MUSCLE (3.8) multiple sequence alignment

TBLA0B01590        -------------MRTTSDIEE--------------SDSEIDIGQNIALNSDSSSDSESD
TDEL0D04630        -MKVSGKRKL---GDDASLSDG----------SESGSEEDYDIVNDIALNSSDSDEDDSS
ZYRO0B04972g       -MGSTLKRKL---EDEESNSEG---------------EEGFDIAGNIALTSSESEGEDGS
TPHA0M00330        MSRSVNKRSM---SADSDDSDF--------------EDNGVDIAKSIAFNASGSDSSDDS
Kpol_1032.11       -MGIISKRKR---HVEDSNSSS-------------DDDDGFDITSNIGLNTADSSDESES
AEL086W            -MGLASKRKR---DTEEHSDEG----------------EDFDIAGNIALDSEDSDDSVSD
SAKL0C08778g       MGSTSLKRKR---ESNNPSVEE-----------EEEEEDVFDIAGDIALDSSEDDDDDDD
KLTH0C08866g       MVKAVAKRSR-----QQSALSD---------------DEDVDIAGNIALDSSDSSSSSDN
Kwal_56.22804      MTKVTLKRSR----REDPLSDE----------------EDVDIAGNIALDSDESSESEDD
KNAG0K01110        -MVSSGKRVRESESYESSDEEGYVSAPGTGSSAEEEDDALVDIAGDIALESSDEEEEEDV
KLLA0F24684g       -MVDSSKRAL---PAEDYSSED---------------EDAFDIAGDIALNADSEDSDISD
Suva_4.218         -MAGVQKRKR---DLGDQDGSG-----------SEEEDAAFDIANDIALNASESDSDDSG
Skud_4.220         -MSGVQKRKR---DLEDQDVSG-----------SEEEDTAFDIANDIALNGSDSDSDGSS
Smik_4.204         -MAGMQKRRR---NLEDQDVIG-----------SEEDDIAFDIANDIALNDSESDSNDSE
YDL031W            -MAGVQKRKR---DLEDQDDNG-----------SEEDDIAFDIANEIALNDSESDANDSD
NDAI0G02870        -MALKEKRTR---DTAVDSSDS------------ENDAADFDIATDIALNASDSDDASSD
NCAS0C03530        -MAPTLKRSRLEDSDAEAASSG-----------DEDQDVGFDIAGDIALNSSESDASESD
KAFR0C01060        -MVALNKRTL---QEHDSDSET-------------ESANEFDIASNIALNSSDSDSDSDV
CAGL0K01551g       -MVKNLKRK----ERDEHESDS---------------DEEIDIAGNLVADGSDSESDDSS
                                                            **  .:      ..     

TBLA0B01590        NSSE-----TEVQDEIEYSDNQEEEVKEDKRTDKENNTKSKND-----------------
TDEL0D04630        EDSE-----GGEQDIIEYSDEEEEHQHEKKKSAPKDKS----------------------
ZYRO0B04972g       DEDS----EENYQDVIDYSDDDKEKEAGKKKKEPVKKSDKHD------------------
TPHA0M00330        DEEDDFKVDDGVQDLIEYSDEETTEKEVKKTKKASNP-----------------------
Kpol_1032.11       SGDD----EEEVQDIVDFSDEEDTKKKPKSSNKTLTDNNS--------------------
AEL086W            SDNE-------VQDIIEFSDDEKQNAPQVSKTAKGAKGAKVAAPRSDAA-----------
SAKL0C08778g       DGEQ--DSEQEVQDVIEFSDGEEQGKKNQSKGAAKSAAKGNSKGAKQPRPS---------
KLTH0C08866g       DDDGSEDEAGDVQDIIEFSDEDEEEARAKAAPQKKKKNAHEGG-----------------
Kwal_56.22804      SEDG-EGEEGDVQDIIDFSGDEEETSKNAKKTGKAEKKPSSKQAS---------------
KNAG0K01110        QG--------DIADIIDYSDEEPAEAKGKQQKQKQKPSKKSPKENA--------------
KLLA0F24684g       DDNDNIGFQAEVQDVIEFSSDEEEKEKKPKKQNKKAKVKAGPIVDSK-------------
Suva_4.218         SEEEADYGLSGVQDVIEYSSDEEEKGKNKKKTDAKNTKKNKEDNKTKTKTKTKNGKKEAA
Skud_4.220         SGTEADYGLGDVQDVIKYSSDEEREGDSKKKANGKNGKKNKSDNKKKSGKKEVAA-----
Smik_4.204         NEIEAGYGPSDVQDIIEYSSDDEEEGKKSNKKKKTNDKKPGKNKHNKKEVAA--------
YDL031W            SEVEADYGPNDVQDVIEYSSDEEEGVNNKKKAENKDIKKKKNSKKEIAA-----------
NDAI0G02870        SDNE------DVQDVIDYSDSEHQQEDNKIARKEKQKKQDIDKS----------------
NCAS0C03530        DDEE------DVQDVIEYSDDETETKKKNDKKKNNNKTKEDKS-----------------
KAFR0C01060        DEQD-----GEVEDIISYSDDEKSQVEEVPKKSKKEKKVIKD------------------
CAGL0K01551g       DGSD-----EEVQDVIEYSSDEEEPAKPAKAVKKKVEDKS--------------------
                   .            * :.:*. :                                      

TBLA0B01590        -FPQLDGNV--------------EVESDDDDINDYFATTHLD-TKKFKKGSFASFGFNRF
TDEL0D04630        -FPKLEASGD-------------EAEDDADDVNEYFSTTAQT-NKKHKKGSFPSFGLSKL
ZYRO0B04972g       -FPILELSDNEEDADAKKK----KEDGDADDISEYFTTNNSE-SKKHKKGSFPSFGFSKF
TPHA0M00330        -FPLLEMSDDEDDKNSKNS----AFNDDADDVNDYFSTNMQD-KSKHKKGSFPSFGLSKL
Kpol_1032.11       -FPSLEISDDEDSNNKG------DHEDDDDDLNDYFSINNSE-KSKHKKGSFPSFGFSKL
AEL086W            -FPSLELSDGED-----------ADNGDKDDVDSYFNTTSQLAASKAKKGSFASFGLSKF
SAKL0C08778g       -FPTLELSDAEDE----------APDADKDAVNDYFSTTAAAAAGKHKKGSFPSFGFSKF
KLTH0C08866g       -FPALELSDNEDHD---------DGKDGADDVTEYFSTNNPE-AAKHKKGSFASFGLSKF
Kwal_56.22804      -FPLLELSDDEEEQ---------AANDGEDDVTEYFTTTNAE-ASKHKKGSFASFGLSKF
KNAG0K01110        -FPSLELSDDESSKA--------AGDASDDDVNAYFSTNNQAEKQKFKKGSFASFGLSKA
KLLA0F24684g       -FPSLELSDDEKK----------ATNESDDDLNDYFNTTADA-AAKHKKGSFASFGLSKL
Suva_4.218         AFPTLELSDDENSVPGKN-----QADDDEDDVNEYFSTTNLE-KTKHKKGSFPSFGLSKI
Skud_4.220         -FPTLELSDDENDASGKT-----QADDDEDDVNEYFSTTNLE-KTKHKKGSFPSFGLSKV
Smik_4.204         -FPILELSDDENNISGQT-----QAGEEEDDVNEYFSTNNLE-KQKHKKGSFPSFGLSKI
YDL031W            -FPMLEMSDDENNASGKT-----QTGDDEDDVNEYFSTNNLE-KTKHKKGSFPSFGLSKI
NDAI0G02870        -FPILELSDDEDTKKKSNSKNNGSDNDDDDDINAYFSTTNLE-KSKHKKGSFPSFGLSKI
NCAS0C03530        -FPSLELSDDEADRR--------NNEDEDDDVNAYFSTTNLD-KSKHKKGSFPSFGLSKF
KAFR0C01060        -FPLLELSDDEDSKK--------QANDNDDDVNSYFSTNNLNTKTKHKKGSFASFGLSKL
CAGL0K01551g       -FPSLELSDDEDEKK--------KVDNDDDDVNAYFSVNTDA-KSKHKKGSFASFGLSKL
                    ** *: .                     * :  **  .      * *****.***:.. 

TBLA0B01590        IMNNINKKGYKQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFLLPMIEKLKTHSSKIG
TDEL0D04630        ILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSKVG
ZYRO0B04972g       ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG
TPHA0M00330        ILSNINKKGFRQPTPIQRKTIPLILQRRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIG
Kpol_1032.11       ILSNVHKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKSHSSKIG
AEL086W            ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG
SAKL0C08778g       ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG
KLTH0C08866g       IVSNIAKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKGHSAKIG
Kwal_56.22804      IISNIAKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIERLKGHSAKIG
KNAG0K01110        ILSNVTRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKTHSSKIG
KLLA0F24684g       VLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIG
Suva_4.218         VLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIG
Skud_4.220         VLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIG
Smik_4.204         VLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIG
YDL031W            VLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIG
NDAI0G02870        IVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIG
NCAS0C03530        IISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIG
KAFR0C01060        ILTNISKRGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFVLPMIEKLKTHSSKIG
CAGL0K01551g       ILVNISKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKTHSSKIG
                   :: *: ..*:.*************** *****:*********** **:: .:* **.*:*

