACLLRNPDKRLTVDEVLDSPFLKPVMVTPFFIRDLIKNAVRYGADQKEVSKEKVEELAD
TDEL0D04600        KACLTRNPDKRLTVDEVLESNFLKPLMVTPFFIRDLIKNAVRYGADQKEVSKEKVEELAD
NDAI0A06620        KACLLRDPAKRWSIDKLLCSPFFNPIIVTPFFIKDLIKNAVKYGTDQKTVTDAKIEELSN
NCAS0I02080        KGCLTRDPEKRWSVDQVLESPFFNPIVVTPFFIKDLIKNAVRYGVDQREVSNEKIEELAN
                   . ** *.*  *     :    :. *.  :  :: .*: .:: :*     :.   :  : :

NCAS0C03560        EVVSKLSTLNL-
TBLA0F00860        DVLNRLREFIL-
KNAG0K01740        DVIEKLSEYRI-
CAGL0K01617g       SVLARLADFRMH
KAFR0F02220        DVLTRLQEFKM-
Kpol_1032.10       DVLNRLADFRL-
TPHA0M00300        DVLNRLADFRL-
Skud_4.223         TVLRKFADYKI-
Suva_4.221         TVLRKFADYKI-
Smik_4.207         TVLRKFSDYKI-
YDL028C            TVLRKFADYKI-
KLLA0C03828g       DVWNKLAEFKL-
KLTH0F06468g       DVWHRLADFRL-
Kwal_33.14167      DVWHRLEEFRL-
SAKL0C07348g       DVWNRLAEFRL-
ADR317C            DVWHRLSDFRL-
Ecym_5236          DVWNRLSDFRL-
ZYRO0B04906g       DVLGKLADIRL-
TDEL0D04600        DVLSRLSDFRL-
NDAI0A06620        DVLERLNDFKM-
NCAS0I02080        DVLGRLTDFKM-
                    *  .:    : 

FASTA FORMAT for MUSCLE Version 3.6

>NCAS0C03560
------------------------------------------------------------
-----MKSNSPMLSID--------------------------------------------
-----------------KILESADSTCSSIFTQS-NNCQIP-SDTTIP---------IYT
KECDIYAK---HERYND----------------------IMEMQREMKDQI---TFKTEQ
KR-LYRWRT-RSKSHVLGPARRST----QALNKTTAKSHLS----------DLENINEPK
RESILG------------------------------------------------------
------EETGLKET----------------------------ELGELNPFQYLKKNNLPT
KELSRLTKLYCNRKLDETRSKKTQ------------------------------------
---------------AIDAHEMNSSSDQLEK-----------------------------
-----RQRKVTTTTRSIYDKNRI--------------IPSNVKNRLK-------------
-------------KGTSGKLQSGRIHQPYHLSVRN----------EQKALSQCQQEMPTA
NEQAKLISKKLVSERVDYLIRDY-------------------------------------
--------------NSKIQNKKHQTIP------------KIEAPVPQSVPSQANLM----
------------------------SK-----QWSRITDEELSIVELLGKGGSSKVYKVQD
-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMEC
GNFDLSHVLHERV--NRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTL
KLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSNNN-------NNLLWKIGK
PSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALI
KTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLIDNAINYGIENQNITQDRIKLLSN
EVVSKLSTLNL-
>TBLA0F00860
------MSHNIQIYPNNIHSRPNQDNEP--------------TSSHNYMDDSDDEDNIER
GPPKLSNFGSALLSNQ-EEQNNK------QHQQDVMESKDSLQI-------KTDKHNI--
----WRNNTNINNTSNTLFGHTDEHSQTSTSTMTSVRMHDHQSVTTLY------SDNNGK
DLNNTLVK---DSNKST----------------------FRSLKQLSREEL---PSR---
QR-NRRLLQ-NLKAGNLGPASRTSSLLTNESFNSSMPLSTNTPEARQNNDNNDNDNDNTT
TTTTTTTTTNNNNNNNNNNLRNKSINNHTHTRTLPLDEIKPPTSTDIGRSYIHSSIENIP
LRIATTETNINTKLTNRNNNDATISNDYNHNSKPIISDYSSIEFNGLNPMQYWRKHDLPP
SELPKLNKAYLQKQREENRKAVLKQRSTSRMILSNKMTN---------------------
---------------STSSTNNGSIKLSDNRFNSFDANNTNNDNLHKINRTKNYTKDNSL
PTARANRNNTDTSPMGKSSRKNLSSPVVSTRNVFLEDIDPPFSNEKKFRIDKENNSKSGQ
TRNRLGSFGSEIDNIHNRHNAIKYISRQNSSEDLHSSNRYTEN--RRTALTSIDINKR-S
GYASPSREHKRSKTTDNYKMDVSVLESNSRIPSSANRINYRSKSALADYN-------NPM
QDIDHLPSSQPPVRPPPHFIPSLSQPQPQQVR------KKVEIIEPEAKIHNY-------
------------------------QK-----PIIIVNNIEYEKVALLGRGGSSKVYKVKG
-PKNSYYALKRVLFDEFDDSSIEGFKGEIELLKKLEHEERVVRLFDYKMENGTLHLIMEC
GDLDLSRILHQRS--KQPLDLEFIRYYSREMLKCVQVVHNNDIVHSDLKPANFVLVGSVL
