MUSCLE (3.8) multiple sequence alignment

Ecym_5237          MDPYVPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEA
ADR316W            MDPQKPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEA
ZYRO0B04928g       MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGSISTPLKDIMIGEEA
TBLA0F00870        MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKDIMIGDEA
KLLA0C03850g       MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA
TPHA0A00920        MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA
SAKL0C07370g       MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA
KLTH0F06490g       MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA
Kwal_33.14177      ------------------------------------------------------MIGDEA
CAGL0K01595g       MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEA
TDEL0D04610        MDPHNPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEA
Kpol_479.25        MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEA
NCAS0C03550        MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA
NDAI0G02900        MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEA
Skud_4.222         MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEA
YDL029W            MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEA
Suva_4.220         MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA
Smik_4.206         MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA
                                                                         ***:**

Ecym_5237          SNVRSYLQISYPMENGIIKNWADMEQLWDYAFYDQMKIPSTAGHKVLLTEPPMNPLKNRE
ADR316W            SQVRSYLQISYPMENGIIRDWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE
ZYRO0B04928g       SDVRSYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKFPSTSGGKILLTEPPMNPLKNRE
TBLA0F00870        SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLPTTSGGKVLLTEPPMNPVKNRE
KLLA0C03850g       SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE
TPHA0A00920        SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE
SAKL0C07370g       SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE
KLTH0F06490g       SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE
Kwal_33.14177      SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNRE
CAGL0K01595g       SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMQLPTTSGGKILLTEPPMNPVKNRE
TDEL0D04610        SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFDQMKLPTTSNGKILLTEPPMNPVKNRE
Kpol_479.25        SEVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLKNRE
NCAS0C03550        SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE
NDAI0G02900        SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLNNTSGGKILLTEPPMNPLKNRE
Skud_4.222         SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE
YDL029W            SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE
Suva_4.220         SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLQSTSNGKILLTEPPMNPLKNRE
Smik_4.206         SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE
                   * **************:*.:* *** ******::**:: .*:. *::*****:** .***

Ecym_5237          QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
ADR316W            QMCEVMFEKYDFGGVYVGIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
ZYRO0B04928g       LMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
TBLA0F00870        RMCEVMFERYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
KLLA0C03850g       QMCEVMFEKYDFGGTYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
TPHA0A00920        KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR
SAKL0C07370g       QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTKR
KLTH0F06490g       QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
Kwal_33.14177      QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
CAGL0K01595g       QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
TDEL0D04610        QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
Kpol_479.25        QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
NCAS0C03550        KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLGHLTRR
NDAI0G02900        KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
Skud_4.222         KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR
YDL029W            KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR
Suva_4.220         KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
Smik_4.206         KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR
                    *******.*****.**.*****************:******************.***.*

Ecym_5237          LDVAGRDVTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTKLAHETTTLV
ADR316W            LDVAGRDMTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTRLAQETTTLV
ZYRO0B04928g       LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLNLDTKLARETTVLV
TBLA0F00870        LDVAGRDVTRHLIDLLSRRGYSFNRTADFETVRQIKEKVCYVSYDLNLDTKLARETTTLV
KLLA0C03850g       LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
TPHA0A00920        LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV
SAKL0C07370g       LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
KLTH0F06490g       LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV
Kwal_33.14177      LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV
CAGL0K01595g       LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
TDEL0D04610        LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKVCYVSYDLDLDTKLARETTTLV
Kpol_479.25        LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTRLARETTTLV
NCAS0C03550        LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
NDAI0G02900        LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Skud_4.222         LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTVLV
YDL029W            LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV
Suva_4.220         LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Smik_4.206         LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV
                   *******:**:**********:**.:************:.******:***.**.***.**

Ecym_5237          ETYELPDGRVIKVGSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAI
ADR316W            EQYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAI
ZYRO0B04928g       ENYELPDGRVIKVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAI
TBLA0F00870        QEYELPDGRIIKVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAI
KLLA0C03850g       ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI
TPHA0A00920        ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI
SAKL0C07370g       ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV
KLTH0F06490g       ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI
Kwal_33.14177      ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAI
CAGL0K01595g       ENYELPDGRIIKVGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAI
TDEL0D04610        ENYELPDGRVIKVGQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAI
Kpol_479.25        EKYELPDGRIIKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAI
NCAS0C03550        ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI
NDAI0G02900        ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAI
Skud_4.222         ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAI
YDL029W            ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI
Suva_4.220         ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI
Smik_4.206         ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI
                   : ******* **** *****.******.*****. *:**:**.*:*:**:*: ::**.*:

Ecym_5237          VLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPARLDKFKVRIEDPPRRKHMVFTGGAVL
ADR316W            VLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPTRLEKFKVRIEDPPRRKHMVFTGGAVL
ZYRO0B04928g       VLSGGSSMYPGLPSRLEKELKQLWYTRILRGDAARLDKFKVKIEDPPRRKHMVFIGGAVL
TBLA0F00870        VLSGGSSMYPGLPSRLERELKQLWFTRILKGDAERLDKFKVRIEDPPRRKHMVFIGGAVL
KLLA0C03850g       VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL
TPHA0A00920        VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL
SAKL0C07370g       VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
KLTH0F06490g       VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL
Kwal_33.14177      VLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
CAGL0K01595g       VLSGGSSMYPGLPSRLEKELKQLWFTRVLNNDPTRLDKFKVRIEDPPRRRHMVFIGGAVL
TDEL0D04610        VLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDASRLDKFKVRIEDPPRRKHMVFIGGAVL
Kpol_479.25        VLSGGSSMYPGLPSRLEKELKQLWFTRVLNKDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
NCAS0C03550        VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL
NDAI0G02900        VLSGGSSMYPGLPSRLEKELKQLWYTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
Skud_4.222         VLSGGSSMYPGLPSRLEKELKQLWFNRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
YDL029W            VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
Suva_4.220         VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
Smik_4.206         VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
                   ***************:*.******:.*:*. *. **:****.*******.**** *****

Ecym_5237          ANIMADKDHMWLTKKEWEEMGPAAMSKFGPR-
ADR316W            ASIMADKEHMWLTKQEWEESGPASMSKFGPR-
ZYRO0B04928g       ASIMAEKDHMWLTKEEWHESGPAAMAKFGPR-
TBLA0F00870        ANIMADKDHMWLSKQEWQENGAAALAKFGPR-
KLLA0C03850g       ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR-
TPHA0A00920        ASIMADKDHMWLSKQEWAESGPAAMAKFGPR-
SAKL0C07370g       ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR-
KLTH0F06490g       ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR-
Kwal_33.14177      ANIMADKDHMWLSKQEWQEMGSAAMSKFGPR-
CAGL0K01595g       ASIMADKDHMWLTKQEWRESGAAAMSKFGPR-
TDEL0D04610        ANIMADKDHMWLSKQEWQESGPAAMAKFGPR-
Kpol_479.25        ANIMADKDHMWLSKQEWQESGPAAMSKFGPR-
NCAS0C03550        ASIMADKDHMWLSKQEWQESGAASMVKFGPRQ
NDAI0G02900        ASIMADKDHMWLSKQEWYEGGAAAMAKFGPR-
Skud_4.222         ASIMADKDHMWLSKQEWQESGPAAMTKFGPR-
YDL029W            ASIMADKDHMWLSKQEWQESGPSAMTKFGPR-
Suva_4.220         ASIMADKDHMWLSKQEWQESGPAAMSKFGPR-
Smik_4.206         ASIMADKDHMWLSKQEWLESGPASMAKFGPR-
                   *.***:*:****:*:** * *.::: ***** 