TBLA0B01590        VRGVILSPSREIAIQTHRVFKEFSKNTELRSVLLTGGDSLEDQFGMMMSNPDVVIATPGR
TDEL0D04630        ARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGR
ZYRO0B04972g       ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR
TPHA0M00330        ARAVILSPSRELAMQTHKVFKDFSRGSQLRSVLLTGGDSLEEQFSMMMSNPDVIVATPGR
Kpol_1032.11       ARAVILSPSRELALQTHRVFKEFSKGTHLRSVLLTGGDSLEDQFSMMMSNPDVIVATPGR
AEL086W            ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGR
SAKL0C08778g       VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR
KLTH0C08866g       ARAVILSPSRELAMQTHKVFREFSRGSDLRSVLLTGGESLEEQFGLMMSNPDVVIATPGR
Kwal_56.22804      ARAVIMSPSRELALQTHKVFREFSRGSDLRSVLLTGGESLEEQFGLMMSNPDVVIATPGR
KNAG0K01110        VRAIILSPSRELALQTHNVFKDFSKGTHLRSVLLTGGDSLEEQFGMMMSNPDVVIATPGR
KLLA0F24684g       VRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGR
Suva_4.218         ARAVILSPSRELAMQTFNVFKEFARGTALRSVLLTGGDSLEEQFSMMMSNPDVIIATPGR
Skud_4.220         ARAVILSPSRELAMQTFNVFKDFAKGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGR
Smik_4.204         ARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGR
YDL031W            ARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFGMMMTNPDVIIATPGR
NDAI0G02870        ARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGR
NCAS0C03530        ARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGR
KAFR0C01060        ARAIILSPSRELAMQTHNVFKEFSKGSDLRSVLLTGGDSLEDQFGMIMANPDVIIATPGR
CAGL0K01551g       ARAIILSPSRELAMQTHSVFKEFSRGTHLRSVLLTGGDSLEDQFGMMMTNPDVIIATPGR
                   .*.:*:*****:*:**. **.:*:..: ***:*****:.**:**.::* ****::*****

TBLA0B01590        FLHLKVEMKLDLKSVEYIVFDEADRLFEMGFEEQLNELLAALPDNRQSLLFSATLPNSLV
TDEL0D04630        FLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNSLV
ZYRO0B04972g       FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV
TPHA0M00330        FMHLKVEMGLDLKTVEYVVFDEADRLFEMGFQEQLNELLASLPMNRQTLLFSATLPNSLV
Kpol_1032.11       FLHLKVEMSLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPMNRQTLLFSATLPSSLV
AEL086W            FLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLV
SAKL0C08778g       FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV
KLTH0C08866g       FLHLKVEMNLDLKSVEYLVFDEADRLFEMGFEEQLSELLAALPVARQTLLFSATLPSSLV
Kwal_56.22804      FLHLKVEMNLDLKSIEYVVFDEADRLFEMGFEEQLNELLAAFPVARQTLLFSATLPSSLV
KNAG0K01110        FLHLKVEMNLVLKTVEYAVFDEADRLFEMGFQEQLNELLAALPSSRQTLLFSATLPSSLV
KLLA0F24684g       FLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLV
Suva_4.218         FLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTARQTLLFSATLPNSLV
Skud_4.220         FLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPARRQTLLFSATLPNSLV
Smik_4.204         FLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLV
YDL031W            FLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLV
NDAI0G02870        FLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQTLLFSATLPSSLV
NCAS0C03530        FLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSATLPSSLV
KAFR0C01060        FLHLKVEMNLDLKSVEYICFDEADRLFEMGFQEQLNELIYSLPSNRQTLLFSATLPSSLV
CAGL0K01551g       FLHLKVEMNLDLKSVEYAVFDEADRLFEMGFQEQLNELLAALPSSRQTLLFSATLPTSLV
                   *:****** * *:::**  ***:******** :**.**: ::*  **:******** :**

TBLA0B01590        EFAKAGLKNPVLVKLDQESKISDNLEMLFLSCKKEERESNLLFLLQDVIGVPVASTEEMK
TDEL0D04630        DFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATEEQIK
ZYRO0B04972g       DFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKM
TPHA0M00330        DFAKAGLTNPVLVRLDAESKISENLQLAFFSTKNEEREATLLYILQDVIDLQIGTEEEIK
Kpol_1032.11       DFAKAGLTNPVLVRLDAETKISENLEILFLSTKNEERENNLLYLLQDVIKIPLGTDDQIK
AEL086W            DFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQ
SAKL0C08778g       DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK
KLTH0C08866g       NFAKAGLTNPVLVRLDAETKVSENLEMLFLSSKNEEREANLLYLLQEAMKIPVATEEQLL
Kwal_56.22804      DFAKAGLTSPVLVRLDTETKVSENLEMLYLSSKNEEREANLLYLLQEAMQIPVATEEQLA
KNAG0K01110        EFAKAGLTNPVLVRLDAESKISENLQMLFLSIKNDEREANLLYLLQNVIKIPLATPEQLK
KLLA0F24684g       DFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIK
Suva_4.218         DFVKAGLVNPVLVRLDTETKVSENLEMLFVSTKNDDREANLLYILQEVIKIPLATSEQLQ
Skud_4.220         DFVKAGLVNPVLVRLDTETKVSENLEMLFLSSKNADREANLLYILQEVIKIPLATSEQLQ
Smik_4.204         DFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLL
YDL031W            DFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEIIKIPLATSEQLQ
NDAI0G02870        DFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDVIKIPLATKEQQR
NCAS0C03530        DFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQLA
KAFR0C01060        DFAKAGLTNPVLVRLDTETKISENLEMLFLSIKNEEREANLLYLLQEEICIPLATEEQIK
CAGL0K01551g       DFAKAGLVNPVLVRLDAESKISDNLEMLFLSTKNDEREANLLYILQEVIKLPLATPEQIK
                   :*.**** .****.** *:*:*:**:: :.: *: :**  *::::*: : : :.: .:  

TBLA0B01590        RFQT------DSREVEEKEEKEKEKG-------KEKEKRAKYYKSDEIPHEQATIIFVPT
TDEL0D04630        LIKD-KS---PDSDEESDDDNGKRSHNKHKK---EKFKKVRMPAANQLPSEKSTILFVPT
ZYRO0B04972g       ILGE-GNKALSDSEDSDAENGKKDRRKKGKK---NKAKRPKLPSANELPSEKATIVFVPT
TPHA0M00330        KLTA-SNKRSDEIDSDNEREQADRKLNKKKK--FEKFIKPKLPSANELPSEKATIVFVPT
Kpol_1032.11       KLSD-FNKSLSDSDSEDEDNKGKQNSRKSKK---GKFQKLKVSASNELPTEKSTIVFAPT
AEL086W            RFRK-QS--NDDADDSDDETDKKKKH--------SKKSKQPLPSAKDMPSPNSTIIFVST
SAKL0C08778g       QLRALNDRSDSDADSDANDKNDRKKR--------KKQARRKMPSANELPSEKATILFVPT
KLTH0C08866g       EYKA-KVKNSYDSDDSDEDAKAKAKK----Q--RKSAIRKKLPSANELPSEHATIVFVPT
Kwal_56.22804      EYRT-KIKDDYDSDDSDSKDKLKAKK----K--KKAMIRRKMPAANELPSEHATIVFVPT
KNAG0K01110        KLRD-SDAKFSESESEDESNEKRGGKRDFKKNGKKKFVKQRLPAANELPSENATVVFVPT
KLLA0F24684g       KLKQ-QN--DADSDSDDSEDEKKKKA----K--KAKKSKRRLPNANEMPSEKATIVFVPT
Suva_4.218         KLQK-SN---NEADSESDDDNDRQKKRKNFK--KEKFRKQRMPGGNELPSEKATILFVPT
Skud_4.220         KLQK-SN---NEADSDSDDENDRHKKKRNFK--KEKFRKQKMPAANELPSERATILFVPT
Smik_4.204         KLQK-ST---NEADSDSDDENDRQKKKINFK--KEKFRKQKMPAANELPSEKATILFVPT
YDL031W            KLQN-SN---NEADSDSDDENDRQKKRRNFK--KEKFRKQKMPAANELPSEKATILFVPT
NDAI0G02870        KFND-QNKKDNESDSDADDNNNNNKNK---K--KRKFKKERLPPANQLPSEKATILFVPT
NCAS0C03530        KFNA-QNIKDNASDSDSDGDDKRQKG----K--RKKFKKERLPPANQLPSEKSTILFVPT
KAFR0C01060        KLNN-ESKIDDDSDSEDDEATRRQKR----K--SKNFKKQRLPPANQLPSEKATIIFVPT
CAGL0K01551g       QLND-NKADDSDESAEEDEDKKRRKR--------KSFNRKAMPKANELPSEKATVVFVPT
                                . .                      .     ..::*  .:*::*..*

TBLA0B01590        RHHVEYISQLLMKCGYLVSYLYGTLDQHARRNQLRQFCFGITRILVVTDVAARGVDIPLL
TDEL0D04630        RHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPML
ZYRO0B04972g       RHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPML
TPHA0M00330        RHHVEYISNLLKDCGYLVSYLYGTLDQHARKHQLFNFRAGLTSILVVTDVAARGVDIPML
Kpol_1032.11       RHHVEYITQLLKDSGFLVSYLYGTLDQHARKRQLLNFRAGLTSILVVTDVAARGVDIPML
AEL086W            RHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLL
SAKL0C08778g       RHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPML
KLTH0C08866g       RHHVEYISQLLKDCGYLVSYLYGTLDQHARRQQLFNFRAGLTTILVVTDVAARGVDIPLL
Kwal_56.22804      RHHVEYITQLLKDCGYLVSYLYGTLDQHARRQQLFNFRAGLTTILVVTDVAARGVDIPML
KNAG0K01110        RHHVEYISQVLKDCGYLVSYIYGSLDQNARKSQLYNFRLGLTSILVVTDVAARGVDIPML
KLLA0F24684g       RHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLL
Suva_4.218         RHHVEYISQLLRDCGFLISYIYGTLDQHARKRQLYNFRAGLTSILVVTDVAARGVDIPML
Skud_4.220         RHHVEYISQLLRDCGYLISYIYGTLDQHARKRQLYNFRAGLTSILVVTDVAARGVDIPML
Smik_4.204         RHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPML
YDL031W            RHHVEYISQLLRDCGYLISYIYGTLDQHARKRQLYNFRAGLTSILVVTDVAARGVDIPML
NDAI0G02870        RHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPML
NCAS0C03530        RHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPML
KAFR0C01060        RHHVEYISQLLKDCGYLVSYIYGTLDQRARNRQLYNFRLGLTSILVVTDVAARGVDIPML
CAGL0K01551g       RHHVEYLSNLLKDCGYLVSYIYGALDQHARKSQLYNFRIGLTSILVVTDVAARGVDIPML
                   ******::::*  .*:*:**:**:*:*.**. ** :*  *:* ***************:*