KIIDFGIANAVPDHTVNIYRECQIGTPNYMAPEALVSMNLTSNENENAQK-PVNRWKVGK
PSDVWSCGCILYQMFYGKPPYGHYQGQNRLLAIMNPEVEIKYPEFTPNNEPIPRSAIDTM
KACLYRDPSKRFTIEELLNNPFFSPIMVTPFFLQDLIKNSVRYGIDRKNISNEELEKMSD
DVLNRLREFIL-
>KNAG0K01740
-----MSRYLSQDRRGADGNIEGAGSLSRSTSTI--------RSMVDASDDEEDEDNII-
GPPKLSDFGSNLLNES--------------ANHSGTFTKFRGLG-------MAHSPRV--
----TQRIDGPGGNNIVSHRNGSSPSSSSIFGSTVYNPARPSSMTTVNNLKHEDSSRIST
VKNDVLNRTLERRRLSRTASSLSNPPTVNSIDLKDHEVNIEKIKQTIRDET---TSKLLE
RR-AKRFLN-LERRNRLGPAKRTSMT--SSLITSEMDDLLI-------------------
------------------------------------------------------------
------QRDAKGEVEQQDR------------EMTPQVDYSNIVFGDLNPFQYVNKYNIPM
EELPQISKVYIEKRKEENRRVALRKHSSSSLNVVSN------------------------
---------------SSQYWANKGNYDDKSEENEKPVADLLG------------------
-----PAIRHSDQTGTSGPLPPR--------------TPVQLNESNH-------------
-------------NVMKQELPAHNNENYNVNKLIR----------KREVLANLNVNQK--
-----EPELKKPKNNLEQLD----------------------------------------
------------------------KPA---II------KRVEIQEPKPSK----------
------------------------KN-----TSIVINNEEYEKIELLGSGGSSKVYKVRD
-SSKKVFALKRVAIDMFEESSVESFKGEIALLEKLKNQERVVQLYNYALESSVLYLIMEC
GDYDLSVMLRERL--NKPLDTEFVRYYAREISHCVKVVHDVGIVHSDLKPANFIFVKGTL
KIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTNGES------NVSRWKVGK
PSDVWSLGCIIYQMVYGKPPYASFQGNDRIRAIIKPSVKIEYPS-VKEGVTVPNSIIELI
KVCLNRDPNKRVDVDGMLNSTFLSPILVSEAFVRDLVKNAVEYGIKQGDVSITTIDALAN
DVIEKLSEYRI-
>CAGL0K01617g
------MGNPYHSESD--------------------------QIWRISSQDSD-DGEIG-
NPPKLSNFGSELISDAIENINPN------RSDKKLISEETRIHE-------SHSQQLNT-
----DINQSTRVTHSASSPLYFEDTSPSTMFVQS-QASAQP-SATTYD------ISSQDY
SDS--------SKSFIK----------------------LKSKQDTLKQEL---TTRYSE
RR-TRRFLHATNRTTKLGPALRNLT---SPALAINDNNSID----------NKMNETSKV
NSSFDTNNAYVDFHQT--------------------------------------------
------KQDIYTSGEEHN-----NTKDNGKIGATQQNDYSDINIHECNPIQYMKMHNLPT
SELSKISKAYFEKQKEENRKKALKNVNMKQSLNYDLKHYSN-------------------
---------------SFPSIESGKENNLIHNTEIEDF-----------------------
-----NGRGHSTNNHSSSYLSNSHS------------HPVSTQFVES-------------
------------ANIELEKPTLKKSLSNADSYRHT----------QREALQNIDVNSN-V
RDGAIDYKRQKIALKDSE------------------------------------------
--------------FDGILDKKKYRGI-----------KRVEIVEPPTSTRPPS------
------------------------RK-----NVVSVNGTEYERVELLGRGGSSNVYKVRG
-LKNRVYALKKVSFDEFDESSVEGFKGEISLLKQLQNQNRVVQLYDFEMGSGVLYLLMEC
GDYDLSQVLHQRA--NQPFDMEFIRYHAREMVTCVKVVHDAGIVHSDLKPANFVFVKGIL
KIIDFGIANAVPDHTVNIYRDMQIGTPNYMAPEALVANNYTADNDGKYDQ-KTNKWKIGK
PADIWSCGCIIYQMIYGKPPYAKYQGQERLLSIMDPNVKIEYKEVLPDKTVIPSLALELM
QYCLMRNPEERWSALQILDSPFLNPLMVSQDFIKNLITTAVSYGAREGDVSPSRLEALTD
SVLARLADFRMH
>KAFR0F02220
-----MSKYTHPSRSRLQRQH---------------------QNLSSISNDSDDDENII-
GPPKLSNFGSALLTEN-DNSGT----------TSRFHTQFRSLN-------GNSVHSP--
-----ISLSRNNSYGSY--GIAEQSPQTSIFATT--INNRPISMTTIQ--NGSADSNVTN
NVNDKY-----ESSYNK----------------------INKIQQSIKDEL---TSRHTG
R--IKRFLN-TNRMNKLGPAKRAS----TMEVDIPLPANTN----------DSYNS----
------------------------------------------------------------
------SSDVFSGQAIEEA---------NDIKEVQNYDYSNINFGDLNPFQFLRKYNLPT
TELPNISKIYFERQKEENRLSILKKHTNNNTGAKTN------------------------
---------------GNDIKDFSISKNLTSED----------------------------
-----KTDLKNTVNTGLVSRTLLNSTLSSRKTNSSL-SPKSKDNNEF-------------
-------------NSLDVEEPKHLTSNNDEIRPNK----------RREPLVDLSTNRK--
-----EPELKRFKTFEENKKRDEIIN----------------------------------
