MUSCLE (3.8) multiple sequence alignment

TBLA0B01600        ------------------------------------------------------------
KLLA0F24662g       ------------------------------------------------------------
KNAG0K01120        ------------------------------------------------------------
CAGL0K01573g       ------------------------------------------------------------
TPHA0A00910        ------------------------------------------------------------
Kpol_479.26        ------------------------------------------------------------
KAFR0C01050        ------------------------------------------------------------
ZYRO0B04950g       ------------------------------------------------------------
TDEL0D04620        ------------------------------------------------------------
Suva_4.219         ------------------------------------------------------------
Skud_4.221         ------------------------------------------------------------
YDL030W            ------------------------------------------------------------
Smik_4.205         ------------------------------------------------------------
NDAI0G02890        ------------------------------------------------------------
NCAS0C03540        ------------------------------------------------------------
KLTH0C08888g       ------------------------------------------------------------
Kwal_56.22799      -------------------------------------------------MIKFNRIAKKM
SAKL0C08800g       MEAPAFVHLCICAFVHLCAHIFILNVACCAVQKILRDRLALWMMKMKDDDVHIYPVHVCG
AEL085W            ------------------------------------------------------------
Ecym_3549          ------------------------------------------------------------
                                                                               

TBLA0B01600        -------------MSNSVDGRDPVALLLAMHEQVV--QMSRTRHEISCEIKDVPGVIRGD
KLLA0F24662g       ---------MNAPTYLCFEERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHN-LGVE
KNAG0K01120        -------------MG--LDERVSLIRQLEILEDAIAARFQRNPALYYNSVPMLKKLTMQA
CAGL0K01573g       -------------ME--LDTVRSLLEDIEVIEDAISSRFQRNPELYYDYRIHLEG-IRDD
TPHA0A00910        -------------MSN-IEERRSLLEDLEVIESSITKRFQRNPELYYKYQEGLKKVVDPD
Kpol_479.26        -------------MSY-IENVRSLLEDIEVIEDAISKRFQRNPEVYYYYSQQLND-INGG
KAFR0C01050        -------------MAN-LEEKRDLCEDLEVIEDAIAKRLQRNPELYYNYLEKLSSFEKHS
ZYRO0B04950g       -------------MTT-LETRRQLLEGLEIIEDAISQRFGRNPELYYSNITKQVL-IDGG
TDEL0D04620        -------------MNT-LESRRSHLEDLEVIEQSIASRFERNPGLYYGYLQKRAL-ID-D
Suva_4.219         -------------MDF-LETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGK-LFPD
Skud_4.221         -------------MNV-LETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCK-VFPD
YDL030W            -------------MNL-LETRRSLLEEMEIIENAIAERIQRNPELYYHYIQESSK-VFPD
Smik_4.205         -------------MSF-LETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSK-VFPD
NDAI0G02890        ------------MSHLDLEKRRSLLEDLEIIENAISTRFQRNPELYYSNLKKVSE-LFPS
NCAS0C03540        ------------MVPL-LEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLS
KLTH0C08888g       -------------MKT-YEDARATLEELELIENAVTSRLRRNPEIFYRNIDEVDL-VEHS
Kwal_56.22799      NSKWSSKEKEKDLMVT-YESSRSTLEELELIEGAIAARLRRNPEIFYRNVDELKL-ITGD
SAKL0C08800g       QSTSNRAGAHHTDMEI-LEAKRSVLERLEVIENAISERIRRNPELYYSYYEEQRL-VDKE
AEL085W            -------------MSS-LEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQL-VNPD
Ecym_3549          -------------MSL-LEEKRAILEELELIEDAISDRIARNPEVFYSYIHELSI-VNSD
                                     :        : : *  :  .: *.                  

TBLA0B01600        ------------RGDRMSNNKLVAIERFRIGKQ---IEQHE-------------------
KLLA0F24662g       AWAVP--------KLDVSANRIYRSKKSKRSRKQIKAQEYEIALFLGRYRRLLKSLQKHK
KNAG0K01120        ---EPKVCPP---QDHVTKNKVYRVEKSARKVKQVATQQHEIKLFLQDRTDILNKLSRAQ
CAGL0K01573g       -------IPKLGLDDDRMVNKIYKARKHKRTLKQKRTQQYEINTFLDDIFKKNKYILKVR
TPHA0A00910        ---ID--LPS---KTVRNTNKIYKTRKHKRKRKQILLQQYEINEFLDDYRRKEKQL--MK
Kpol_479.26        ---GE--ETKT-VVSNRSSNRIYKSRKHKRDRKQVILQQYETNEFIKDIRSKLNEIREIN
KAFR0C01050        ---LE--VPS---SIDIKNNRVYKSKKAKRSKKQIVAQQHEIRLFIEDYTNKQKGLNMLM
ZYRO0B04950g       ---IE--LPS---TTAMAVNRIYKSKRTKRSRKQLVTQQHEINLFLSQALDKQKELSGVN
TDEL0D04620        ---IP--LSSS-ITNAYNANRIYKAKRSKRNRKQFVLQQHEIDLFLQESMRKLRDLGSLK
Suva_4.219         ---IK--QPR---PSLVSENKIYKLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEIN
Skud_4.221         ---VK--LPK---PSLIAENKIYKLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESN
YDL030W            ---TK--LPR---SSLIAENKIYKFKKVKRKRKQIILQQHEINIFLRDYQEKQQTFNKIN
Smik_4.205         ---VK--LPK---SSLIAENKLFKIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNIN
NDAI0G02890        KQVEE--LPT---HSIMTNNKIYKTKKLKRNRKQIALQQHEISLFIKDFFSKQKELETLT
NCAS0C03540        ---ID--TPA---ESNKSNNKIYKRKKLKRSRKQFVLQQQEINIFLKDFEERRRVL----
KLTH0C08888g       ---GR--FDHI-PSSQKSANKVYTVKKSRRSRKQILAQEHEIKSFLSQYLKDCQSLGRVE
Kwal_56.22799      ---AK--VDDY-AEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFLEEYRKKSESLRNVE
SAKL0C08800g       ---NHGLLPPV-PASDISANRIHSVKKSRRSRKQIVLQQHEIDRFLEEYQREVARLHGIK
AEL085W            ---EK-VLDNI-SKDDINSNRIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFK
Ecym_3549          ---EK-VLSNI-PNVDITANRVYMIKKSKRSRKQILLQQHEISKFLSYYLKNVKKLNGYK
                                      *.:    .     :    :: *                   

TBLA0B01600        -------------------KYRRCYEQLQRVPRNSVE---------------EVSVASLF
KLLA0F24662g       LSEEHLEYFRD--TNASFEQFETVTTEVLEGQVNSRS------------LVEVKSDYEMF
KNAG0K01120        ESGPGESQYKN------LDEFKTAINGLTESNIPKRS-----------GLQSEKDQYAMF
CAGL0K01573g       NQLKSDGLKYK-DSECKFELLKKLLGDEPTEDEDEDDSISKSNSSRLLDIDETINRYNMN
TPHA0A00910        QKLDISEFRDK---GADFVKFEELLESINNEYNNQNE-----ETPTNLKLLDKKDKYAMF
Kpol_479.26        VTKESNGIK--------LDRYVELMGSIDTKYEDSVS-----DN-QQLPINKTIFQYSMF
KAFR0C01050        KRKDTTQISSD------IGDFITSITENKSHVKS--------------SLKDKIDYYSMF
ZYRO0B04950g       GTVDVEDYRDE---EINFDKFREAVDQINSKYEDQEG--------LALDINENIVNHEMF
TDEL0D04620        GPVNTHSLRDE---EATFEIFKQNLEEIKDKYKDLGS-----DS-LFSDVNEEISKHAMF
Suva_4.219         IPQDVQEDEKD------LRSFEQKLQELEEELKNEQE-------NYQLDINLKRGRYALF
Skud_4.221         NLEGVEEDDKE------VDRFEQNLQELEERLKNEDD-------NFQLDINLTRSKYALF
YDL030W            RPEETQEDDKD------LPNFERKLQQLEKELKNEDE-------NFELDINSKKDKYALF
Smik_4.205         SQNYSQEDDKD------LCSFDEELRQLEDELKSEEE-------NFQLDINSKRNKYALF
NDAI0G02890        REANFKAKKNKEEILLPVEEFKDILSEINEADGNENG-----NR-RELEINDKINKYSMF
NCAS0C03540        LDLGKETVKDD---NITLETFKTMIQDINAKKSSSEV----------LPINQKITRYAMF
KLTH0C08888g       FDMSEYRVDNG-----SVNKLLEHIERIKEIHPKDDE---------------FGDQYAMF
Kwal_56.22799      FDLRRYQVTDG-----SVDGFLEHIETINSEVPD--------------DIDDSMENYTMF
SAKL0C08800g       LDKDDSESAAP-----DFEQLEKAVKDAKSRYADESR--------TLAGVDVESVEHSMF
AEL085W            SD-DIESLRDP---NMNFETFEADIKELQERQAEGAD-----SESAISSLERKRREYSMF
Ecym_3549          ND-NVDEFKDH---NQNFELFRDQIQRIKEKYAEESN-----SEAFDASLEARKYQYTMF
                                                                             : 

TBLA0B01600        ATRIK-----EIAPLPIPSIDINSVYRDPEEEYGTSISLDRFYNLWIGHLTKRKTSESPP
KLLA0F24662g       SGPQAASK--NIISPIGQIIDLSRNF-ARDENFGTYLDLSEQFKKWLNIIKRADL-----
KNAG0K01120        SSSIEKP-PTNILSARALELDINAIF-NREEQYGTYIQLENYHPMWLELMKEPSV-----
CAGL0K01573g       LGNG------KLVSERCSLLDINTIF-QKDEQDGFIIDFEPLYRRWLNIVKDGTL-----
TPHA0A00910        SSSININSPNNILSKRSQLLDLNNYF-SKEEQYGEILNLEQFYSSWLNVVKTADC-----
Kpol_479.26        TSSNSKNKPNNILSDKCKYLEINDYF-TRDEQYGEYLELERFYNNWLNVIKSANC-----
KAFR0C01050        SASTTQK---SILSKRAADLDINQTF-TRDEQFGECMDLERFHNVWLSVVKDDSY-----
ZYRO0B04950g       SATFSKS---TILSESARDLDLNQIF-TRDEQYGDLLDLEKFHSQWLNVIKRADC-----
TDEL0D04620        SALTTDSKPVTILSRSAKNLRLNDVF-SREEQYGEYLDLDRFHSSWLNVIRSTEC-----
Suva_4.219         SSSAEPSKRTNILSERARDIDLNRLF-TRDEQYGEYMELEQFHSLWLNVIKRGDC-----
Skud_4.221         SSSADPSKRTNILSERARDLDLNKIF-TRDEQYGEYMELDQFHYLWLNVIRRSDC-----
YDL030W            SSSSDPSRRTNILSDRARDLDLNEIF-TRDEQYGEYMELEQFHSLWLNVIKRGDC-----
Smik_4.205         SSSIDSSKRTNILSERARDLDLNKIF-TRDEQYGEYMELEQFHSLWLNVFKRSDC-----
NDAI0G02890        SNSLNKSHPSTILSSRASDLDINSIF-SLEEQYGEYLALNPYYTEWLNVVKKEDL-----
NCAS0C03540        SASISESKPNNILSQRCAGLDINKYF-SREEQYGQYMDFENFYLEWLNVVKTGDV-----
KLTH0C08888g       SSSTPSNK--NIISRKAQNLDINSYF-TRDEQYGEYLDLEPFHQKWLSVVKNGDV-----
Kwal_56.22799      SNSTAARR--DILSKKARALDINAKF-TREEQYGEFLDLEPFHQQWLSVVKDGSV-----
SAKL0C08800g       SSSTSTHK--DILSTRGRDLDMNRLF-ARDEHYGEFLLLEPFHHEWLNIVKDGSV-----
AEL085W            SASSGADQ--TILSNVGQFIDVNKLF-MWEEHYGEYLFLERLHQDWLNVVKDGSV-----
Ecym_3549          SNSNHQKK--DILSLEGQSIDINKKF-SWEEHYGEYLHLDQYHQEYLNIVKNANV-----
                              : .     : :.  :   :*  *  : :.  .  ::  .          