TBLA0B01590        PNVINYSLPGSSKIFVHRVGRTARAGNRGWAYSIVSESELPYLVELGTFLGKKVITTGMV
TDEL0D04630        ANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISESELPYLLDLELFLGKKILTTPMY
ZYRO0B04972g       ANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLELFLGKKILLAPMY
TPHA0M00330        ANVINYSLPASSKIFVHRVGRTARAGNKGWAYSIASETELPYLLDLELFLGKKILLTQMY
Kpol_1032.11       ANVINYSLPASSKIFIHRVGRTARAGNRGWAYSIVSETELPYMLDLELFLGKKILLTSMY
AEL086W            ANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTILSESELPYLLDLELFLGKKVLLTPMY
SAKL0C08778g       ANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSENELPYLLDLELFLGKKILLAPMY
KLTH0C08866g       ANVVNYSLPASSKIFVHRVGRTARAGNKGFAYSIVSENELPYLLDLELFLGKKILLTPMF
Kwal_56.22804      ANVVNYSLPASSKIFVHRVGRTARAGNKGSAYSIVSDNELPYLLDLELFLGKKILLTPMY
KNAG0K01110        ANVINYSLPSSSKIFIHRVGRTARAGNKGWAYTIVSESELPYLLDLELFLSKKVLLTPML
KLLA0F24684g       ANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSENELPYLLDLELFLGKKILLTPMY
Suva_4.218         ANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAENELPYLLDLELFLGKKILLAPMY
Skud_4.220         ANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVSENELPYLLDLELFLGKKILLAPMY
Smik_4.204         ANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAENELPYLLDLELFLGKKILLTPMY
YDL031W            ANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAENELPYLLDLELFLGKKILLTPMY
NDAI0G02870        ANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSESELPYLLDLELFLGKKIMLTPMY
NCAS0C03530        ANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKILMTPMY
KAFR0C01060        ANVINFSLPVSSKVFVHRVGRTARAGNRGWAYSIVSENELPYLLDLELFLGKKILLTSMY
CAGL0K01551g       ANVVNYSLPASSKIFIHRVGRTARAGNRGWAYSIVSENELPYLLDLELFLGRKILLTPMY
                   .**:* ::* ***:*:*********** * *::* ::.****:::*  **..*:: : * 

TBLA0B01590        EKL--------------GVSFD--KISYNKWMVLGSGPRVDVESFGDLYKNVYDQEFDLQ
TDEL0D04630        EAATDLLEKRWVEEGKEKILFKAPKPSYTNRLVLGSCPRLDIDSMGDLYKNLM-SSFELE
ZYRO0B04972g       EATCNLLKEKWVNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDSNYDLG
TPHA0M00330        EATCSLAKNKWIAAGNEEYTFQPPKPSYTDRMILGSCPRLELENIGDLYKNIMSASFDLQ
Kpol_1032.11       EASCKLMKSKWIADGNTESSFEDPKISYTNRLVLGSAPRYDIESVGDLYKNIIESNFDLQ
AEL086W            EATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLVESNFELQ
SAKL0C08778g       DATCELMRKQWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQ
KLTH0C08866g       EATTELLKSKWIAEGNSELTFNPPKVSYTNRMVLGACPRLDLETCGDLFKNLTQSSFDLQ
Kwal_56.22804      EATTEMLKSRWIAEGKSELTFNAPKVSYTNRMVLGACPRLELETCGDLFKSLIDSSFDLK
KNAG0K01110        EAKNAILKQKWIDQGNDEMSFKPPAVSYTDRIVLGSCPRLDLESMGDLFKNILENNFDLS
KLLA0F24684g       ESSCQILRKKAESEGNN--NFTDPKVSYTTRMVLGACPRSEIDGMGDLYSNMIKSDFELN
Suva_4.218         DSLAGLMKKRWVDEGKPEYTFQPPTLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQ
Skud_4.220         DNLVDSIKKRWIDEGNLEFQFQPPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQ
Smik_4.204         DSLVDVMKKRWVEEGNSAYNFQLPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQ
YDL031W            DSLVDVMKKRWIDEGKPEYQFQPPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMSSNFDLQ
NDAI0G02870        DSLCEIMKNKWIAEGNDESSFVNPKIAYTDRLILGSAPRLEVEGLGDLYKNMMQNNFELK
NCAS0C03530        DSMSDIMLKKWIAEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNVMKSNFEIQ
KAFR0C01060        DATCDIMKKKWVSEGKSELTFQDPKPSYTNRMVLGSAPRLQVEDLNDLYTGVLSGSFDLK
CAGL0K01551g       EALERLSKEKWVAEGNDETLFQSPKISYTSRMVLGSCPRLDIEALSELYNNLMKSNFDLD
                   :                   *     :*  .::**: ** :::  .:*: .:   .::: 

TBLA0B01590        MSKKTCEKAEKLYLRTRGGASNDSVKRSKELILQKWDGQNVKFGQDLERAKLELLNKFAL
TDEL0D04630        TLRGVAKKAEKLYLRTRTAASVESVKRSRELMTSGWDEQNVMFGKNLEKEKLDFLAKLQD
ZYRO0B04972g       STRGVSIKAEIMYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFLAKLQD
TPHA0M00330        MAKKTSLKAEKLYFRTRTAASPESIKRGKELIASGWDEQHIMFGKNVEKEKLDFLSKFQN
Kpol_1032.11       MAKKVSLKAEKLYCRTRTAASPESIKRSKEVIASGWDEQNIRFGRNLEKEKLNFLAKFQN
AEL086W            NLKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKLEFLAKLQN
SAKL0C08778g       LLKSVALKAEKLYFRTRAPASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQN
KLTH0C08866g       QLKGVAAKAEKLYFRTRPPASSQSMKRSKEVIASGWDEQNLRFGKNIEKEKLDFLAKLQN
Kwal_56.22804      QLKAVANKAEKLYFRTRPPASSQSMKRSKEVLSSGWDEQNLRFGKNMEKEKLDFLAKLQN
KNAG0K01110        LMKATSLKAEKLYFRTRTHASLESLKRSKEVIASGWDEQNIIFGSNVEKEKINFLAKLQN
KLLA0F24684g       TVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAEKEKLDFLAKLQH
Suva_4.218         LAKKTALKAEQLYYRTRTAASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQN
Skud_4.220         LAMKTSMKAEKLYYRTRTSASPESLKRSKEIIASGWDAQNAFFGKNEEKEKLDFLAKLQN
Smik_4.204         LAKKTAMKAEKLYYRTRTSASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQN
YDL031W            LAKKTAMKAEKLYYRTRTSASPESLKRSKEIISSGWDAQNAFFGKNEEKEKLDFLAKLQN
NDAI0G02870        LIKDVAMKAEKLYFRTRTSASPESLKRSKEIIASGWDEQNVLFGKNQEKEKLDFLAKLQN
NCAS0C03530        LLKGVAMKAEKLYFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKLDFLAKLQN
KAFR0C01060        MMKQTALKAEKLYFRTRTSASPESMKRSKEIILSGWDEQNIRFGKNVEKEKFQFLAKLQN
CAGL0K01551g       MAKKTALKAEKLYFRTRTSASPESLKRSKEIISSGWDEQNVLFGKNLEKEKNAFLEKLQN
                       .. *** :* ***  ** :::**..:::   ** *:  ** : *  *  :* *:  

TBLA0B01590        RKNKETVFEFGKNGEDEMSTLMNRRWKVVKGIERKAKRRREMKEEEE-GGVEEELQFEEE
TDEL0D04630        RTNKETVFEFARNADDETSMLMKKRRFQVAPITEKAKKRKELLELQKAAGFSHAM--EDE
ZYRO0B04972g       RRNKETVFEFARNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSL--EDE
TPHA0M00330        RNNKETVFEFGRNPTDATAVLMNRRRRQLAPIQRKAVERRKLLEKERLAGLSHAL--EDE
Kpol_1032.11       RRNKETVFEFGKNPNDDTAILMQKRRKQIAPIQRKARKRQELLDKERVAGLTHKI--EDE
AEL086W            RHNKETVFEFARNHDDEMAILMKRRRRQIAPIQQRAKERQQLLEKERQAGLRHTL--EDE
SAKL0C08778g       RNHKETVFEFARNQEDEMAVLMRRRRRQIAPIQRKARERQELLEKERMAGLRHTL--EDE
KLTH0C08866g       RNNKETVFEFARNQDDEMSLLMKKRRIQIAPIQRRAKERKELLEKERMAGLRHTV--EDE
Kwal_56.22804      RHHKETVFEFARNHDDEMALLMKKRRIQIAPIQRRAKERKELLEKERKAGLVHSV--EDE
KNAG0K01110        RRNKETVFEFSRNPDDEMSVFMKRRRRQLAPVQKKAKERRELLEKERRSGLSHSI--EDE
KLLA0F24684g       RNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEKERMIGLRHSI--EDE
Suva_4.218         RRNKETVFEFTRNPDDEMSVLMKRRRKQLAPIQRKSRERRELLEKERMAGLSHSI--EDE
Skud_4.220         RRNKETVFEFTRNPDDEMAVLMKRRRKQLAPIQRKASERRKLLEKERMAGLSHSI--ENE
Smik_4.204         RRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSI--EDE
YDL031W            RRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSI--EDE
NDAI0G02870        RRNKETVFEFSRNPDDEMSVFMKRRRRQLAPIQRKARERKELLQMEKMAGLTHSV--EDE
NCAS0C03530        RRNKETVFEFASNPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLTHTM--EDE
KAFR0C01060        RHNKETVFEFARNPDDEMSVLMKRRRRQLAPIQRKAEERRELMEKERLAGLTHRI--EDQ
CAGL0K01551g       RRNKETVFEFTRNPEDEMANLMHRRRRAIAPIQRKAKERKELLEKERMAGLTHAL--EDE
                   * :*******  *  *  : :*..*.  :  :  .:  *.:: : :   *.   :  *::