--------------EKENVVQDVPKSM-----------KRVEIMEPKMSHR---------
------------------------QR-----NVINVNETEYEKIELLGRGGSSKVYKVKG
-PSNKVFALKRVVFDEFDDSSINGFKGEIKLLNKLRNENRVVKLFDYEMNQGLLYLIMEC
GDVDLSQILNQKINLNLPFDIEFIRYYTREMIKCVKVVHDNGIVHSDLKPANFVLVKGVL
KIIDFGIADAVPDHTVNIYRETQTGTPNYMAPETLIAMNYTNNGA------KDLKWKVGK
PSDVWSCGCIIYQMIYGKAPYAGFQGQHRIFAIMNSDVKIVYPEKTNEEELIPKTMVELM
KNCLRRDPGKRWTVDDILSSTFLNPIVTSQSFIRDLIKNAITFGSQQKIVSEDKINDLTN
DVLTRLQEFKM-
>Kpol_1032.10
------MGNNLMYKPTSIDIHKNQDLKLNSKYSRNEGMIEGNDNNKNIQDDSD-DEQIT-
GFPKLSNFGSALLTSE--------------------KENITK------------------
----NKLTNTNLTLNDDKSLAYDNYSSTLSINRAGNVNTTS-SMSKANNNYEYNNSSENI
STGNS--------TFQR----------------------FKGLHESIKDEL---NTKNLE
RRKTRRFFN-RTKMGVLGPAMRTNLE--NEKLGKNSKHETI---------EEKINKYDQP
AHLISSSSTVASS-----------------------------------------------
------SYTSYHDTHQSIN-----------QTSQTTINYDLIDFGELNPVQYIKKNNLPT
TELPTISKLYFERQRAESRKIALKKHSSSKELLF--------------------------
---------------SSSSSALKNSFNQISDAQNESKCI---------------------
--SNNTGDTDALSEPKISDKENSRSTWSRNG------YAILKDDYIN-------------
-------------NLEYYKNPSGYSSSLNK---------------KREALSSINVNTNHN
HSYQELGDNKRNKISTKGIESEIEHVAAR-------------------------------
--------------NSMLEQQKVEQLNSANIH--KHGKKKVEIIEPKSASANRIA-----
------------------------SK-----SVVSVNGVEYEKIELLGRGGSSKVYKVKN
VHNNKIFALKRVMFDEFDESSIDSFKGEIELLKKLENEKRVVTLIQHQMESGVLLLIMEC
GDHDLSQILNQRM--NMPLDIEFIRFHAREMLKCVKVVHDAGIVHSDLKPANFVFVKGIL
KIIDFGIANAVPDHTVNIYRETQIGTPNYMAPEALVAMNSQQDSD------QQNKWKVGK
PSDIWSCGCILYQMFYGRPPYGSFQGQNRLLAIMNPNVKIVFSEKTSNNERIPRSALETM
KACLIRNPDKRWAVDQVLEGSFFNPVMVTSFIIRDLIKNAVNYGADQRYVTDEKITELAD
DVLNRLADFRL-
>TPHA0M00300
-----MVLNDNTRFSKSGGIRN--------------------DTIQTYNNDSDSDEKLT-
VLPKLSNFGSALISEK--------------------------------------------
----NENITRNSLTNSSISMSSNYNQINTLTKNN--------EIGTIN---------SNF
NNG--------QIASPK----------------------FKGIKNLIDQEM---TVKHNE
RRKGRRIFR-KIELNSLGKAKRTNL---DYTIAPSHMTEVNYDQYQENDHKTFESMNDME
NDIPKYKTTTDSILSNNKSTDNLAGKNSKNHVTTP-------------------------
---SSSFGSTLYSSTTNPFTDSNTYNHSNTSLPNTMIDYNLIEIGDLNPFQVLKKYNLPS
TELATISKLYFEKQKEENRKNIMKKRSVSKEG----------------------------
---------------FMTSISSNSVSSKISRQSSFHTT----------------------
-----TNNRHSSMVSKQDTNA----------------ILMNTTSTRS-------------
-------------DEKVMKPLNEYEPD-------------------RKVLASIDINKNIN
VNAIEKKRPVEHQYSYEKSKIHISESRESQSSTVE-----K-------------------
--------------PHTFQDNKEGQK----IV------KKVEIVEPPTSMTNRKS-----
------------------------SK-----SIVSVNDIEYERIELLGRGGSSKVYKVKN
TNNNRVYALKRVVFDEFDDTSVDAFKGEIELLKKLENEKRVVKLIQYQMDNGVLYLVMEC
GDHDLSQILNQRA--NMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGIL
KIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVALNEVSNVE------KKNRWRVGK
PSDIWSCGCIMYQMFYGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTM
KACLIRSPEKRWTADEILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELAD
DVLNRLADFRL-
>Skud_4.223
-----MSTNSFHDYMDS-------------------------KSKMNTRQLSD-DEEFT-
TPPKLSNFGSALLSHT-EKASTS------EALSTNKNDKIANPV-------FEEMNRS--
----SSRSHPPSSMGNLTSGHTSTSSQSTLFGRYLRNSHQT-SMTTMN------TSDIEM
SVGNSL-----DKSFER----------------------IKNLRQNMKEDI---TSKYAE
RR-SKRFLI-SNRTTKLGPAKRATTL--KSVFDDDVADSSN----------QLISISRET
TESPLADS----------------------------------------------------
------YQAGFRGTRKKD------------------MKYESIDFEDLNPIQYIKKHNLST