TBLA0B01600        TLVEFYGQVTKQF----LHDRWIDETAFPP------SLIAGMLEYLTGFQERVDIVKPQD
KLLA0F24662g       TILSFLKMLESF-----ETYDYLLNPSLDRDTKEYNQLVTELLKYYKAYYSKAYPLVDKE
KNAG0K01120        TVLQYLESLERMFLNADDKTSYLTSPPIDRDNKQYLRFLERLGLYLKTYIAKKFPLIDQH
CAGL0K01573g       TYPKFISNLEKFI----DDKKYLLDPVMDRKTKGYCEFVVEACDFVETQYFKRNILLNEE
TPHA0A00910        SILKYILMLNVFL----DKDEFILNSPMDRKNLRYVDFIRILSKYFESYLEKRYILNNWI
Kpol_479.26        SILQYMSIIEKFL----DSAQYILQPPMDRKNERYLKFLEIIETYLTSFIKKTYVLIDWE
KAFR0C01050        SLLDFFRVIESFL----DTKSYLKSPHMDRKNQRYQEFIKTISGYVESFFFKKFCLIDKE
ZYRO0B04950g       SYLQFFDVLQKFL----DPSEYLLSPPMDRKNERYGQFLIELFQYVEQFFAKVYVLVNST
TDEL0D04620        TLLQFYSILEKFL----DDRQYILAPPMDRKNGRYAEFLVEISNYLEKFFQKANVLLNHT
Suva_4.219         SLLQFFDTVELFV----DDKKYLLAPPMDRKNDRYMSFLMKLSEYVESFFYKSYALFEKE
Skud_4.221         SLLQFFNILELFV----DDKKFLLTPPMDRKNDRYMDFLMRLSKYLETFFFKSYVLFDKE
YDL030W            SLLQFLDILELFL----DDEKYLLTPPMDRKNDRYMAFLLKLSKYVETFFFKSYALLDAA
Smik_4.205         SLLQFFDVVELFV----DDKKYLLTPPMDRKNDRYMAFLIKLCKYLETFFFKSYALFDKE
NDAI0G02890        TFLQFLNMLKIFQ----DDKRYIVQPPMDRKNEPYMKYLQRYCSYLESFFERKYPLIDSR
NCAS0C03540        TLLQFLNLLRVFM----DEEKYLTHPPMDRKNNRYMKFLESLCSYVESFFFRKYALINKS
KLTH0C08888g       TLLQFLSEVEKFT----DQR-YLLQPAVNRNSSRYREFVASLHHYLSDYAARAYPLLSWD
Kwal_56.22799      SLLQFLGEIEKFT----TKR-FLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQDWD
SAKL0C08800g       TALQFMNVVEMFV----SDA-YLVAPAVNRGSKKYQDFVGSLLGYMSEFFRKTYPLVNHS
AEL085W            TLLQFIAFLESFA----GTG-YLTAPPVDRNSKRYQVFIQKLVTYLEGAFRNTYPLLNHR
Ecym_3549          SLLQFIGFLQTFC----DHG-HLKNPPVDRNSKIYHGFLERLLKYVNSFFESAFPLINHV
                   :  .:   :             :  . .          :     :          :    

TBLA0B01600        SSAAITRRLRRHIALSSSSCSSSSSSASSPSPWPLTCIVCGPKKFATEQVFHHHLNSNRH
KLLA0F24662g       ---ILSKTIHNG--F-DKYVRTGITESPSKESGKMYSVVFN-RWFDSQSEFNTHVQTEQF
KNAG0K01120        ---LVEDYLLDH--FKNRYVNKPVSTDQN----TQFCPVCD-KRYEGMQLFNDHLLNKFH
CAGL0K01573g       ---QIKGKLHRD--F-ENHVTKAIITESG----IYYCLYCD-KMFNSAHIYDSHRTGKAH
TPHA0A00910        ---NFKTELKKS--F-EKYSIKPIVKEKK----GYLCISCG-KWFKNSNVYDGHLKGKQH
Kpol_479.26        ---EEAEVLKYD--Y-EIECTKSLMKQGK----GNFCRLCG-KWFKTESVFENHLPGKNH
KAFR0C01050        ---YVNARLQQD--F-ILYLDNPLNNQN-----GFFCVACN-KSFKTKSVFDNHLPGKQH
ZYRO0B04950g       ---ILSQRMESD--F-EEYLRMPIYKSNH----GLYCVACG-KWFKTPTVFQSHLTGKHH
TDEL0D04620        ---KLERRIQSE--F-SRSLATPLHTGGK----GFYCIACC-KWFKVPTVFDSHLTGKHH
Suva_4.219         ---VVEGLIKSD--FDNSYCRGILKSESK----GIYCPLCY-KWFKTQAVFENHIPGKNH
Skud_4.221         ---MVENSIESD--FENSYCKGLVRSEAK----GIYCPFCS-KWFKTFPVFENHLSGKNH
YDL030W            ---AVENLIKSD--FEHSYCRGSLRSEAK----GIYCPFCS-RWFKTSSVFESHLVGKIH
Smik_4.205         ---VIESSIRFD--FEQSYCKGSLRSEAK----GIHCPFCY-KWFKTSPVFENHLTGKIH
NDAI0G02890        ---YTSRELKKE--F-NKSIIKPLENEKK----GFFCKTCC-KWFKTLTVFESHLNGQKH
NCAS0C03540        ---AITSQIESQ--F-TEYIKEPTEHSVK----GQYCKACA-KWFKTESVFVNHIPGKNH
KLTH0C08888g       ---LIHAKAQEL--Y-HTNVAKPIPSGES----GVFCIPCD-KRFKTDTVYNAHLPGKRH
Kwal_56.22799      ---KIHAEIQAT--Y-CDYKSHPEEAGDS----GLFCIPCD-KTFKAETVYLAHLTGKKH
SAKL0C08800g       ---TLGRRLAAL--F-DEYLRAPVADETK----GLFCIPCG-RWFKLETVYKSHLSGKKH
AEL085W            ---LLENRISQS--F-ESYIANPVEDPPR----GLLCIACG-KHFKVGTVFAGHLLGKKH
Ecym_3549          ---QFQKRIKNS--F-VEYTSTPIEDSSR----GCLCVACG-KWFKAITVYTSHLQGRKH
                                                       .     . :     :  *     .