TBLA0B01590        LGSGSGPGPGQGPGQDLVDAGNYNGVFEDGDAILNGQTKKR-------------------
TDEL0D04630        LLNDNEL-----IKESVPEE-VLQ-EFEDADKLLEDQEKLG------------------R
ZYRO0B04972g       VLDKYKG---E-VGYSVPDA-VLE-EFEDADQVLEDQETEGK---------------KQK
TPHA0M00330        ILKGEDH---E-SGYTISKE-ALA-AFEDADKLLQEQEKKK-------------------
Kpol_1032.11       ILKGEDH---E-AGYSVPEE-ALK-SFEDADKILEEQESSR------------------K
AEL086W            ILKGEEN---E-VGYSVPQE-LLR-DFEDADELAAKRNTKK-------------------
SAKL0C08778g       VLKGGDG---E-FGYSVPEE-VLAQEFEDADKILDEQENKKKTKTMKTRQGETKPKPKPK
KLTH0C08866g       ILKGDEN---E-VGYSVPEE-VLHREFQDADELLGAQSKSK-------------------
Kwal_56.22804      ILKGDET---E-VGYSVPEE-VLHQEFEDADELLEGQKKEK-------------------
KNAG0K01110        IFNQNNNTEME-TGYTVSEE-ALK-QFEDADELLQKQSEKK-------------------
KLLA0F24684g       ILKGEDN---E-VGYSVPDE-VLK-EFEDADVLLEEQENIK------------------K
Suva_4.218         ILKGNDG---E-TGYTISED-ALK-EFEDADQLLEAQENDSK---------------K-K
Skud_4.220         ILKGDDG---E-TGYTVSEE-ALK-EFEDADQLLEAQENDSK---------------K-K
Smik_4.204         ILKGDDG---E-TGYTVSED-ALK-NFEDADQLLEAQENESK---------------K-K
YDL031W            ILKGDDG---E-TGYTVSED-ALK-EFEDADQLLEAQENENK---------------K-K
NDAI0G02870        ILKGDDN---E-AGYSVSED-TLKQQFQDADELLADQENKSK---------------KDK
NCAS0C03530        VLKGDNA---EDNSYTISED-TLK-QFEDGDELLAGQENKK-------------------
KAFR0C01060        ILKGDDF---E-AGYTVPED-ALK-EFEDADKVLEASNKKS-------------------
CAGL0K01551g       ILKGDDA---E-VGYTVTED-TLK-AFEDADTILAEQENAS------------------K
                   : .             : .       *:*.* :                           

TBLA0B01590        ---KTFKDERFFLSHYADPKKVENE--EVVDGFINAASEASYDLNNDEKIQVHKQSSATV
TDEL0D04630        KKSKSFRDPNFFLSHYAPQGGLHENELNLTSGFTTDAAQAACDINGDDKVQVHKQ-NATV
ZYRO0B04972g       QKSKSFKDSNFFMSHYAPAQSVQDSQLNISSGFTTDAAQASYDLNDDDKIQVHKQ-TATV
TPHA0M00330        RKPKTYKDPQFFLSHYAPAKDIQDKQLNLTSGFTNDAAQAAYDLNNDDKVQVHKQ-TANI
Kpol_1032.11       KKSKTFRDPNFFISHYAPAGDIQDKQLQITSGFTNDAAQAAYDLNDDDKVQVHKQ-TATV
AEL086W            ----GFRDENFYLSHFAPASDIQDKQLQVASSFTNEVSKATFDLHNDDKVQVHKQ-TATV
SAKL0C08778g       PKPKTYKDPNFFLSHYAPAGDIQDKQLQLTSGFTNDAADATFDLHDDNKVQVHKQ-TATV
KLTH0C08866g       -RPKSFRDPAFFLSHYAPASEIQDKQLEVTNGFTNEAANATFDLHNDDKVQNHKQ-VATT
Kwal_56.22804      -KQKSFRDPTYFLSHYAPASEIQDKQLEVSNGFTNEAANATFDLHNDDKVQNHKQ-IATI
KNAG0K01110        TKPKNYKDPNFFLSHYAPAADIQDKQLQVTSGFTNDAAQAAYDLNDDDKVQVHKQ-TATV
KLLA0F24684g       KQKKTFRDPTFYLSHFAPTSDIQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQ-TATV
Suva_4.218         KKPKTFKDPSFFLSHYAPAGEIQDKQLEITGGFANDAAHAAYDLNGDDKVQVHKQ-TATV
Skud_4.220         KKPKTFKDPTFFLSHYAPAGEIQDKQLQIASGFANDAAHAAYDLNTDDKVQVHKQ-TATV
Smik_4.204         KKPKTFKDPTFFLSHYAPAGEIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQ-TATV
YDL031W            KKPKSFKDPTFFLSHYAPAGDIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQ-TATV
NDAI0G02870        KSKKSFKDPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVHKQ-TAMV
NCAS0C03530        -KKKTFKDPTFFLSHYAPASDIQDKQLQVANGFANEAAQAAYDLNNDDKVQVHKQ-TATV
KAFR0C01060        -EQKTFRDENFFLSHYAPTSAIQDQQYKLSTGFTNAAAEAAYDLNSDDKVQVHKQ-TATV
CAGL0K01551g       KKKKTFRDPNFFLSHYAPANEIQDKQLELSGGFINEAAQSAYDLNSDDKVQVHKQ-TATV
                        :.*  :::**:*    : :.  ::  .* . .:  : *:  *:*:* ***  *  

TBLA0B01590        KWDRKRKKYVNLQGIDNKKYIIGESGRKIPATFRSGKYEEWAKARNINTRNVMRVGARES
TDEL0D04630        KWDSKKKKYINSQGADNKKYIVGESGQKIPASFRSGKYAEWSKARNLQP---IKVGARES
ZYRO0B04972g       KWDKKKKKYVNPQGADNVRYITSESGQKIPASYRSGKFDEWSKKRKLKM---PKVGSRES
TPHA0M00330        KWDKGRKKYVNINGLDNKKYIIGEGGQKIPASFKSGRFDEWSKARHIKP---LKAGVRED
Kpol_1032.11       KWDKKRKKYVNMQGIDNKKYIIGESGQKIPASFKSGKFAEWSKSRNIKG---IKTGARET
AEL086W            KWDKKRKKYVNVQGIDNKKYIIGESGQKIPASFRSGKFDEWSKARKLAP---LKVGARES
SAKL0C08778g       KWDKKRKKYVNAQGLDNKKYIIGESGQKIPASFRSGKFAEWSKARKLGP---LKVGARET
KLTH0C08866g       KWDKKRQKYVNTQGLDNKKYIMGESGHKIPASFRSGKFDEWSKARKLGP---LKVGAKES
Kwal_56.22804      KWDKKRQKYVNSQGLDNKKYITGESGHKIPASFRSGKFDEWSKARKLGP---IKVGARES
KNAG0K01110        KWDKKRKKYVNMQGIDNKKYIIGESGQKIAASFRSGKFDEWSKARHIKP---LKVGAKED
KLLA0F24684g       KWDKKRKKYVNTQGLDNKKYIIGESGQKIPASFRSGKFQDWSKARKIAP---LKVGARES
Suva_4.218         KWDKKRKKYVNTQGLDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKP---LKVGSRES
Skud_4.220         KWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKP---LKAGSRES
Smik_4.204         KWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKP---LKVGSRES
YDL031W            KWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKP---LKVGSRET
NDAI0G02870        KWDKKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKP---LKVGARET
NCAS0C03530        KWDKKRKKYVNVQGLDNKKYIIGESGQKIAASFRSGKFDEWTKARKLKP---LKVGARES
KAFR0C01060        KWDKKRKKYVNMQGIDNKKYIVGESGQKIAASFRSGKFEEWSKARKLKP---LKVGARES
CAGL0K01551g       KWDKKRKKYVNMNGIDNKKYIIGESGQKIAASFRSGKFDEWSKARKLAP---LKTGANES
                   ***  .:**:* :* ** .** .*.*.**.*::.**.: :*:* *::      ..* .* 