SDLPIISQIYFDRQREENKQAALRK-HSSRELLSRN------------------------
---------------RSSSTSLSSGNSLANKDASITFNS---------------------
--SSQPRRKVSTGSFSSKSSVEIRKTFKENV------NASNINSPNG-------------
-------------PVHKIYKEISRNKDPDCE--------------KREVLRNISINAN-H
ADNILQQENKRLKRSLDDAIINENEDVNVKN-----------------------------
--------------QEVFYHRPAPKPP---VT------KKVEIVEPARTATSSS------
------------------------NR-----NMITVNDSQYEKIELLGRGGSSRVYKVKG
-SGNKVYALKRVSFDAFDDSSIDGFKGEIELLEKLKDEKRVIQLLDYEMGDGLLYLIMEC
GDHDLSQILNQRG--NMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGIL
KIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRH---DGNKWKVGR
PSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELM
KACLYRNPDKRWTVDKVLNSTFLQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVE
TVLRKFADYKI-
>Suva_4.221
-----MSTNSFHDYMDS-------------------------KSRMNARQFSD-DEEFT-
TPPKLSNFGSALLSHT-EKTSVS-------QELSNKNDKIANPV-------FEETNRS--
----SSRSHPPSSMGNLTSGHTSTSSHSTLFGRYLKNNHQT-SMTTMN------TNDIEI
NVGNSL-----DKSFEK----------------------IRSLRQNMKEDI---TSKYTE
RR-SKRFLI-SNRTTKLGPAKRASTL--TNVFDDDVPNSSN----------QLISNLRET
TESPLDDP----------------------------------------------------
------SETEFKETKKNS-------------------DYESINFGDLNPIQYIKKHNLPT
SDLPMISQIYFDKQREENRQAALRK-HSSRELLSKN------------------------
---------------RSSSTPLSNSYSLVNKDHSITSNS---------------------
--NSQPRRKISTGSSSSKSSIEIRKVLKENI------DTDNYSNLKS-------------
-------------PINKIYRESSRNKDSDSE--------------KREALRNISINTS-H
ADSGLQQDNKRLKRSLDDAIIHDNENMKN-------------------------------
--------------QDVFYHRPAPKPP---VT------KKVEIVEPIKSASLSN------
------------------------SR-----NIITVNDSQYEKIELLGRGGSSRVYKVKG
-AGNKVYALKRVSFDAFDDSSVDGFKGEIELLEKLKDQKRVIQLLDYEMGDGLLYLIMEC
GDHDLSQILNQRS--NMSLDFNFIRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGIL
KIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQTNENRQ---EGNKWKVGR
PSDMWSCGCIVYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPDHTSNNERIPKSAIELM
KACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIRNAVRYGSEKPQISHDDLNDVVE
TVLRKFADYKI-
>Smik_4.207
-----MSTNSFHDYMDL-------------------------NSRTNMRQFSD-DEEFT-
TPPKLSNFGSALLSHS-EKTSAP------ETLSSHKTNKMTNHV-------LEEMDRS--
----SSRSHPPSSMGNLTSGHTSTSSHSTLFGRYLRNNHQT-SMTTMN------TNDIEI
NVGNSL-----DKSFER----------------------IRNLRQNMKEDM---TSKYAE
RR-SKRFLI-SNRTTKLGPAKRATTL--TNVFDEEVPNSSN----------LPINPRETI
ETLLEDS-----------------------------------------------------
------NKSGFRESKKNM-------------------DYESIEFGDLNPIQYIKKHNLPT
SDLPLISQIYFDKQREENRQAALRK-HSSRELLYKN------------------------
---------------RSSSTSLSSNNLLPSKDNSITFIN---------------------
--SSLPRRKISTGSSSSKSSIEIRRALKENI------DTSNNSSFNS-------------
-------------PIHNIHKEISRNKDSDSE--------------KRGVLRNISINAN-H
ADNILQQDNKRLKRSLDDVITNENENKKI-------------------------------
--------------QEVFYHRPAPKPP---VT------KKVEIVEPAKSASSSN------
------------------------NR-----SMITVNDSQYEKIELLGRGGSSRVYKVKG
-SGNKIYALKRVSFDAFDDSSVDGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMEC
GDHDLSQILNQRS--NMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGIL
KIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQH---EGNKWKVGR
PSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELM
KACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVE
TVLRKFSDYKI-
>YDL028C
-----MSTNSFHDYVDL-------------------------KSRTNTRQFSD-DEEFT-