TBLA0B01600        LKREASRLPIMIPIQSVREKLQTLAAELASGAARVERQLNMTPQERFAEHAAQQRIRTAV
KLLA0F24662g       NIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAFTDEEFTEELEKLQEQYESP
KNAG0K01120        AQQRGKRLPLLQAEFRVSVYLTALSKEFKDSKNFMERKLAFTYAERQEELQRLTTEYEAP
CAGL0K01573g       SKSVSNYHDSFRAEFKLHVYVSCMREEFENTKEYVDRKMAFTNKERLEEMEKLTQEYHRP
TPHA0A00910        EKHYSNRKMFLYNEYKLHRIINYLKYEFDESKAYMERKLAFTNTERNNELKLLTKKYEEP
Kpol_479.26        VKNYKKYYDEYFIEFKIHRILNWLSKEFEETKLFLERKLAFTSDERIKEIDRMTEVYERP
KAFR0C01050        KRNVDKRRNSLISEYKLYRFLNLLRTEFNNTKEFTERKISFTANERREELERLNNEYNAP
ZYRO0B04950g       RNNRDKRFTKLQAEYKLHRYLKILQGQLERTRGFVERKMAFTTEERMEEMSRLARIYEGP
TDEL0D04620        KNNLSKRSKHLQAEYKLHRYLTLLSEEFRRTREFTERKVAFTAEERMQEMARLNHDYHAP
Suva_4.219         KKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSLTQKYEAP
Skud_4.221         KKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSLTEKYEAP
YDL030W            KKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQKYEAP
Smik_4.205         KKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDALTQKYEAP
NDAI0G02890        IKSYNKRVQGLYAEYKTHRYSMLLKEEHQSTCEFVERKMAFTVEERITEMKRLAEICKAP
NCAS0C03540        IKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRLTENYEKP
KLTH0C08888g       VGNLHKNSSFLTQEHSLHIFCRYLSRELARTREFVERKLAFTTEERTQELERLTDIYDSP
Kwal_56.22799      INNMNKKDEFLAQEYKLHMLCCYLVQELVRTREFVERKLAFTPEERRQEMERLTTVYESP
SAKL0C08800g       SKNLAKGDGHLLAEYKLHKYCGLLVQTIANTRAFVERNRALTADERAQELERLAKEYEAP
AEL085W            AQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNREMATIRDAYDAP
Ecym_3549          LNNLKCRRRSLMVEYTLQNLFTCLNKELVSTKSFVERKYAFTVEERIQELAKLRDAYNAN
                                          :           : :  :*  *   *           

TBLA0B01600        QGRGGGDTTATPSATPSATPAATTPAS-----------ASTVEVDGRHVPRWLYRLQGLS
KLLA0F24662g       IYAKDESE-DKPSYIDNAEDTAQKESM----DPTNPY-NLPLGPDGFPIPRWLIKVQGLD
KNAG0K01120        NYNPALEHEDNPAETDKNKNGKTHSENKQTAELESMFTNMPLGPDGMPIPLWLYKLQGLD
CAGL0K01573g       VYDPTEKEGDVEEDNSKSKTKDELKE-----MLGLGE-DMPLGPDGLPIPYWLYKLQGLD
TPHA0A00910        AYNKDEPENTDKYEEDDNSMSNAAEDR------NKSF-NMPLGPDGMPIPLWLYKLQGLD
Kpol_479.26        AYSVGEPEEGKPN--ENSSKTSSNKND----IINGSF-DMPLGPDGLPMPYWLYKLQGLD
KAFR0C01050        VYGSEEQEEGDEEHDEYASKNGNRS------ILDGLF-NMPLGPDGVPMPFWLYKLQGLD
ZYRO0B04950g       DYAPDEKEIEEKE-----DSVDTPSEK----KMNGGI-ELPLGLDGLPIPLWLYKLQGLD
TDEL0D04620        DYGPDEKEQEDPD--SNKAELDKNS------ALGGSF-DLPLGADGLPIPYWLYKLQGLD
Suva_4.219         AYDATEREDDGKG--GGEQKDDKLQEKH---LFGKSF-DMPLGPDGLPMPYWLYKLHGLD
Skud_4.221         AYDHTEGEGDGQC--DAGRKGDLLQEKQ---PFGKSF-DMPLGPDGLPMPYWLYKLHGLD
YDL030W            AYDSTEKEGAEQV--DGEQRDGQLQEEH---LSGKSF-DMPLGPDGLPMPYWLYKLHGLD
Smik_4.205         AYDPTDKDGDQQK--GSDQRDDQLQEKH---FFGKSF-DMPLGPDGLPMPHWLYKLHGLD
NDAI0G02890        AYDVNEKEGDENN--TELNVKDNLKNDGASAMLSGSI-NMPLGPDGLPMPFWLYKLQGLD
NCAS0C03540        AYSSDEKEGDENN--ADLEHDEQRSGKGQG-LLEGSF-DMPLGPDGLPMPFWLYKLQGLD
KLTH0C08888g       VYGRQEQE-DAQE--DENKETEDKEDS----VLDSSM-NLPLGPDGFPIPYWLYKLQGLD
Kwal_56.22799      VYGEQEQE-DIAE--ADQKPTTNQEDS----TPEPSF-DLPLGPDGFPIPYWLYKLQGLD
SAKL0C08800g       AYSQHETEDAARE--KQQKREPETDEG------GNPF-NLPLGPDGYPIPYWLYKLQGLD
AEL085W            AYSSGEPEDVIET--PQQQQNAHPDDV-------NPL-NLPLGPMGYPIPYWLYKLQGLD
Ecym_3549          AYGDHERE-DSQEDLSVSSSKETPPDD------NNPL-NLPLGPDGYPIPYWLYKLQGLD
                                                           .:   *  :* ** .::**.

TBLA0B01600        SIFTCELCDGREFHGRTRYERHFTSTQHRTRLVCLGVPAEQHVQFRGLGKLDAVLELRGE
KLLA0F24662g       VKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGI--TPSLAFKDVTTIVEVTELWKA
KNAG0K01120        VKYTCEICGNAEFKGRRAYQKHFHEPLHEYRLKCLGI--TRSKAFDGIALIEEAQELWAK
CAGL0K01573g       VGQECEICGNQVYKGHKNFDKHFSGPTHTYHLKCLGI--EPSSAFQGITKIKEAQALWKQ
TPHA0A00910        IKYNCEICGNKEYQGRKAYENHFSELTHTSHLYFLGI--QYSKAFKGITSIAEAKSLWSS
Kpol_479.26        MTYKCEICANTIYKGRRTFEKHFSETTHNYHLRCLGI--EPSSAFKGIVSIKEATDLWGT
KAFR0C01050        VSYYCEICSNREFKGRRAFERHFNEKTHQYHLRCLGI--TPSPTFVGITAITEAQTLWDH
ZYRO0B04950g       VTYSCEICGNQTYRGRRMFERHFTEPTHLFHLKCLGI--EASDAFRSITSIEEAQNLWKR
TDEL0D04620        VEYSCEICTNQTYKGRRAFEKHFLEPTHTFHLKCLGI--EPSITFKGITGIQEAQDLWRQ