FASTA FORMAT for MUSCLE Version 3.6

>Ecym_5237
MDPYVPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEA
SNVRSYLQISYPMENGIIKNWADMEQLWDYAFYDQMKIPSTAGHKVLLTEPPMNPLKNRE
QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
LDVAGRDVTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTKLAHETTTLV
ETYELPDGRVIKVGSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAI
VLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPARLDKFKVRIEDPPRRKHMVFTGGAVL
ANIMADKDHMWLTKKEWEEMGPAAMSKFGPR-
>ADR316W
MDPQKPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEA
SQVRSYLQISYPMENGIIRDWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE
QMCEVMFEKYDFGGVYVGIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
LDVAGRDMTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTRLAQETTTLV
EQYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAI
VLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPTRLEKFKVRIEDPPRRKHMVFTGGAVL
ASIMADKEHMWLTKQEWEESGPASMSKFGPR-
>ZYRO0B04928g
MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGSISTPLKDIMIGEEA
SDVRSYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKFPSTSGGKILLTEPPMNPLKNRE
LMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLNLDTKLARETTVLV
ENYELPDGRVIKVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAI
VLSGGSSMYPGLPSRLEKELKQLWYTRILRGDAARLDKFKVKIEDPPRRKHMVFIGGAVL
ASIMAEKDHMWLTKEEWHESGPAAMAKFGPR-
>TBLA0F00870
MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKDIMIGDEA
SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLPTTSGGKVLLTEPPMNPVKNRE
RMCEVMFERYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
LDVAGRDVTRHLIDLLSRRGYSFNRTADFETVRQIKEKVCYVSYDLNLDTKLARETTTLV
QEYELPDGRIIKVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAI
VLSGGSSMYPGLPSRLERELKQLWFTRILKGDAERLDKFKVRIEDPPRRKHMVFIGGAVL
ANIMADKDHMWLSKQEWQENGAAALAKFGPR-
>KLLA0C03850g
MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA
SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE
QMCEVMFEKYDFGGTYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI
VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL
ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR-
>TPHA0A00920
MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA
SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE
KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR
LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV
ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI
VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL
ASIMADKDHMWLSKQEWAESGPAAMAKFGPR-
>SAKL0C07370g
MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA
SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE
QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTKR
LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV
VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR-
>KLTH0F06490g
MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA
SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE
QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV
ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI
VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL
ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR-
>Kwal_33.14177
------------------------------------------------------MIGDEA
SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMNPVKNRE
QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV
ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAI
VLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
ANIMADKDHMWLSKQEWQEMGSAAMSKFGPR-
>CAGL0K01595g
MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEA
SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMQLPTTSGGKILLTEPPMNPVKNRE
QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
ENYELPDGRIIKVGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAI
VLSGGSSMYPGLPSRLEKELKQLWFTRVLNNDPTRLDKFKVRIEDPPRRRHMVFIGGAVL
ASIMADKDHMWLTKQEWRESGAAAMSKFGPR-
>TDEL0D04610
MDPHNPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEA
SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFDQMKLPTTSNGKILLTEPPMNPVKNRE
QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKVCYVSYDLDLDTKLARETTTLV
ENYELPDGRVIKVGQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAI
VLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDASRLDKFKVRIEDPPRRKHMVFIGGAVL
ANIMADKDHMWLSKQEWQESGPAAMAKFGPR-
>Kpol_479.25
MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEA
SEVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLKNRE
QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTRLARETTTLV
EKYELPDGRIIKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAI
VLSGGSSMYPGLPSRLEKELKQLWFTRVLNKDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
ANIMADKDHMWLSKQEWQESGPAAMSKFGPR-
>NCAS0C03550
MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA
SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE
KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLGHLTRR
LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI
VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL
ASIMADKDHMWLSKQEWQESGAASMVKFGPRQ
>NDAI0G02900
MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEA
SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLNNTSGGKILLTEPPMNPLKNRE
KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAI
VLSGGSSMYPGLPSRLEKELKQLWYTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
ASIMADKDHMWLSKQEWYEGGAAAMAKFGPR-
>Skud_4.222
MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEA
SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE
KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR
LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTVLV
ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAI
VLSGGSSMYPGLPSRLEKELKQLWFNRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
ASIMADKDHMWLSKQEWQESGPAAMTKFGPR-
>YDL029W
MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEA
SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE
KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR
LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV
ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI
VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
ASIMADKDHMWLSKQEWQESGPSAMTKFGPR-
>Suva_4.220
MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA
SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLQSTSNGKILLTEPPMNPLKNRE
KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR
LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI
VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
ASIMADKDHMWLSKQEWQESGPAAMSKFGPR-
>Smik_4.206
MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA
SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE
KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR
LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV
ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI
VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
ASIMADKDHMWLSKQEWLESGPASMAKFGPR-