TPPKLSNFGSALLSHT-EKTSAS------EILSSHNNDKIANR--------LEEMDRS--
----SSRSHPPPSMGNLTSGHTSTSSHSTLFGRYLRNNHQT-SMTTMN------TSDIEI
NVGNSL-----DKSFER----------------------IRNLRQNMKEDI---TAKYAE
RR-SKRFLI-SNRTTKLGPAKRAMTL--TNIFDEDVPNSPN----------QPINA-RET
VELPLEDS----------------------------------------------------
------HQTNFKETKRNT-------------------DYDSIDFGDLNPIQYIKKHNLPT
SDLPLISQIYFDKQREENRQAALRK-HSSRELLYKS------------------------
---------------RSSSSSLSSNNLLANKDNSITSNN---------------------
--GSQPRRKVSTGSSSSKSSIEIRRALKENI------DTSNNSNFNS-------------
-------------PIHKIYKGISRNKDSDSE--------------KREVLRNISINAN-H
ADNLLQQENKRLKRSLDDAITNENINSKN-------------------------------
--------------LEVFYHRPAPKPP---VT------KKVEIVEPAKSASLSN------
------------------------NR-----NIITVNDSQYEKIELLGRGGSSRVYKVKG
-SGNRVYALKRVSFDAFDDSSIDGFKGEIELLEKLKDQKRVIQLLDYEMGDGLLYLIMEC
GDHDLSQILNQRS--GMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGIL
KIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNSENQH---EGNKWKVGR
PSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNNEKIPKSAIELM
KACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIRNAVRYGSEKPHISQDDLNDVVD
TVLRKFADYKI-
>KLLA0C03828g
---------------------------------------------------------ML-
GSDGVVRLNQSSFPTA-ESQHEY---------SRYQDAKTGLEE-------PTHSNPL--
----HFVRHFNGRNTTHTSNHTEDQSQSTVFTMV-NKQFQP-SMTTMN-TVVKEDNDISN
SNSNH------DNKYNK----LNEESLMKDDTHSHTSQKFKVLQQSMKEELYNSTTKSSN
KR-NRRFI--TSRLSSLGPAKRNLST--SFNVDSPSESRVDNSQINSSIINDTSNISQQD
IENSHTSNSSNTGYRYH-------------------------------------------
------DHNIFLETHRQHSTPSHDENKDPSANLQPNINYENIDFGDLNPYQYLKKYNLPS
GELPYISKVYFERQKEENRKTVLRKA----------------------------------
---------------TSGTLALKREFTQYRRTQT--------------------------
--ARQPRRKHNFGTDKTSLQDPLSSPLQ--------------------------------
-------------KNQLVFQEVDRELAN-----------------KREALKPLDVNNP--
---SSSQEAKRPKYENDHVPEDYR------------------------------------
--------------PPFFSHRKAPSPHDSKPF------KKVEIVEPPK-STVEVIPLKSE
GCDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELLGKGGSGKVYKVKS
-SDHKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMEC
GEHDLSQVLTQRS--KIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGML
KIIDFGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDG------EQAKWKVGK
PSDVWSCGCILYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTI
RSCLERNPISRVTIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEELSE
DVWNKLAEFKL-
>KLTH0F06468g
-------MSSYTVRSSVPGAPSNRRLEFPARRT---------SVQSLARDDSD-DENML-
GPPKLSNFGSALLSDK-ENVEPYPYSRNQSVSNAKRYSQPPRAA-------ARPETFGAV
REF-SSSNTNNSVAGPYSTFHSEEHSDSTMFATS--KHNQQ-SMTTFN----PETPSEQG
KPEDMYL----EKSRSR----------------------VKSMQQTLRDEL---SLRSSK
RR-NRRFV--SSRFNLLGPAKRA-----SSNTGTPNHSELA----------DESNVSQQE
ANFSHSSSAGATAHQN--------------------------------------------
------EYNVFYESQNSSS----PQKDSAAPTDHTSINYDNIEFGDLNPYQYLKKHNIPT
TELPNISRLYFERQKGENRKTALRKNIAAKDAFQTRLTSA--------------------
---------------SLSNSPLLKHVDLIKREQSIP------------------------
--KRQPRRKISDHATNNDSKAWSSPVSSSKGLK----TAPSRDGTSP-------------
-------------RASEMYENIERPERDTFGSIR-----------RREALSNININSN--
---YHQLQNKRTKYSTENLEEARGIHRPPFEHSVQEERFA--------------------
--------------NHGFKHRSPPAVP---ER------KHVEIVEPLK--TTESIPLKPP
ATSG-------DSY--------NRRK-----PTIYVNGTEYEKLELLGRGGSSKVYKVKN
VANNKVYALKRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMEC
GDHDLSHTLALRS--GMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGIL
KIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPA-----EQNRWKVGK
PSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTM
KACLERNPEKRWSVDEVLNGPFVKPIAVTHFFIRDLIKNSVKYGANQREISNEKIEELAE
DVWHRLADFRL-
>Kwal_33.14167
-------MSSYSVRSNLISKPPEIRG----LDFRPRRP----NIHSTARDDSD-DENML-
GPPTLSNFGSALLSDK-ENVEPHRSTASSRHHPLNQMSRTHSQL-------PSRTETLAM
SREFSTANTNSSYTGPHSTIHSVDHSDSTLFATF--KDNQQ-SMTTFN------PDDQLH
QSGLDRVSL--EQSRSK----------------------IKSLQQALRDDL---SSRNSK
RR-TRRFA--SSRLSLLGPAKRA-----SSTSGTPNRSELI----------EESNISQPE
GNISNSSTRTASANLN--------------------------------------------
------EHNIFYEPQNSNQ----AIQSSHSPFISSTINYEDVEFGDLNPYQYLKKYNLPT
TELPNISRIYFERQKGQNRKAALRKSIASKDAIQNRIAT---------------------
---------------TSSPHSPPVDADAIRRDNSAF------------------------
--KRQPRRKISESATSNDPKAWSSPFSGINNP-----TVASARRTDQ-------------
-------------YQADEKYSNTEIPDPNAFDSFR----------RREALSNININSY--
--SAAQPQHKKPKYSDYNPQEFGRLPRPSLENRSPISNKE--------------------
--------------EPQFKHRSPPLIPG----------KHVEIVEPIR--TKESIPLKPP
ASSD-------DIN--------GRKR-----PVVYVNGTEYEKLELLGRGGTSKVYKVKN
ANNNKVYALKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMEC
GDHDLSQTLAHRS--GMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGIL
KIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTHNQAP-----EQSRWKVGK
PSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTM
KACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAE
DVWHRLEEFRL-
>SAKL0C07348g
MHNPPVASSSFGPDTGKQESHLFQRS----------------SQRVSLKDDSD-DEHPI-
GPPKLSNFGSALLFDK-ENHTPTGTGLQRDAAAADLRKSVAFQDISTGCQRPSQVPLSRN
LSLNSMSNTNNTFGASYPSYNSEDPSQSTLFTTS---RHQP-SMTTVH------PEPHGL
DSSKS------EQSSHR----------------------LRALQHSLKEEL---SSRHAK
RR-NRRFV--SSRLGLLGPAKRA-----SSTAGLAYTDSGN----------DDASISQQE
ANVSGSSSTSGFVGNNE-------------------------------------------
------GYNVFLESHTGA-----GERQHHTSSKDTGVDYRDVDFGDLNPYQYLKKHNLPT
SELPNISKIYFERQKEENRRTALRKNVVTRETLHER------------------------
---------------VASMPNVSFGAALQQREHAGASTSTNTSNSASNSNIT--------
--TRQPRRKASDTPSSAFSKSLSSPLTTSNSS-----TYAVAATAAK-------------
-------------HPYIDHPQQKYDTPPATDTPIHK---------KREALANIDTNSQ-R
HSHAQTKMHRSSAASLRNEVHQHRQQQLGS------------------------------
--------------QQEFLHRRAPAPPPPPPSLPTDSDRRGELTKAAR---VETVPLKPP
ATGSLKPPASLDSH--------ARRK-----PTIQVNGTEYEKMELLGRGGSSKVYKVRT
-PNNKVYALKRVAFDEFDESSVDGFKGEIELLKKLENQPRVVRLVDYEMAHGVLFVVMEC
GDHDLSSILAHRA--SLPLDIEFVRYHAQEMLRCVKVVHDADIVHSDLKPANFVFVKGIL
KIIDFGIANAVPDHTVNIYRETQIGTPNYMAPEALVAMNYAQGQPH-----QQNRWKVGK
PSDIWSCGCILYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTPSGDVVPRTALDTM
KACLERNPDKRCTVDEVLNGAFIRPVSVTHFFVRDLIKNAVKYGSEQREVSSEKVEELAD
DVWNRLAEFRL-
>ADR317C
------MRELGTSQQYLRPASSCSQSGSVNQLLR--------RPQLHLNSDSD-DDHPL-
GPPKLSNFGSALLTDK-ENETP----------TYLRRSGTSLQG-------GN-------
----ATATSGHTKPSTFTGTMNTEDSHSTLFSSM--SKHQP-SMTTVD--------AERT
APGDD------GLSSHR----------------------YQVIQQSMKDEI---LSRQGT
RR-SRRFI--TSRLATLGPAKRNST---TTNFEFSSNISHD----------EPRDVSHQE
GNVSTSSNSNSGVLNNN-------------------------------------------
------GYNVFLDTEERAR--HDDKESHSAARQSGLSDYGNISFGDLNPYQYLKKHNLPT
SELPNISRIYFEMQKRENRRAAVRKNVLNGSGGQVAQL----------------------
---------------PTNNSAIASTAVALKEANGIASIS-----SGSNKLTPPQAANSMI
KRDRQPRRKHSDASVSSFSKLLSSPISA---------GAPNYADSQK-------------