Suva_4.219         REYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGI--EPSSVFKGITKIAEAQRLWKN
Skud_4.221         REYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGI--EPSPAFKGITKIAEVQKLWKD
YDL030W            REYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGI--EPSSVFKGITKIKEAQELWKN
Smik_4.205         REYHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGI--EPSLAFKGITKITEAQKLWEN
NDAI0G02890        VSYPCEICSNQIFKGRRTFDKHFTEATHIYHLRCLGI--EPTPAFKGVTKIEEAQRLWNN
NCAS0C03540        VEYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGI--EPSSMFKGITKIKEAQKLWVD
KLTH0C08888g       IEYPCELCGNFVYNGRRQFDKHFGEQRHVFGLRRLGI--EPSASFKGVTKIDDAKQLWSH
Kwal_56.22799      IEYPCEVCGNLIYKGRRQFDKHFTEQRHIFGLKRLGV--DPSPSFKGVTSIDDVKQLWAH
SAKL0C08800g       IEYSCEICSNHTYKGRRYFEKHFSEARHIFGLRCLGI--EPSATFKGITKIQEAKDLWAR
AEL085W            IEYACEICANHVYKGRRISNAIFRTAP-CYGLRCLGI--EPSPAFKDIYNIAEAQQLFQS
Ecym_3549          IEYTCEICGNHLYKGRRVFERHFHEQRHTYGLRCLGI--EPTSTFKGISKISDAQILWSR
                       **:* .  :.*.   :  *        *  **:       * .:  :  .  *   

TBLA0B01600        KLGRLEEQEPSRSTVGRAKAVGKAGGKAVGKDTALGNDTGLSQEWAALLERQGLA
KLLA0F24662g       LQAKSTLKS-----GEPFSKISTVKEPEMVLETEDNEGNVMSVQVYEELKKQGLL
KNAG0K01120        ISGKSTSAR-----------AGSDDSLKLEIEVEDEDGNVMSQTVYQDLKRQGLL
CAGL0K01573g       MQRNTT--------------------QELAEEVEDKEGNVMSKDIYEELKKQGLV
TPHA0A00910        MHASNGSAA------SFSNQNNTKLAMTEDIEVEDSEGNVMSKKIYDELKKQNLV
Kpol_479.26        MNVKDKSSK-------------HAESNNYEIEVEDKEGNVLSKEIYEELKKQGLL
KAFR0C01050        IQSTQKKKA-------------PSGKIDMDIEVEDADGNVLTRKVYDDLKRQGLL
ZYRO0B04950g       ISGNNTTSS-------------------RDIEVEDEEGNVMTQQVYEELKKQGLV
TDEL0D04620        TSSRNRPQT----------------QKKIDLEVEDQEGNVLTQKVYQELKKQGLV
Suva_4.219         TQSQPQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV
Skud_4.221         IQNQHRSGSSTAVALTKKSPSQPKLPTGLELEEEDEEGNVMSKKVYDELKKQGLV
YDL030W            MQGQSQLTS-IAAVPPKPNPSQLKVPTELELEEEDEEGNVMSKKVYDELKKQGLV
Smik_4.205         MQKQPQSATSIASSLTKLKHSRSKLPTELELEEEDEEGNVMSKKVFDELKKQGLV
NDAI0G02890        MKNDTIMGD---------KKFIETIPDKMAIEVEDKEGNIMTQKVYDELKKQGLA
NCAS0C03540        INSQKNSSK------------PMVSSIELQVEVEDSVGNVMSKKLYDELKKQGLH
KLTH0C08888g       LRSTSSGRV--------------SSEGKLEVEVEDEDGNVMSKKVYDELKKQGLL
Kwal_56.22799      LRSSSKASN--------------AAGPKFEEEIEDEEGNVMSKKVYEELKKQGLI
SAKL0C08800g       IQTSVATGVGAGAIASAATAAATPSTAKLEIEVEDEEGNVMSEKLYHELKRQGLL
AEL085W            LQSSTGPAG--LATRRAGAISSSANTRKLEVEVEDEDGNVMTHQVYEDLKKQGLL
Ecym_3549          LKNNSHLNSASATYPDATSSRAVVTNNKLEIEMEDEDGNVMSHRVYEDLKKQGLL
                                                  :     .. ::      *:.*.* 

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0B01600
------------------------------------------------------------
-------------MSNSVDGRDPVALLLAMHEQVV--QMSRTRHEISCEIKDVPGVIRGD
------------RGDRMSNNKLVAIERFRIGKQ---IEQHE-------------------
-------------------KYRRCYEQLQRVPRNSVE---------------EVSVASLF
ATRIK-----EIAPLPIPSIDINSVYRDPEEEYGTSISLDRFYNLWIGHLTKRKTSESPP
TLVEFYGQVTKQF----LHDRWIDETAFPP------SLIAGMLEYLTGFQERVDIVKPQD
SSAAITRRLRRHIALSSSSCSSSSSSASSPSPWPLTCIVCGPKKFATEQVFHHHLNSNRH
LKREASRLPIMIPIQSVREKLQTLAAELASGAARVERQLNMTPQERFAEHAAQQRIRTAV
QGRGGGDTTATPSATPSATPAATTPAS-----------ASTVEVDGRHVPRWLYRLQGLS
SIFTCELCDGREFHGRTRYERHFTSTQHRTRLVCLGVPAEQHVQFRGLGKLDAVLELRGE
KLGRLEEQEPSRSTVGRAKAVGKAGGKAVGKDTALGNDTGLSQEWAALLERQGLA
>KLLA0F24662g
------------------------------------------------------------
---------MNAPTYLCFEERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHN-LGVE
AWAVP--------KLDVSANRIYRSKKSKRSRKQIKAQEYEIALFLGRYRRLLKSLQKHK
LSEEHLEYFRD--TNASFEQFETVTTEVLEGQVNSRS------------LVEVKSDYEMF
SGPQAASK--NIISPIGQIIDLSRNF-ARDENFGTYLDLSEQFKKWLNIIKRADL-----
TILSFLKMLESF-----ETYDYLLNPSLDRDTKEYNQLVTELLKYYKAYYSKAYPLVDKE
---ILSKTIHNG--F-DKYVRTGITESPSKESGKMYSVVFN-RWFDSQSEFNTHVQTEQF
NIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAFTDEEFTEELEKLQEQYESP
IYAKDESE-DKPSYIDNAEDTAQKESM----DPTNPY-NLPLGPDGFPIPRWLIKVQGLD
VKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGI--TPSLAFKDVTTIVEVTELWKA
LQAKSTLKS-----GEPFSKISTVKEPEMVLETEDNEGNVMSVQVYEELKKQGLL
>KNAG0K01120
------------------------------------------------------------