TBLA0B01590        EGSVV----------GGGRGGGGGRFKHKLDKKPKMPDKYRDDYKKQKEKNERAVERGV-
TDEL0D04630        PTAANMLRNPAQNHPTDGQRTVGGKFKHKQVKAPKLPDKHRDDYHKQKKKVKEALDKGIN
ZYRO0B04972g       SMATNLLQDPTRGNPSSNNR----RFMHKQVKAPKVPDKYRDDYGKQKTKVAKALEKGIH
TPHA0M00330        SIPTNLLADVTGP--SDGSRTFGGRFKHKQNKAPRLPDKHRDDYESQKKKVQNALERGVQ
Kpol_1032.11       SIPTNLLSDPTTD--SGSQRGPGGRFKHKQNKAPRLPDKFRDDYQSQKKKVQSAIERGVS
AEL086W            SIPANLLADPT------GSRLANGKFKHKQIKAPKMPDKNRDDYQSQLKKVNKAMESGLH
SAKL0C08778g       SGPSNLLSDPA----SGGRRVAGGRFKHKLDKAPKLPDRHRDDYKTQQKKVANALERGIS
KLTH0C08866g       STTAKMLSNPT----AEGQRSIGGRFKHNKVRAPKLPDKHRDDYHVQKKKVEKAVSSGIP
Kwal_56.22804      SSTSKMLSNPT----SNNQRMGGGKFKHNKVKAPKLPDKNRDDYHVQKKKVEKAISSGIR
KNAG0K01110        SIETHLLRDPTGRSNISGNRTASGKYKHKQDKAPKLPDKHRDNYHSQKKKIASAMERGTY
KLLA0F24684g       TIPSNLLADPT----SPSERTVGGKFKHKTQKAPKLPDKHRDDYAFQKKKVEAALERGVR
Suva_4.218         SIPSNLLADPSQGP-GARGGAVRGKFKHKQMKAPKMPDKHRDNYYTQKKKVEKALQSGVN
Skud_4.220         SIPSNLLADPSQGP-GSNGRTARGKFKHKQMKAPKMPDKHRDNYYSQKKKVEKALQSGVN
Smik_4.204         SIPSNLLQDPSQGT-GSNGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVDKALQSGIS
YDL031W            SIPSNLLEDPSQGP-AANGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVEKALQSGIS
NDAI0G02870        TIPSNILANPTNGSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALANGIQ
NCAS0C03530        SIPSNLLSDPTQG--PGAQNSVRGKFKHKQLKAPKLPDKHRDDYQTQKKKVAKALENGVQ
KAFR0C01060        TMQTNLLSNPTENN-SNGQKTVRGKFKHKQMKSPKLPDKFRDDYEKQKKKVASALARGAH
CAGL0K01551g       SIPSNLLVDPTRGPGKSGSKLPNGKFKHKLEKAPRLPDKKRDDYHKQKKKVESALERGIA
                                           .: *:  . *.:**. **:*  *  *   *:  *  

TBLA0B01590        MKGK---RGYKDELKNVAEIRKNRVEKEKRRAKNGRPGRERR-
TDEL0D04630        VKGYNTRGAPKNELQSIAQIRKQRQTSEKKHAKNARPSKKRKY
ZYRO0B04972g       VKGHNNAPGMTNELRSADQIRKQRVVKDKRRAKNARVGKKR--
TPHA0M00330        VKGYNNRNSVKSELKTVAQIRKERMVNENKQKKNARPSKKRKY
Kpol_1032.11       VKGFGGSSG-NTELKTTAQIRKERMAKEKKRQKNARPTKKRKF
AEL086W            VKGY-NAPGMKQELRTTEQIRKQRSMAEKRKAKNARPAKKRKF
SAKL0C08778g       VKGF-GAPGAKSEMKSTEQIRSQRVAKDKRLAKNARPSKKRKF
KLTH0C08866g       VKGY-NAPGMKSEMRSTQQIYKERVAKEKKRAKNARPAKKRKF
Kwal_56.22804      VKGF-NAPGMKSEMRTPQQIYKERVAKEKKRAKNARPAKKRKY
KNAG0K01110        VKGF-NGPGTQSELKSTAQIRKGRLQAEKKKAKNARPNKKRKF
KLLA0F24684g       VKGY-NGPGMKQEIKSVDEIRKLREIKEKKRSKNARPTKRRKH
Suva_4.218         VRGYNNAPGLRSELKSTDQIRKDRAAADKKRAKNARPTKKRKF
Skud_4.220         VKGHNNAPGLSSELKSTEQIRKDRVMAEKKRAKNARPSKKRKF
Smik_4.204         VKGYNNAPGLRNELKSTEQIRKDRNMAEKKRAKNARPSKKRKF
YDL031W            VKGYNNAPGLRSELKSTEQIRKDRIIAEKKRAKNARPSKKRKF
NDAI0G02870        VRGYGNAPGMSNELKSTEQIMKDRNVKENKRAKNARPSKRRKF
NCAS0C03530        VRGF-RGPGMKSELKSTEEIRKQRAFMEKKRAKNARPAKRRKY
KAFR0C01060        VKGY-SGPGMKNELKSTEQIRKERMAKENRRAKNARPSKKRKF
CAGL0K01551g       VKGYNNAPAFKSELKSVAQIRKDRKTKENRHAKNARPSKKRKF
                   :.*     .   *:..  :* . *   ::.  **.*  . *  