-------------HTPVQKNSTPYEPLLINQNTK-----------KREALNSLDVNAN-R
HPSIITKKQKVDELHD--------------------------------------------
------------------YLKKAPAAA---SV------KKVEIVEPVRDPVITTIPLKPP
SAEV--PANVHQLP--------QRKR-----QVITVNGSEYEKVELLGRGGSSKVYKVRN
-SSNRIYALKRVSFDEFDDASADGFKGEIELLKKLENQTRVVKLIDHEMNHGVLYVVMEC
GDHDLSQVLAQRS--SMPLDIEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGIL
KIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTQDSDQIQQEMHHNRWKVGK
PSDIWSCGCIMYQMIYGKPPYGSFQGQNRLLAIMNPEVKIVYPEKTPTGDFVPRTALDTI
KACLERNPERRWTVDELLRGPFIKPITVTHFFIRDLIKNAVKYGSDQRYVSKEKVENLAD
DVWHRLSDFRL-
>Ecym_5236
------MQDSVTSHQYLHPVSNYNNGNIGSVNNIM-------RRSQGDIIDSD-DENPL-
SPPKLSNFGSALFTDK-ENETP----------TYLRKSGVVA----------QPAPYP--
----NINMNANKPPTLTGTLHMDDGSHSTLFTSV--SKHQP-SMTTVN--------QEQR
TPGEE------GLGSYR----------------------FQMIQQSMKDEL---SSRQIM
RR-SRRFI--TSRLSTLGPAKRNTTL--TANLDFSSNMSHE----------DSRDLSHQD
GNISSSSNNHSGLLQNQ-------------------------------------------
------DYNVFLDTEPNCR---PDSKENDGLKSASSIDYDNISFGDLNPYQYLKKHNLPT
SELPNISRIYFEIQKKENRRAAVRKNIFTNNSINSSSTAKDYGGDNKHNNKHNNNNNNNN
NNNNNNNKSNNNNNDSVNNNNIGNIHLNISNRNGNQNHNTHGNTMGTNKWTPTQTL-SVP
KRDRQPRRKTSDASVSSFSKILSSPITG---------AANNYVESQK-------------
-------------QIQPPMQRSPVSLGPLQLNPNTK---------KREALNKLDVNST-N
QQAIVHKKHKSDE-----------------------------------------------
--------------QNFYHIRKAPNPP---AV------KKVEIIEPVKDTVITTIPLKPP
STE----NGSYQTP--------QRKR-----QIIQVNGSEYEKVELLGRGGSSKVYKVRS
-SNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMEC
GDHDLSQVLAQRA--NMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGIL
KIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGK
PSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTI
KACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVSKEKVEDLAD
DVWNRLSDFRL-
>ZYRO0B04906g
------MLPRYNSLPGSEQRQPPRNKGTWKYSLFPEHDQKKVSTKTIFTDDSD-DEKIS-
IPPKLSNFGSALLSEK-EKENIN----ENDLFEMLPKDSVKPSS-------LNNEPYY--
----NSVNHTPG--NTYASIHSGDPSQSTLFAQY-RSHQQP-SMTTMN------STDVQD
KDGNDF-----ENSFQK----------------------IKSMQQSMREEL---TSRHAE
RR-SRRFLN-SSRKEFLGPAKRA-----SAIFPEALDRRFS----------GTTNSNGTN
DNNN--------------------------------------------------------
------STDGLLQLNREE------------SPEEKLSLSSQVDLGDLNPVQYLKKHDLPT
SELPRISRLYFEKQKPRKMELARLKQEILRESRTS-------------------------
---------------SSGNNGSGVQHIPIRRENSLSA-----------------------
--ATQPRRKLSDTSSRNIFQRGFSSPVARSV------DSQRNILSDK-------------
-------------SSLKHNEYDSYPHSNTLLYSHR----------KREALANIDVNRN-N
NDQIYEPELKRYKYFDEHHNNNRNNDYEPESKRYDLFEDHRNGNNNKDEKPISLERLPSE
APPVAIPIHPSVIQENEFHHREAPKPP---VV------KKVEIVEPEKRTDSKGKSSNGE
ALT---------------------RR-----NATTVNDVEYEKIELLGRGGSSKVYKVKD
-NNNKLYALKRVVFDEFDDSSVNGFKGEIELLNKLKDKTRVVKLFDYEMEHGVLYLIMEC
GDHDLSQILNQRA--GMPLDIEFVRYHAREMLKCVKVVHDAGIVHSDLKPANFVFVKGIL
KIIDFGIANAVPDHTVNIYRETQIGTPNYMAPEALVAMNYTGQNDGDKYK-QQNRWKVGK
PSDVWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIIFSEKTANDEAVPRSILDTM
KACLLRNPDKRLTVDEVLDSPFLKPVMVTPFFIRDLIKNAVRYGADQKEVSKEKVEELAD
DVLGKLADIRL-
>TDEL0D04600
------MSEYLGIYPSSLERK---------------------KSHAAYKDDSD-DEKIT-
GPPKLSDFGVALLMEK-ENMAPSMVRRGEPSPNSFKRELKTRFG-------PTNTDYF--
----SGSNNQTSFSQTYVSANSGEPSQSTIFAQS-RFNQQP-SMTTMD------TNGIKI
PASDL------ETSFGR----------------------IKSMQQNMREEL---TTRHAQ
RR-SRRFLH-GTRIGVLGPAKRA-----SSTNGADMSDLSI----------GNVQMVQQT