-------------MG--LDERVSLIRQLEILEDAIAARFQRNPALYYNSVPMLKKLTMQA
---EPKVCPP---QDHVTKNKVYRVEKSARKVKQVATQQHEIKLFLQDRTDILNKLSRAQ
ESGPGESQYKN------LDEFKTAINGLTESNIPKRS-----------GLQSEKDQYAMF
SSSIEKP-PTNILSARALELDINAIF-NREEQYGTYIQLENYHPMWLELMKEPSV-----
TVLQYLESLERMFLNADDKTSYLTSPPIDRDNKQYLRFLERLGLYLKTYIAKKFPLIDQH
---LVEDYLLDH--FKNRYVNKPVSTDQN----TQFCPVCD-KRYEGMQLFNDHLLNKFH
AQQRGKRLPLLQAEFRVSVYLTALSKEFKDSKNFMERKLAFTYAERQEELQRLTTEYEAP
NYNPALEHEDNPAETDKNKNGKTHSENKQTAELESMFTNMPLGPDGMPIPLWLYKLQGLD
VKYTCEICGNAEFKGRRAYQKHFHEPLHEYRLKCLGI--TRSKAFDGIALIEEAQELWAK
ISGKSTSAR-----------AGSDDSLKLEIEVEDEDGNVMSQTVYQDLKRQGLL
>CAGL0K01573g
------------------------------------------------------------
-------------ME--LDTVRSLLEDIEVIEDAISSRFQRNPELYYDYRIHLEG-IRDD
-------IPKLGLDDDRMVNKIYKARKHKRTLKQKRTQQYEINTFLDDIFKKNKYILKVR
NQLKSDGLKYK-DSECKFELLKKLLGDEPTEDEDEDDSISKSNSSRLLDIDETINRYNMN
LGNG------KLVSERCSLLDINTIF-QKDEQDGFIIDFEPLYRRWLNIVKDGTL-----
TYPKFISNLEKFI----DDKKYLLDPVMDRKTKGYCEFVVEACDFVETQYFKRNILLNEE
---QIKGKLHRD--F-ENHVTKAIITESG----IYYCLYCD-KMFNSAHIYDSHRTGKAH
SKSVSNYHDSFRAEFKLHVYVSCMREEFENTKEYVDRKMAFTNKERLEEMEKLTQEYHRP
VYDPTEKEGDVEEDNSKSKTKDELKE-----MLGLGE-DMPLGPDGLPIPYWLYKLQGLD
VGQECEICGNQVYKGHKNFDKHFSGPTHTYHLKCLGI--EPSSAFQGITKIKEAQALWKQ
MQRNTT--------------------QELAEEVEDKEGNVMSKDIYEELKKQGLV
>TPHA0A00910
------------------------------------------------------------
-------------MSN-IEERRSLLEDLEVIESSITKRFQRNPELYYKYQEGLKKVVDPD
---ID--LPS---KTVRNTNKIYKTRKHKRKRKQILLQQYEINEFLDDYRRKEKQL--MK
QKLDISEFRDK---GADFVKFEELLESINNEYNNQNE-----ETPTNLKLLDKKDKYAMF
SSSININSPNNILSKRSQLLDLNNYF-SKEEQYGEILNLEQFYSSWLNVVKTADC-----
SILKYILMLNVFL----DKDEFILNSPMDRKNLRYVDFIRILSKYFESYLEKRYILNNWI
---NFKTELKKS--F-EKYSIKPIVKEKK----GYLCISCG-KWFKNSNVYDGHLKGKQH
EKHYSNRKMFLYNEYKLHRIINYLKYEFDESKAYMERKLAFTNTERNNELKLLTKKYEEP
AYNKDEPENTDKYEEDDNSMSNAAEDR------NKSF-NMPLGPDGMPIPLWLYKLQGLD
IKYNCEICGNKEYQGRKAYENHFSELTHTSHLYFLGI--QYSKAFKGITSIAEAKSLWSS
MHASNGSAA------SFSNQNNTKLAMTEDIEVEDSEGNVMSKKIYDELKKQNLV
>Kpol_479.26
------------------------------------------------------------
-------------MSY-IENVRSLLEDIEVIEDAISKRFQRNPEVYYYYSQQLND-INGG
---GE--ETKT-VVSNRSSNRIYKSRKHKRDRKQVILQQYETNEFIKDIRSKLNEIREIN
VTKESNGIK--------LDRYVELMGSIDTKYEDSVS-----DN-QQLPINKTIFQYSMF
TSSNSKNKPNNILSDKCKYLEINDYF-TRDEQYGEYLELERFYNNWLNVIKSANC-----
SILQYMSIIEKFL----DSAQYILQPPMDRKNERYLKFLEIIETYLTSFIKKTYVLIDWE
---EEAEVLKYD--Y-EIECTKSLMKQGK----GNFCRLCG-KWFKTESVFENHLPGKNH
VKNYKKYYDEYFIEFKIHRILNWLSKEFEETKLFLERKLAFTSDERIKEIDRMTEVYERP
AYSVGEPEEGKPN--ENSSKTSSNKND----IINGSF-DMPLGPDGLPMPYWLYKLQGLD
MTYKCEICANTIYKGRRTFEKHFSETTHNYHLRCLGI--EPSSAFKGIVSIKEATDLWGT
MNVKDKSSK-------------HAESNNYEIEVEDKEGNVLSKEIYEELKKQGLL
>KAFR0C01050
------------------------------------------------------------
-------------MAN-LEEKRDLCEDLEVIEDAIAKRLQRNPELYYNYLEKLSSFEKHS
---LE--VPS---SIDIKNNRVYKSKKAKRSKKQIVAQQHEIRLFIEDYTNKQKGLNMLM
KRKDTTQISSD------IGDFITSITENKSHVKS--------------SLKDKIDYYSMF
SASTTQK---SILSKRAADLDINQTF-TRDEQFGECMDLERFHNVWLSVVKDDSY-----
SLLDFFRVIESFL----DTKSYLKSPHMDRKNQRYQEFIKTISGYVESFFFKKFCLIDKE
---YVNARLQQD--F-ILYLDNPLNNQN-----GFFCVACN-KSFKTKSVFDNHLPGKQH
KRNVDKRRNSLISEYKLYRFLNLLRTEFNNTKEFTERKISFTANERREELERLNNEYNAP
VYGSEEQEEGDEEHDEYASKNGNRS------ILDGLF-NMPLGPDGVPMPFWLYKLQGLD
VSYYCEICSNREFKGRRAFERHFNEKTHQYHLRCLGI--TPSPTFVGITAITEAQTLWDH
IQSTQKKKA-------------PSGKIDMDIEVEDADGNVLTRKVYDDLKRQGLL
>ZYRO0B04950g
------------------------------------------------------------
-------------MTT-LETRRQLLEGLEIIEDAISQRFGRNPELYYSNITKQVL-IDGG
---IE--LPS---TTAMAVNRIYKSKRTKRSRKQLVTQQHEINLFLSQALDKQKELSGVN
GTVDVEDYRDE---EINFDKFREAVDQINSKYEDQEG--------LALDINENIVNHEMF
SATFSKS---TILSESARDLDLNQIF-TRDEQYGDLLDLEKFHSQWLNVIKRADC-----
SYLQFFDVLQKFL----DPSEYLLSPPMDRKNERYGQFLIELFQYVEQFFAKVYVLVNST
---ILSQRMESD--F-EEYLRMPIYKSNH----GLYCVACG-KWFKTPTVFQSHLTGKHH
RNNRDKRFTKLQAEYKLHRYLKILQGQLERTRGFVERKMAFTTEERMEEMSRLARIYEGP
DYAPDEKEIEEKE-----DSVDTPSEK----KMNGGI-ELPLGLDGLPIPLWLYKLQGLD
VTYSCEICGNQTYRGRRMFERHFTEPTHLFHLKCLGI--EASDAFRSITSIEEAQNLWKR
ISGNNTTSS-------------------RDIEVEDEEGNVMTQQVYEELKKQGLV
>TDEL0D04620
------------------------------------------------------------
-------------MNT-LESRRSHLEDLEVIEQSIASRFERNPGLYYGYLQKRAL-ID-D