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0B01590
-------------MRTTSDIEE--------------SDSEIDIGQNIALNSDSSSDSESD
NSSE-----TEVQDEIEYSDNQEEEVKEDKRTDKENNTKSKND-----------------
-FPQLDGNV--------------EVESDDDDINDYFATTHLD-TKKFKKGSFASFGFNRF
IMNNINKKGYKQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFLLPMIEKLKTHSSKIG
VRGVILSPSREIAIQTHRVFKEFSKNTELRSVLLTGGDSLEDQFGMMMSNPDVVIATPGR
FLHLKVEMKLDLKSVEYIVFDEADRLFEMGFEEQLNELLAALPDNRQSLLFSATLPNSLV
EFAKAGLKNPVLVKLDQESKISDNLEMLFLSCKKEERESNLLFLLQDVIGVPVASTEEMK
RFQT------DSREVEEKEEKEKEKG-------KEKEKRAKYYKSDEIPHEQATIIFVPT
RHHVEYISQLLMKCGYLVSYLYGTLDQHARRNQLRQFCFGITRILVVTDVAARGVDIPLL
PNVINYSLPGSSKIFVHRVGRTARAGNRGWAYSIVSESELPYLVELGTFLGKKVITTGMV
EKL--------------GVSFD--KISYNKWMVLGSGPRVDVESFGDLYKNVYDQEFDLQ
MSKKTCEKAEKLYLRTRGGASNDSVKRSKELILQKWDGQNVKFGQDLERAKLELLNKFAL
RKNKETVFEFGKNGEDEMSTLMNRRWKVVKGIERKAKRRREMKEEEE-GGVEEELQFEEE
LGSGSGPGPGQGPGQDLVDAGNYNGVFEDGDAILNGQTKKR-------------------
---KTFKDERFFLSHYADPKKVENE--EVVDGFINAASEASYDLNNDEKIQVHKQSSATV
KWDRKRKKYVNLQGIDNKKYIIGESGRKIPATFRSGKYEEWAKARNINTRNVMRVGARES
EGSVV----------GGGRGGGGGRFKHKLDKKPKMPDKYRDDYKKQKEKNERAVERGV-
MKGK---RGYKDELKNVAEIRKNRVEKEKRRAKNGRPGRERR-
>TDEL0D04630
-MKVSGKRKL---GDDASLSDG----------SESGSEEDYDIVNDIALNSSDSDEDDSS
EDSE-----GGEQDIIEYSDEEEEHQHEKKKSAPKDKS----------------------
-FPKLEASGD-------------EAEDDADDVNEYFSTTAQT-NKKHKKGSFPSFGLSKL
ILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSKVG
ARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPGR
FLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNSLV
DFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATEEQIK
LIKD-KS---PDSDEESDDDNGKRSHNKHKK---EKFKKVRMPAANQLPSEKSTILFVPT
RHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPML
ANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISESELPYLLDLELFLGKKILTTPMY
EAATDLLEKRWVEEGKEKILFKAPKPSYTNRLVLGSCPRLDIDSMGDLYKNLM-SSFELE
TLRGVAKKAEKLYLRTRTAASVESVKRSRELMTSGWDEQNVMFGKNLEKEKLDFLAKLQD
RTNKETVFEFARNADDETSMLMKKRRFQVAPITEKAKKRKELLELQKAAGFSHAM--EDE
LLNDNEL-----IKESVPEE-VLQ-EFEDADKLLEDQEKLG------------------R
KKSKSFRDPNFFLSHYAPQGGLHENELNLTSGFTTDAAQAACDINGDDKVQVHKQ-NATV
KWDSKKKKYINSQGADNKKYIVGESGQKIPASFRSGKYAEWSKARNLQP---IKVGARES
PTAANMLRNPAQNHPTDGQRTVGGKFKHKQVKAPKLPDKHRDDYHKQKKKVKEALDKGIN
VKGYNTRGAPKNELQSIAQIRKQRQTSEKKHAKNARPSKKRKY
>ZYRO0B04972g
-MGSTLKRKL---EDEESNSEG---------------EEGFDIAGNIALTSSESEGEDGS
DEDS----EENYQDVIDYSDDDKEKEAGKKKKEPVKKSDKHD------------------
-FPILELSDNEEDADAKKK----KEDGDADDISEYFTTNNSE-SKKHKKGSFPSFGFSKF
ILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIG
ARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGR
FLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLV
DFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKM
ILGE-GNKALSDSEDSDAENGKKDRRKKGKK---NKAKRPKLPSANELPSEKATIVFVPT
RHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPML
ANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLELFLGKKILLAPMY
EATCNLLKEKWVNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDSNYDLG
STRGVSIKAEIMYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFLAKLQD
RRNKETVFEFARNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSL--EDE
VLDKYKG---E-VGYSVPDA-VLE-EFEDADQVLEDQETEGK---------------KQK
QKSKSFKDSNFFMSHYAPAQSVQDSQLNISSGFTTDAAQASYDLNDDDKIQVHKQ-TATV
KWDKKKKKYVNPQGADNVRYITSESGQKIPASYRSGKFDEWSKKRKLKM---PKVGSRES
SMATNLLQDPTRGNPSSNNR----RFMHKQVKAPKVPDKYRDDYGKQKTKVAKALEKGIH
VKGHNNAPGMTNELRSADQIRKQRVVKDKRRAKNARVGKKR--
>TPHA0M00330
MSRSVNKRSM---SADSDDSDF--------------EDNGVDIAKSIAFNASGSDSSDDS
DEEDDFKVDDGVQDLIEYSDEETTEKEVKKTKKASNP-----------------------
-FPLLEMSDDEDDKNSKNS----AFNDDADDVNDYFSTNMQD-KSKHKKGSFPSFGLSKL
ILSNINKKGFRQPTPIQRKTIPLILQRRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIG
ARAVILSPSRELAMQTHKVFKDFSRGSQLRSVLLTGGDSLEEQFSMMMSNPDVIVATPGR
FMHLKVEMGLDLKTVEYVVFDEADRLFEMGFQEQLNELLASLPMNRQTLLFSATLPNSLV
DFAKAGLTNPVLVRLDAESKISENLQLAFFSTKNEEREATLLYILQDVIDLQIGTEEEIK
KLTA-SNKRSDEIDSDNEREQADRKLNKKKK--FEKFIKPKLPSANELPSEKATIVFVPT
RHHVEYISNLLKDCGYLVSYLYGTLDQHARKHQLFNFRAGLTSILVVTDVAARGVDIPML
ANVINYSLPASSKIFVHRVGRTARAGNKGWAYSIASETELPYLLDLELFLGKKILLTQMY
EATCSLAKNKWIAAGNEEYTFQPPKPSYTDRMILGSCPRLELENIGDLYKNIMSASFDLQ
MAKKTSLKAEKLYFRTRTAASPESIKRGKELIASGWDEQHIMFGKNVEKEKLDFLSKFQN
RNNKETVFEFGRNPTDATAVLMNRRRRQLAPIQRKAVERRKLLEKERLAGLSHAL--EDE
ILKGEDH---E-SGYTISKE-ALA-AFEDADKLLQEQEKKK-------------------
RKPKTYKDPQFFLSHYAPAKDIQDKQLNLTSGFTNDAAQAAYDLNNDDKVQVHKQ-TANI
KWDKGRKKYVNINGLDNKKYIIGEGGQKIPASFKSGRFDEWSKARHIKP---LKAGVRED
SIPTNLLADVTGP--SDGSRTFGGRFKHKQNKAPRLPDKHRDDYESQKKKVQNALERGVQ
VKGYNNRNSVKSELKTVAQIRKERMVNENKQKKNARPSKKRKY
>Kpol_1032.11
-MGIISKRKR---HVEDSNSSS-------------DDDDGFDITSNIGLNTADSSDESES
SGDD----EEEVQDIVDFSDEEDTKKKPKSSNKTLTDNNS--------------------
-FPSLEISDDEDSNNKG------DHEDDDDDLNDYFSINNSE-KSKHKKGSFPSFGFSKL
ILSNVHKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKSHSSKIG
ARAVILSPSRELALQTHRVFKEFSKGTHLRSVLLTGGDSLEDQFSMMMSNPDVIVATPGR
FLHLKVEMSLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPMNRQTLLFSATLPSSLV
DFAKAGLTNPVLVRLDAETKISENLEILFLSTKNEERENNLLYLLQDVIKIPLGTDDQIK
KLSD-FNKSLSDSDSEDEDNKGKQNSRKSKK---GKFQKLKVSASNELPTEKSTIVFAPT
RHHVEYITQLLKDSGFLVSYLYGTLDQHARKRQLLNFRAGLTSILVVTDVAARGVDIPML
ANVINYSLPASSKIFIHRVGRTARAGNRGWAYSIVSETELPYMLDLELFLGKKILLTSMY
EASCKLMKSKWIADGNTESSFEDPKISYTNRLVLGSAPRYDIESVGDLYKNIIESNFDLQ
MAKKVSLKAEKLYCRTRTAASPESIKRSKEVIASGWDEQNIRFGRNLEKEKLNFLAKFQN
RRNKETVFEFGKNPNDDTAILMQKRRKQIAPIQRKARKRQELLDKERVAGLTHKI--EDE
ILKGEDH---E-AGYSVPEE-ALK-SFEDADKILEEQESSR------------------K
KKSKTFRDPNFFISHYAPAGDIQDKQLQITSGFTNDAAQAAYDLNDDDKVQVHKQ-TATV
KWDKKRKKYVNMQGIDNKKYIIGESGQKIPASFKSGKFAEWSKSRNIKG---IKTGARET
SIPTNLLSDPTTD--SGSQRGPGGRFKHKQNKAPRLPDKFRDDYQSQKKKVQSAIERGVS
VKGFGGSSG-NTELKTTAQIRKERMAKEKKRQKNARPTKKRKF
>AEL086W
-MGLASKRKR---DTEEHSDEG----------------EDFDIAGNIALDSEDSDDSVSD
SDNE-------VQDIIEFSDDEKQNAPQVSKTAKGAKGAKVAAPRSDAA-----------
-FPSLELSDGED-----------ADNGDKDDVDSYFNTTSQLAASKAKKGSFASFGLSKF
ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG
ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGR
FLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLV
DFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQ
RFRK-QS--NDDADDSDDETDKKKKH--------SKKSKQPLPSAKDMPSPNSTIIFVST
RHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLL
ANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTILSESELPYLLDLELFLGKKVLLTPMY
EATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLVESNFELQ
NLKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKLEFLAKLQN
RHNKETVFEFARNHDDEMAILMKRRRRQIAPIQQRAKERQQLLEKERQAGLRHTL--EDE
ILKGEEN---E-VGYSVPQE-LLR-DFEDADELAAKRNTKK-------------------
----GFRDENFYLSHFAPASDIQDKQLQVASSFTNEVSKATFDLHNDDKVQVHKQ-TATV
KWDKKRKKYVNVQGIDNKKYIIGESGQKIPASFRSGKFDEWSKARKLAP---LKVGARES
SIPANLLADPT------GSRLANGKFKHKQIKAPKMPDKNRDDYQSQLKKVNKAMESGLH
VKGY-NAPGMKQELRTTEQIRKQRSMAEKRKAKNARPAKKRKF
>SAKL0C08778g
MGSTSLKRKR---ESNNPSVEE-----------EEEEEDVFDIAGDIALDSSEDDDDDDD
DGEQ--DSEQEVQDVIEFSDGEEQGKKNQSKGAAKSAAKGNSKGAKQPRPS---------
-FPTLELSDAEDE----------APDADKDAVNDYFSTTAAAAAGKHKKGSFPSFGFSKF
ILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIG
VRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGR
FLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLV
DFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLK
QLRALNDRSDSDADSDANDKNDRKKR--------KKQARRKMPSANELPSEKATILFVPT
RHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPML
ANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSENELPYLLDLELFLGKKILLAPMY
DATCELMRKQWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQ
LLKSVALKAEKLYFRTRAPASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQN
RNHKETVFEFARNQEDEMAVLMRRRRRQIAPIQRKARERQELLEKERMAGLRHTL--EDE
VLKGGDG---E-FGYSVPEE-VLAQEFEDADKILDEQENKKKTKTMKTRQGETKPKPKPK
PKPKTYKDPNFFLSHYAPAGDIQDKQLQLTSGFTNDAADATFDLHDDNKVQVHKQ-TATV
KWDKKRKKYVNAQGLDNKKYIIGESGQKIPASFRSGKFAEWSKARKLGP---LKVGARET
SGPSNLLSDPA----SGGRRVAGGRFKHKLDKAPKLPDRHRDDYKTQQKKVANALERGIS
VKGF-GAPGAKSEMKSTEQIRSQRVAKDKRLAKNARPSKKRKF
>KLTH0C08866g
MVKAVAKRSR-----QQSALSD---------------DEDVDIAGNIALDSSDSSSSSDN
DDDGSEDEAGDVQDIIEFSDEDEEEARAKAAPQKKKKNAHEGG-----------------
-FPALELSDNEDHD---------DGKDGADDVTEYFSTNNPE-AAKHKKGSFASFGLSKF
IVSNIAKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKGHSAKIG
ARAVILSPSRELAMQTHKVFREFSRGSDLRSVLLTGGESLEEQFGLMMSNPDVVIATPGR
FLHLKVEMNLDLKSVEYLVFDEADRLFEMGFEEQLSELLAALPVARQTLLFSATLPSSLV
NFAKAGLTNPVLVRLDAETKVSENLEMLFLSSKNEEREANLLYLLQEAMKIPVATEEQLL
EYKA-KVKNSYDSDDSDEDAKAKAKK----Q--RKSAIRKKLPSANELPSEHATIVFVPT
RHHVEYISQLLKDCGYLVSYLYGTLDQHARRQQLFNFRAGLTTILVVTDVAARGVDIPLL
ANVVNYSLPASSKIFVHRVGRTARAGNKGFAYSIVSENELPYLLDLELFLGKKILLTPMF
EATTELLKSKWIAEGNSELTFNPPKVSYTNRMVLGACPRLDLETCGDLFKNLTQSSFDLQ
QLKGVAAKAEKLYFRTRPPASSQSMKRSKEVIASGWDEQNLRFGKNIEKEKLDFLAKLQN
RNNKETVFEFARNQDDEMSLLMKKRRIQIAPIQRRAKERKELLEKERMAGLRHTV--EDE
ILKGDEN---E-VGYSVPEE-VLHREFQDADELLGAQSKSK-------------------
-RPKSFRDPAFFLSHYAPASEIQDKQLEVTNGFTNEAANATFDLHNDDKVQNHKQ-VATT
KWDKKRQKYVNTQGLDNKKYIMGESGHKIPASFRSGKFDEWSKARKLGP---LKVGAKES
STTAKMLSNPT----AEGQRSIGGRFKHNKVRAPKLPDKHRDDYHVQKKKVEKAVSSGIP
VKGY-NAPGMKSEMRSTQQIYKERVAKEKKRAKNARPAKKRKF
>Kwal_56.22804
MTKVTLKRSR----REDPLSDE----------------EDVDIAGNIALDSDESSESEDD
SEDG-EGEEGDVQDIIDFSGDEEETSKNAKKTGKAEKKPSSKQAS---------------
-FPLLELSDDEEEQ---------AANDGEDDVTEYFTTTNAE-ASKHKKGSFASFGLSKF
IISNIAKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIERLKGHSAKIG
ARAVIMSPSRELALQTHKVFREFSRGSDLRSVLLTGGESLEEQFGLMMSNPDVVIATPGR
FLHLKVEMNLDLKSIEYVVFDEADRLFEMGFEEQLNELLAAFPVARQTLLFSATLPSSLV
DFAKAGLTSPVLVRLDTETKVSENLEMLYLSSKNEEREANLLYLLQEAMQIPVATEEQLA
EYRT-KIKDDYDSDDSDSKDKLKAKK----K--KKAMIRRKMPAANELPSEHATIVFVPT
RHHVEYITQLLKDCGYLVSYLYGTLDQHARRQQLFNFRAGLTTILVVTDVAARGVDIPML
ANVVNYSLPASSKIFVHRVGRTARAGNKGSAYSIVSDNELPYLLDLELFLGKKILLTPMY
EATTEMLKSRWIAEGKSELTFNAPKVSYTNRMVLGACPRLELETCGDLFKSLIDSSFDLK
QLKAVANKAEKLYFRTRPPASSQSMKRSKEVLSSGWDEQNLRFGKNMEKEKLDFLAKLQN
RHHKETVFEFARNHDDEMALLMKKRRIQIAPIQRRAKERKELLEKERKAGLVHSV--EDE
ILKGDET---E-VGYSVPEE-VLHQEFEDADELLEGQKKEK-------------------
-KQKSFRDPTYFLSHYAPASEIQDKQLEVSNGFTNEAANATFDLHNDDKVQNHKQ-IATI
KWDKKRQKYVNSQGLDNKKYITGESGHKIPASFRSGKFDEWSKARKLGP---IKVGARES
SSTSKMLSNPT----SNNQRMGGGKFKHNKVKAPKLPDKNRDDYHVQKKKVEKAISSGIR
VKGF-NAPGMKSEMRTPQQIYKERVAKEKKRAKNARPAKKRKY
>KNAG0K01110
-MVSSGKRVRESESYESSDEEGYVSAPGTGSSAEEEDDALVDIAGDIALESSDEEEEEDV
QG--------DIADIIDYSDEEPAEAKGKQQKQKQKPSKKSPKENA--------------
-FPSLELSDDESSKA--------AGDASDDDVNAYFSTNNQAEKQKFKKGSFASFGLSKA
ILSNVTRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKTHSSKIG
VRAIILSPSRELALQTHNVFKDFSKGTHLRSVLLTGGDSLEEQFGMMMSNPDVVIATPGR
FLHLKVEMNLVLKTVEYAVFDEADRLFEMGFQEQLNELLAALPSSRQTLLFSATLPSSLV
EFAKAGLTNPVLVRLDAESKISENLQMLFLSIKNDEREANLLYLLQNVIKIPLATPEQLK
KLRD-SDAKFSESESEDESNEKRGGKRDFKKNGKKKFVKQRLPAANELPSENATVVFVPT
RHHVEYISQVLKDCGYLVSYIYGSLDQNARKSQLYNFRLGLTSILVVTDVAARGVDIPML
ANVINYSLPSSSKIFIHRVGRTARAGNKGWAYTIVSESELPYLLDLELFLSKKVLLTPML
EAKNAILKQKWIDQGNDEMSFKPPAVSYTDRIVLGSCPRLDLESMGDLFKNILENNFDLS
LMKATSLKAEKLYFRTRTHASLESLKRSKEVIASGWDEQNIIFGSNVEKEKINFLAKLQN
RRNKETVFEFSRNPDDEMSVFMKRRRRQLAPVQKKAKERRELLEKERRSGLSHSI--EDE
IFNQNNNTEME-TGYTVSEE-ALK-QFEDADELLQKQSEKK-------------------
TKPKNYKDPNFFLSHYAPAADIQDKQLQVTSGFTNDAAQAAYDLNDDDKVQVHKQ-TATV
KWDKKRKKYVNMQGIDNKKYIIGESGQKIAASFRSGKFDEWSKARHIKP---LKVGAKED
SIETHLLRDPTGRSNISGNRTASGKYKHKQDKAPKLPDKHRDNYHSQKKKIASAMERGTY
VKGF-NGPGTQSELKSTAQIRKGRLQAEKKKAKNARPNKKRKF
>KLLA0F24684g
-MVDSSKRAL---PAEDYSSED---------------EDAFDIAGDIALNADSEDSDISD
DDNDNIGFQAEVQDVIEFSSDEEEKEKKPKKQNKKAKVKAGPIVDSK-------------
-FPSLELSDDEKK----------ATNESDDDLNDYFNTTADA-AAKHKKGSFASFGLSKL
VLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIG
VRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGR
FLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLV
DFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIK
KLKQ-QN--DADSDSDDSEDEKKKKA----K--KAKKSKRRLPNANEMPSEKATIVFVPT
RHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLL
ANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSENELPYLLDLELFLGKKILLTPMY
ESSCQILRKKAESEGNN--NFTDPKVSYTTRMVLGACPRSEIDGMGDLYSNMIKSDFELN
TVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAEKEKLDFLAKLQH
RNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEKERMIGLRHSI--EDE
ILKGEDN---E-VGYSVPDE-VLK-EFEDADVLLEEQENIK------------------K
KQKKTFRDPTFYLSHFAPTSDIQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQ-TATV
KWDKKRKKYVNTQGLDNKKYIIGESGQKIPASFRSGKFQDWSKARKIAP---LKVGARES
TIPSNLLADPT----SPSERTVGGKFKHKTQKAPKLPDKHRDDYAFQKKKVEAALERGVR
VKGY-NGPGMKQEIKSVDEIRKLREIKEKKRSKNARPTKRRKH
>Suva_4.218
-MAGVQKRKR---DLGDQDGSG-----------SEEEDAAFDIANDIALNASESDSDDSG
SEEEADYGLSGVQDVIEYSSDEEEKGKNKKKTDAKNTKKNKEDNKTKTKTKTKNGKKEAA
AFPTLELSDDENSVPGKN-----QADDDEDDVNEYFSTTNLE-KTKHKKGSFPSFGLSKI
VLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIG
ARAVILSPSRELAMQTFNVFKEFARGTALRSVLLTGGDSLEEQFSMMMSNPDVIIATPGR
FLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTARQTLLFSATLPNSLV
DFVKAGLVNPVLVRLDTETKVSENLEMLFVSTKNDDREANLLYILQEVIKIPLATSEQLQ
KLQK-SN---NEADSESDDDNDRQKKRKNFK--KEKFRKQRMPGGNELPSEKATILFVPT
RHHVEYISQLLRDCGFLISYIYGTLDQHARKRQLYNFRAGLTSILVVTDVAARGVDIPML
ANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAENELPYLLDLELFLGKKILLAPMY
DSLAGLMKKRWVDEGKPEYTFQPPTLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQ
LAKKTALKAEQLYYRTRTAASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQN
RRNKETVFEFTRNPDDEMSVLMKRRRKQLAPIQRKSRERRELLEKERMAGLSHSI--EDE
ILKGNDG---E-TGYTISED-ALK-EFEDADQLLEAQENDSK---------------K-K
KKPKTFKDPSFFLSHYAPAGEIQDKQLEITGGFANDAAHAAYDLNGDDKVQVHKQ-TATV
KWDKKRKKYVNTQGLDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKP---LKVGSRES
SIPSNLLADPSQGP-GARGGAVRGKFKHKQMKAPKMPDKHRDNYYTQKKKVEKALQSGVN
VRGYNNAPGLRSELKSTDQIRKDRAAADKKRAKNARPTKKRKF
>Skud_4.220
-MSGVQKRKR---DLEDQDVSG-----------SEEEDTAFDIANDIALNGSDSDSDGSS
SGTEADYGLGDVQDVIKYSSDEEREGDSKKKANGKNGKKNKSDNKKKSGKKEVAA-----
-FPTLELSDDENDASGKT-----QADDDEDDVNEYFSTTNLE-KTKHKKGSFPSFGLSKV
VLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIG
ARAVILSPSRELAMQTFNVFKDFAKGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGR
FLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPARRQTLLFSATLPNSLV
DFVKAGLVNPVLVRLDTETKVSENLEMLFLSSKNADREANLLYILQEVIKIPLATSEQLQ
KLQK-SN---NEADSDSDDENDRHKKKRNFK--KEKFRKQKMPAANELPSERATILFVPT
RHHVEYISQLLRDCGYLISYIYGTLDQHARKRQLYNFRAGLTSILVVTDVAARGVDIPML
ANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVSENELPYLLDLELFLGKKILLAPMY
DNLVDSIKKRWIDEGNLEFQFQPPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQ
LAMKTSMKAEKLYYRTRTSASPESLKRSKEIIASGWDAQNAFFGKNEEKEKLDFLAKLQN
RRNKETVFEFTRNPDDEMAVLMKRRRKQLAPIQRKASERRKLLEKERMAGLSHSI--ENE