DNTPLEEHREVQS-----------------------------------------------
------PAEIKPDLTKKE------------TRTRDVLDYKSIDFGDMNPVQYLKLHNLSS
SELPKLSKVYFERQREEIHQMALQKSISSREALTNKV-----------------------
---------------QRSFSSISSSGNSIRRESSMPLY----------------------
-----PRRKLSDTSVSSAAKTSFQSSFSSPLA-----YPKKNFLIDQ-------------
-------------PVVTSKPAADHGKNLTKQYAQREQYTLESSFKKREALANIDINRN-S
QESLQQPKRFKPIRTQEQLSESHLPEPYVN------------------------------
--------------KEEYLNREPPKPR---AT------KRVEILEPKPSQGQS-------
------------------------RK-----NVVKVNDVEYEKVELLGRGGSSKVYKVRD
-RSNNVYALKRVVFDEFDDSSVSGFKGEIELLKKLENQNRVVQLVDHEMEHGVLYLIMEC
GDHDLSRILNHRA--GMPLDMEFVRYHAREMLRCVKVVHDSGIVHSDLKPANFVFVKGIL
KIIDFGIANAVPDHTVNIYRENQIGTPNYMAPEALVAMNYTQDDEKYQ---QQNRWKVGK
PSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPDVKIIFSDKTSRDETIPRSALDTM
KACLTRNPDKRLTVDEVLESNFLKPLMVTPFFIRDLIKNAVRYGADQKEVSKEKVEELAD
DVLSRLSDFRL-
>NDAI0A06620
-----MSKYKYRPRARTHDSE---------------------QRSPTYSTDSD-DEPLS-
DPPKLSTFASALFSVK-DSSNQ-------LDFSENYNSTTNGPI-------NKYAGLK--
----NVSANESHNITNNATQFDDHSSISTIFAHT-NLPRQP-SITTTN--NNVPGDDDNA
RLAESYNELEMESNLQR----------------------IKVLQQSMKEEL---TSRYVE
RR-NRRFL--TSRLTRLGPAKRAS----SAVSEKDILRSID----------NNTQHLLPE
YHTP--------------------------------------------------------
------PLSVLDQKEISTV---------PESAARGNIDYSSIDFGRLKPFEYLKKKKLPT
SELPSISKAYFQKQKEESLQNTLKKRHRTLNEDPKI------------------------
---------------GTFNDEGGSSGNIVSKGTPRIPNL---------------------
-----PRRKFSQASARPSAPHNL-------------------------------------
-------------PPTDKYGPIQYS--------------------SRDVLTSLDINNQ--
-----SPSKADHKFGYDIQIGKPYTVKTP-------------------------------
--------------LNESYKRLSPK-------------KKVEIIEPFIYAQKKKTG----
------------------------KK-----LSITVNGIDYEKIELLGRGGSSKVYKVKN
-DQNKIFALKRVSFDEFDDSSIAGFKGEIELLEKLCKEPRVVRLFDYQMSSGVLYLIMEC
GDNDLSQVLNQRM--GFPLDMDFLRYHVRELLKCVKAVHDAGIVHSDLKPANFVFIKGLL
KLIDFGIANVIPDHTVNVYRESQIGTPNYMAPETLIATNHSIEQSDLNK--EMSKWKVGK
PSDVWSCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPEVKVIFSERTAKDEKIPTSLIDLM
KACLLRDPAKRWSIDKLLCSPFFNPIIVTPFFIKDLIKNAVKYGTDQKTVTDAKIEELSN
DVLERLNDFKM-
>NCAS0I02080
-----MAKYSYHSRLSIHRREPLQN-----------------LGTNIEPDDSD-DEKVS-
GPPVLSNFASAFLSEG-----------------DKNTSNIREEE-------TNVFNNS--
----NMKLSQTPNNSIEPNQADDLSLHSTLFANT-VGNRQS-SLTTMNSTNNFALNHDTN
KEHTVF-----EDNLQK----------------------IKSLQQTMKEEL---TSRYIE
RR-NKRFL--TSRRNNLGPAKRAST---SAISASTEDRYQE----------NDKHSNNEK
YSTQDDSNILAKQ-----------------------------------------------
------VGRLSSPLNRQNR--AFQSSNGDDTNMKEPVDYSSIEFGELTPFEYLKKHDLPT
SELPYISRIYFEKQKLENRQTVLRKRRFSSKESLSLGTTSSL------------------
---------------APYSNSKNNTTNQVSRDLSL-------------------------
-----PRRKISDTSSKISKQI----------------LKSNINLSES-------------
-------------GSHGFPPDLQSIQRQHESAEKL----------SRAPLIDLNVNNV--
SPKRMDKLRETHKFSDSRLNVQDFSKKT--------------------------------
--------------DVVVYEKQAPR-------------KKVEIVEPKRSHSKLA------
------------------------KR-----NTITVNDTEYEKIELLGRGGSSRVYKVKN
-SQNKVFALKRVSFDEFDDSSVDGFKGEIELLEKLSNESRVVKLFDYQMDSGVLFLIMEC
GDHDLSQILSQRS--DMPLDMDFVRYHAREVVRCIKIVHDAGIVHSDLKPANFVFVKGIL
KIIDFGIANAIPDHTVNIYRENQIGTPNYMAPEALVAMNYTNEND------GGNKWKVGK
PSDIWSCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPDVKVIFSEKTANNESIPRSLIDLM
KGCLTRDPEKRWSVDQVLESPFFNPIVVTPFFIKDLIKNAVRYGVDQREVSNEKIEELAN
DVLGRLTDFKM-