---IP--LSSS-ITNAYNANRIYKAKRSKRNRKQFVLQQHEIDLFLQESMRKLRDLGSLK
GPVNTHSLRDE---EATFEIFKQNLEEIKDKYKDLGS-----DS-LFSDVNEEISKHAMF
SALTTDSKPVTILSRSAKNLRLNDVF-SREEQYGEYLDLDRFHSSWLNVIRSTEC-----
TLLQFYSILEKFL----DDRQYILAPPMDRKNGRYAEFLVEISNYLEKFFQKANVLLNHT
---KLERRIQSE--F-SRSLATPLHTGGK----GFYCIACC-KWFKVPTVFDSHLTGKHH
KNNLSKRSKHLQAEYKLHRYLTLLSEEFRRTREFTERKVAFTAEERMQEMARLNHDYHAP
DYGPDEKEQEDPD--SNKAELDKNS------ALGGSF-DLPLGADGLPIPYWLYKLQGLD
VEYSCEICTNQTYKGRRAFEKHFLEPTHTFHLKCLGI--EPSITFKGITGIQEAQDLWRQ
TSSRNRPQT----------------QKKIDLEVEDQEGNVLTQKVYQELKKQGLV
>Suva_4.219
------------------------------------------------------------
-------------MDF-LETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGK-LFPD
---IK--QPR---PSLVSENKIYKLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEIN
IPQDVQEDEKD------LRSFEQKLQELEEELKNEQE-------NYQLDINLKRGRYALF
SSSAEPSKRTNILSERARDIDLNRLF-TRDEQYGEYMELEQFHSLWLNVIKRGDC-----
SLLQFFDTVELFV----DDKKYLLAPPMDRKNDRYMSFLMKLSEYVESFFYKSYALFEKE
---VVEGLIKSD--FDNSYCRGILKSESK----GIYCPLCY-KWFKTQAVFENHIPGKNH
KKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSLTQKYEAP
AYDATEREDDGKG--GGEQKDDKLQEKH---LFGKSF-DMPLGPDGLPMPYWLYKLHGLD
REYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGI--EPSSVFKGITKIAEAQRLWKN
TQSQPQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV
>Skud_4.221
------------------------------------------------------------
-------------MNV-LETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCK-VFPD
---VK--LPK---PSLIAENKIYKLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESN
NLEGVEEDDKE------VDRFEQNLQELEERLKNEDD-------NFQLDINLTRSKYALF
SSSADPSKRTNILSERARDLDLNKIF-TRDEQYGEYMELDQFHYLWLNVIRRSDC-----
SLLQFFNILELFV----DDKKFLLTPPMDRKNDRYMDFLMRLSKYLETFFFKSYVLFDKE
---MVENSIESD--FENSYCKGLVRSEAK----GIYCPFCS-KWFKTFPVFENHLSGKNH
KKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSLTEKYEAP
AYDHTEGEGDGQC--DAGRKGDLLQEKQ---PFGKSF-DMPLGPDGLPMPYWLYKLHGLD
REYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGI--EPSPAFKGITKIAEVQKLWKD
IQNQHRSGSSTAVALTKKSPSQPKLPTGLELEEEDEEGNVMSKKVYDELKKQGLV
>YDL030W
------------------------------------------------------------
-------------MNL-LETRRSLLEEMEIIENAIAERIQRNPELYYHYIQESSK-VFPD
---TK--LPR---SSLIAENKIYKFKKVKRKRKQIILQQHEINIFLRDYQEKQQTFNKIN
RPEETQEDDKD------LPNFERKLQQLEKELKNEDE-------NFELDINSKKDKYALF
SSSSDPSRRTNILSDRARDLDLNEIF-TRDEQYGEYMELEQFHSLWLNVIKRGDC-----
SLLQFLDILELFL----DDEKYLLTPPMDRKNDRYMAFLLKLSKYVETFFFKSYALLDAA
---AVENLIKSD--FEHSYCRGSLRSEAK----GIYCPFCS-RWFKTSSVFESHLVGKIH
KKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQKYEAP
AYDSTEKEGAEQV--DGEQRDGQLQEEH---LSGKSF-DMPLGPDGLPMPYWLYKLHGLD
REYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGI--EPSSVFKGITKIKEAQELWKN
MQGQSQLTS-IAAVPPKPNPSQLKVPTELELEEEDEEGNVMSKKVYDELKKQGLV
>Smik_4.205
------------------------------------------------------------
-------------MSF-LETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSK-VFPD
---VK--LPK---SSLIAENKLFKIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNIN
SQNYSQEDDKD------LCSFDEELRQLEDELKSEEE-------NFQLDINSKRNKYALF
SSSIDSSKRTNILSERARDLDLNKIF-TRDEQYGEYMELEQFHSLWLNVFKRSDC-----
SLLQFFDVVELFV----DDKKYLLTPPMDRKNDRYMAFLIKLCKYLETFFFKSYALFDKE
---VIESSIRFD--FEQSYCKGSLRSEAK----GIHCPFCY-KWFKTSPVFENHLTGKIH
KKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDALTQKYEAP
AYDPTDKDGDQQK--GSDQRDDQLQEKH---FFGKSF-DMPLGPDGLPMPHWLYKLHGLD
REYHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGI--EPSLAFKGITKITEAQKLWEN
MQKQPQSATSIASSLTKLKHSRSKLPTELELEEEDEEGNVMSKKVFDELKKQGLV
>NDAI0G02890
------------------------------------------------------------
------------MSHLDLEKRRSLLEDLEIIENAISTRFQRNPELYYSNLKKVSE-LFPS
KQVEE--LPT---HSIMTNNKIYKTKKLKRNRKQIALQQHEISLFIKDFFSKQKELETLT
REANFKAKKNKEEILLPVEEFKDILSEINEADGNENG-----NR-RELEINDKINKYSMF
SNSLNKSHPSTILSSRASDLDINSIF-SLEEQYGEYLALNPYYTEWLNVVKKEDL-----
TFLQFLNMLKIFQ----DDKRYIVQPPMDRKNEPYMKYLQRYCSYLESFFERKYPLIDSR
---YTSRELKKE--F-NKSIIKPLENEKK----GFFCKTCC-KWFKTLTVFESHLNGQKH
IKSYNKRVQGLYAEYKTHRYSMLLKEEHQSTCEFVERKMAFTVEERITEMKRLAEICKAP
AYDVNEKEGDENN--TELNVKDNLKNDGASAMLSGSI-NMPLGPDGLPMPFWLYKLQGLD
VSYPCEICSNQIFKGRRTFDKHFTEATHIYHLRCLGI--EPTPAFKGVTKIEEAQRLWNN
MKNDTIMGD---------KKFIETIPDKMAIEVEDKEGNIMTQKVYDELKKQGLA
>NCAS0C03540