ILKGDDG---E-TGYTVSEE-ALK-EFEDADQLLEAQENDSK---------------K-K
KKPKTFKDPTFFLSHYAPAGEIQDKQLQIASGFANDAAHAAYDLNTDDKVQVHKQ-TATV
KWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKP---LKAGSRES
SIPSNLLADPSQGP-GSNGRTARGKFKHKQMKAPKMPDKHRDNYYSQKKKVEKALQSGVN
VKGHNNAPGLSSELKSTEQIRKDRVMAEKKRAKNARPSKKRKF
>Smik_4.204
-MAGMQKRRR---NLEDQDVIG-----------SEEDDIAFDIANDIALNDSESDSNDSE
NEIEAGYGPSDVQDIIEYSSDDEEEGKKSNKKKKTNDKKPGKNKHNKKEVAA--------
-FPILELSDDENNISGQT-----QAGEEEDDVNEYFSTNNLE-KQKHKKGSFPSFGLSKI
VLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIG
ARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGR
FLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLV
DFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLL
KLQK-ST---NEADSDSDDENDRQKKKINFK--KEKFRKQKMPAANELPSEKATILFVPT
RHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPML
ANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAENELPYLLDLELFLGKKILLTPMY
DSLVDVMKKRWVEEGNSAYNFQLPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQ
LAKKTAMKAEKLYYRTRTSASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQN
RRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSI--EDE
ILKGDDG---E-TGYTVSED-ALK-NFEDADQLLEAQENESK---------------K-K
KKPKTFKDPTFFLSHYAPAGEIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQ-TATV
KWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKP---LKVGSRES
SIPSNLLQDPSQGT-GSNGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVDKALQSGIS
VKGYNNAPGLRNELKSTEQIRKDRNMAEKKRAKNARPSKKRKF
>YDL031W
-MAGVQKRKR---DLEDQDDNG-----------SEEDDIAFDIANEIALNDSESDANDSD
SEVEADYGPNDVQDVIEYSSDEEEGVNNKKKAENKDIKKKKNSKKEIAA-----------
-FPMLEMSDDENNASGKT-----QTGDDEDDVNEYFSTNNLE-KTKHKKGSFPSFGLSKI
VLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIG
ARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFGMMMTNPDVIIATPGR
FLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLV
DFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEIIKIPLATSEQLQ
KLQN-SN---NEADSDSDDENDRQKKRRNFK--KEKFRKQKMPAANELPSEKATILFVPT
RHHVEYISQLLRDCGYLISYIYGTLDQHARKRQLYNFRAGLTSILVVTDVAARGVDIPML
ANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAENELPYLLDLELFLGKKILLTPMY
DSLVDVMKKRWIDEGKPEYQFQPPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMSSNFDLQ
LAKKTAMKAEKLYYRTRTSASPESLKRSKEIISSGWDAQNAFFGKNEEKEKLDFLAKLQN
RRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSI--EDE
ILKGDDG---E-TGYTVSED-ALK-EFEDADQLLEAQENENK---------------K-K
KKPKSFKDPTFFLSHYAPAGDIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQ-TATV
KWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKP---LKVGSRET
SIPSNLLEDPSQGP-AANGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVEKALQSGIS
VKGYNNAPGLRSELKSTEQIRKDRIIAEKKRAKNARPSKKRKF
>NDAI0G02870
-MALKEKRTR---DTAVDSSDS------------ENDAADFDIATDIALNASDSDDASSD
SDNE------DVQDVIDYSDSEHQQEDNKIARKEKQKKQDIDKS----------------
-FPILELSDDEDTKKKSNSKNNGSDNDDDDDINAYFSTTNLE-KSKHKKGSFPSFGLSKI
IVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIG
ARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGR
FLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQTLLFSATLPSSLV
DFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDVIKIPLATKEQQR
KFND-QNKKDNESDSDADDNNNNNKNK---K--KRKFKKERLPPANQLPSEKATILFVPT
RHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPML
ANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSESELPYLLDLELFLGKKIMLTPMY
DSLCEIMKNKWIAEGNDESSFVNPKIAYTDRLILGSAPRLEVEGLGDLYKNMMQNNFELK
LIKDVAMKAEKLYFRTRTSASPESLKRSKEIIASGWDEQNVLFGKNQEKEKLDFLAKLQN
RRNKETVFEFSRNPDDEMSVFMKRRRRQLAPIQRKARERKELLQMEKMAGLTHSV--EDE
ILKGDDN---E-AGYSVSED-TLKQQFQDADELLADQENKSK---------------KDK
KSKKSFKDPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVHKQ-TAMV
KWDKKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKP---LKVGARET
TIPSNILANPTNGSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALANGIQ
VRGYGNAPGMSNELKSTEQIMKDRNVKENKRAKNARPSKRRKF
>NCAS0C03530
-MAPTLKRSRLEDSDAEAASSG-----------DEDQDVGFDIAGDIALNSSESDASESD
DDEE------DVQDVIEYSDDETETKKKNDKKKNNNKTKEDKS-----------------
-FPSLELSDDEADRR--------NNEDEDDDVNAYFSTTNLD-KSKHKKGSFPSFGLSKF
IISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIG
ARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGR
FLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSATLPSSLV
DFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQLA
KFNA-QNIKDNASDSDSDGDDKRQKG----K--RKKFKKERLPPANQLPSEKSTILFVPT
RHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPML
ANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKILMTPMY
DSMSDIMLKKWIAEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNVMKSNFEIQ
LLKGVAMKAEKLYFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKLDFLAKLQN
RRNKETVFEFASNPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLTHTM--EDE
VLKGDNA---EDNSYTISED-TLK-QFEDGDELLAGQENKK-------------------
-KKKTFKDPTFFLSHYAPASDIQDKQLQVANGFANEAAQAAYDLNNDDKVQVHKQ-TATV
KWDKKRKKYVNVQGLDNKKYIIGESGQKIAASFRSGKFDEWTKARKLKP---LKVGARES
SIPSNLLSDPTQG--PGAQNSVRGKFKHKQLKAPKLPDKHRDDYQTQKKKVAKALENGVQ
VRGF-RGPGMKSELKSTEEIRKQRAFMEKKRAKNARPAKRRKY
>KAFR0C01060
-MVALNKRTL---QEHDSDSET-------------ESANEFDIASNIALNSSDSDSDSDV
DEQD-----GEVEDIISYSDDEKSQVEEVPKKSKKEKKVIKD------------------
-FPLLELSDDEDSKK--------QANDNDDDVNSYFSTNNLNTKTKHKKGSFASFGLSKL
ILTNISKRGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFVLPMIEKLKTHSSKIG
ARAIILSPSRELAMQTHNVFKEFSKGSDLRSVLLTGGDSLEDQFGMIMANPDVIIATPGR
FLHLKVEMNLDLKSVEYICFDEADRLFEMGFQEQLNELIYSLPSNRQTLLFSATLPSSLV
DFAKAGLTNPVLVRLDTETKISENLEMLFLSIKNEEREANLLYLLQEEICIPLATEEQIK
KLNN-ESKIDDDSDSEDDEATRRQKR----K--SKNFKKQRLPPANQLPSEKATIIFVPT
RHHVEYISQLLKDCGYLVSYIYGTLDQRARNRQLYNFRLGLTSILVVTDVAARGVDIPML
ANVINFSLPVSSKVFVHRVGRTARAGNRGWAYSIVSENELPYLLDLELFLGKKILLTSMY
DATCDIMKKKWVSEGKSELTFQDPKPSYTNRMVLGSAPRLQVEDLNDLYTGVLSGSFDLK
MMKQTALKAEKLYFRTRTSASPESMKRSKEIILSGWDEQNIRFGKNVEKEKFQFLAKLQN
RHNKETVFEFARNPDDEMSVLMKRRRRQLAPIQRKAEERRELMEKERLAGLTHRI--EDQ
ILKGDDF---E-AGYTVPED-ALK-EFEDADKVLEASNKKS-------------------
-EQKTFRDENFFLSHYAPTSAIQDQQYKLSTGFTNAAAEAAYDLNSDDKVQVHKQ-TATV
KWDKKRKKYVNMQGIDNKKYIVGESGQKIAASFRSGKFEEWSKARKLKP---LKVGARES
TMQTNLLSNPTENN-SNGQKTVRGKFKHKQMKSPKLPDKFRDDYEKQKKKVASALARGAH
VKGY-SGPGMKNELKSTEQIRKERMAKENRRAKNARPSKKRKF
>CAGL0K01551g
-MVKNLKRK----ERDEHESDS---------------DEEIDIAGNLVADGSDSESDDSS
DGSD-----EEVQDVIEYSSDEEEPAKPAKAVKKKVEDKS--------------------
-FPSLELSDDEDEKK--------KVDNDDDDVNAYFSVNTDA-KSKHKKGSFASFGLSKL
ILVNISKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKTHSSKIG
ARAIILSPSRELAMQTHSVFKEFSRGTHLRSVLLTGGDSLEDQFGMMMTNPDVIIATPGR
FLHLKVEMNLDLKSVEYAVFDEADRLFEMGFQEQLNELLAALPSSRQTLLFSATLPTSLV
DFAKAGLVNPVLVRLDAESKISDNLEMLFLSTKNDEREANLLYILQEVIKLPLATPEQIK
QLND-NKADDSDESAEEDEDKKRRKR--------KSFNRKAMPKANELPSEKATVVFVPT
RHHVEYLSNLLKDCGYLVSYIYGALDQHARKSQLYNFRIGLTSILVVTDVAARGVDIPML
ANVVNYSLPASSKIFIHRVGRTARAGNRGWAYSIVSENELPYLLDLELFLGRKILLTPMY
EALERLSKEKWVAEGNDETLFQSPKISYTSRMVLGSCPRLDIEALSELYNNLMKSNFDLD
MAKKTALKAEKLYFRTRTSASPESLKRSKEIISSGWDEQNVLFGKNLEKEKNAFLEKLQN
RRNKETVFEFTRNPEDEMANLMHRRRRAIAPIQRKAKERKELLEKERMAGLTHAL--EDE
ILKGDDA---E-VGYTVTED-TLK-AFEDADTILAEQENAS------------------K
KKKKTFRDPNFFLSHYAPANEIQDKQLELSGGFINEAAQSAYDLNSDDKVQVHKQ-TATV
KWDKKRKKYVNMNGIDNKKYIIGESGQKIAASFRSGKFDEWSKARKLAP---LKTGANES
SIPSNLLVDPTRGPGKSGSKLPNGKFKHKLEKAPRLPDKKRDDYHKQKKKVESALERGIA
VKGYNNAPAFKSELKSVAQIRKDRKTKENRHAKNARPSKKRKF