------------------------------------------------------------
------------MVPL-LEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLS
---ID--TPA---ESNKSNNKIYKRKKLKRSRKQFVLQQQEINIFLKDFEERRRVL----
LDLGKETVKDD---NITLETFKTMIQDINAKKSSSEV----------LPINQKITRYAMF
SASISESKPNNILSQRCAGLDINKYF-SREEQYGQYMDFENFYLEWLNVVKTGDV-----
TLLQFLNLLRVFM----DEEKYLTHPPMDRKNNRYMKFLESLCSYVESFFFRKYALINKS
---AITSQIESQ--F-TEYIKEPTEHSVK----GQYCKACA-KWFKTESVFVNHIPGKNH
IKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRLTENYEKP
AYSSDEKEGDENN--ADLEHDEQRSGKGQG-LLEGSF-DMPLGPDGLPMPFWLYKLQGLD
VEYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGI--EPSSMFKGITKIKEAQKLWVD
INSQKNSSK------------PMVSSIELQVEVEDSVGNVMSKKLYDELKKQGLH
>KLTH0C08888g
------------------------------------------------------------
-------------MKT-YEDARATLEELELIENAVTSRLRRNPEIFYRNIDEVDL-VEHS
---GR--FDHI-PSSQKSANKVYTVKKSRRSRKQILAQEHEIKSFLSQYLKDCQSLGRVE
FDMSEYRVDNG-----SVNKLLEHIERIKEIHPKDDE---------------FGDQYAMF
SSSTPSNK--NIISRKAQNLDINSYF-TRDEQYGEYLDLEPFHQKWLSVVKNGDV-----
TLLQFLSEVEKFT----DQR-YLLQPAVNRNSSRYREFVASLHHYLSDYAARAYPLLSWD
---LIHAKAQEL--Y-HTNVAKPIPSGES----GVFCIPCD-KRFKTDTVYNAHLPGKRH
VGNLHKNSSFLTQEHSLHIFCRYLSRELARTREFVERKLAFTTEERTQELERLTDIYDSP
VYGRQEQE-DAQE--DENKETEDKEDS----VLDSSM-NLPLGPDGFPIPYWLYKLQGLD
IEYPCELCGNFVYNGRRQFDKHFGEQRHVFGLRRLGI--EPSASFKGVTKIDDAKQLWSH
LRSTSSGRV--------------SSEGKLEVEVEDEDGNVMSKKVYDELKKQGLL
>Kwal_56.22799
-------------------------------------------------MIKFNRIAKKM
NSKWSSKEKEKDLMVT-YESSRSTLEELELIEGAIAARLRRNPEIFYRNVDELKL-ITGD
---AK--VDDY-AEIEKNSNKIYSVRKTKRTRKQILAQEHEIQLFLEEYRKKSESLRNVE
FDLRRYQVTDG-----SVDGFLEHIETINSEVPD--------------DIDDSMENYTMF
SNSTAARR--DILSKKARALDINAKF-TREEQYGEFLDLEPFHQQWLSVVKDGSV-----
SLLQFLGEIEKFT----TKR-FLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQDWD
---KIHAEIQAT--Y-CDYKSHPEEAGDS----GLFCIPCD-KTFKAETVYLAHLTGKKH
INNMNKKDEFLAQEYKLHMLCCYLVQELVRTREFVERKLAFTPEERRQEMERLTTVYESP
VYGEQEQE-DIAE--ADQKPTTNQEDS----TPEPSF-DLPLGPDGFPIPYWLYKLQGLD
IEYPCEVCGNLIYKGRRQFDKHFTEQRHIFGLKRLGV--DPSPSFKGVTSIDDVKQLWAH
LRSSSKASN--------------AAGPKFEEEIEDEEGNVMSKKVYEELKKQGLI
>SAKL0C08800g
MEAPAFVHLCICAFVHLCAHIFILNVACCAVQKILRDRLALWMMKMKDDDVHIYPVHVCG
QSTSNRAGAHHTDMEI-LEAKRSVLERLEVIENAISERIRRNPELYYSYYEEQRL-VDKE
---NHGLLPPV-PASDISANRIHSVKKSRRSRKQIVLQQHEIDRFLEEYQREVARLHGIK
LDKDDSESAAP-----DFEQLEKAVKDAKSRYADESR--------TLAGVDVESVEHSMF
SSSTSTHK--DILSTRGRDLDMNRLF-ARDEHYGEFLLLEPFHHEWLNIVKDGSV-----
TALQFMNVVEMFV----SDA-YLVAPAVNRGSKKYQDFVGSLLGYMSEFFRKTYPLVNHS
---TLGRRLAAL--F-DEYLRAPVADETK----GLFCIPCG-RWFKLETVYKSHLSGKKH
SKNLAKGDGHLLAEYKLHKYCGLLVQTIANTRAFVERNRALTADERAQELERLAKEYEAP
AYSQHETEDAARE--KQQKREPETDEG------GNPF-NLPLGPDGYPIPYWLYKLQGLD
IEYSCEICSNHTYKGRRYFEKHFSEARHIFGLRCLGI--EPSATFKGITKIQEAKDLWAR
IQTSVATGVGAGAIASAATAAATPSTAKLEIEVEDEEGNVMSEKLYHELKRQGLL
>AEL085W
------------------------------------------------------------
-------------MSS-LEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQL-VNPD
---EK-VLDNI-SKDDINSNRIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFK
SD-DIESLRDP---NMNFETFEADIKELQERQAEGAD-----SESAISSLERKRREYSMF
SASSGADQ--TILSNVGQFIDVNKLF-MWEEHYGEYLFLERLHQDWLNVVKDGSV-----
TLLQFIAFLESFA----GTG-YLTAPPVDRNSKRYQVFIQKLVTYLEGAFRNTYPLLNHR
---LLENRISQS--F-ESYIANPVEDPPR----GLLCIACG-KHFKVGTVFAGHLLGKKH
AQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNREMATIRDAYDAP
AYSSGEPEDVIET--PQQQQNAHPDDV-------NPL-NLPLGPMGYPIPYWLYKLQGLD
IEYACEICANHVYKGRRISNAIFRTAP-CYGLRCLGI--EPSPAFKDIYNIAEAQQLFQS
LQSSTGPAG--LATRRAGAISSSANTRKLEVEVEDEDGNVMTHQVYEDLKKQGLL
>Ecym_3549
------------------------------------------------------------
-------------MSL-LEEKRAILEELELIEDAISDRIARNPEVFYSYIHELSI-VNSD
---EK-VLSNI-PNVDITANRVYMIKKSKRSRKQILLQQHEISKFLSYYLKNVKKLNGYK
ND-NVDEFKDH---NQNFELFRDQIQRIKEKYAEESN-----SEAFDASLEARKYQYTMF
SNSNHQKK--DILSLEGQSIDINKKF-SWEEHYGEYLHLDQYHQEYLNIVKNANV-----
SLLQFIGFLQTFC----DHG-HLKNPPVDRNSKIYHGFLERLLKYVNSFFESAFPLINHV
---QFQKRIKNS--F-VEYTSTPIEDSSR----GCLCVACG-KWFKAITVYTSHLQGRKH
LNNLKCRRRSLMVEYTLQNLFTCLNKELVSTKSFVERKYAFTVEERIQELAKLRDAYNAN
AYGDHERE-DSQEDLSVSSSKETPPDD------NNPL-NLPLGPDGYPIPYWLYKLQGLD
IEYTCEICGNHLYKGRRVFERHFHEQRHTYGLRCLGI--EPTSTFKGISKISDAQILWSR
LKNNSHLNSASATYPDATSSRAVVTNNKLEIEMEDEDGNVMSHRVYEDLKKQGLL