MUSCLE (3.8) multiple sequence alignment

AGR405C         -----------MTKDLLGYW--------------------ESLVPPQPPPVWNYTATEVI
Ecym_1011       MLQFLKRFNILKNSATVSFLLLPALAIAGNRSVHNQERNMSSLLSPKLAPSWDFAADEIV
                            ..  :.:                     .**:.*: .* *:::* *::

AGR405C         DLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDLLWNQLIFLRNVSPDPKVR
Ecym_1011       SLAQKAIDEGTKFYDSVASLETP-DLENFVVAVIDHEDETDGYMSQLTFLQHVSADKEVR
                .**    ::.  .*:** * :    *:*:: .:: :::***   .** **.:**.* :**

AGR405C         EASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFKVTNYELYKYMEKDASYYNR
Ecym_1011       DASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDENLKKNDPELYWYMENVNKDYIH
                :**:.: *::::*  : **.****::*.::* ******::* .: ***.***:  . * .

AGR405C         NKRNLTNAESIELGQVTRKISVDTLQFSINLGEETEYITFTEEELEGVSPLVLDQFERII
Ecym_1011       AGMGLPEESRNKIKEIKKKLANNSLAFSNNLGEQNDYIAFTKDELVGVSETTLGQFEKVI
                   .*.: .  :: ::..*:: ::* ** ****:.:**:**::** ***  .*.***.:*

AGR405C         EGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRVAANEQLLFETLDLRRRMAQL
Ecym_1011       EDGVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNELAEI
                *.**:* *:******* ***.**.*****..**:.***.*. ***:*:***.**. :*::

AGR405C         RGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDREILKSKKAEDYKSKNLTFD
Ecym_1011       HGHPTYASYQLEMKMAKKQETVFNFLYDLKDKLLPGGKKDLENLKSLKEQEYKELGLPYN
                .*: .**.*:*  ****::***: ** ** :.*** *:** * *** * ::**. .*.::

AGR405C         GEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEGMLDTYQTLFRLKFVEVTDPSQ
Ecym_1011       GSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECG
                *.: :**  **::* *:*::::* *::*:***:: .*:***: **.**.***** *  . 

AGR405C         KNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKYSHAANFGMASAFRKKDGSQSY
Ecym_1011       KNVWHEDVKQFAVWDLDKCN-PEFVGWIYFDLHPREGKYGHAANFGLYSPYVTEEGTRHY
                **************::*. : *** *******:**:***.******: *.: .::*:. *

AGR405C         PVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHLVANNKLAAHNSLGSVPWDFVE
Ecym_1011       PVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVE
                ********::**:.**.*:*. **:.*:********* **.:..:.  *. .*:******

AGR405C         APSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNSSGLGSGLYYLGQLRLGLFDM
Ecym_1011       APSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDM
                *******:*. ..* :  *********:** .*:*: :::. :.:**  * **.:.****

AGR405C         YVHT-REYHGLEVRKLWNDMRREISLINSQNYTSTGYNTFGHIMTGSYSAGYYGYLWSQV
Ecym_1011       TVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMSG-YSAGYYGYMWSEV
                 *** .*   *::..***::* *::**.. :  :.**::*.***:* ********:**:*

AGR405C         FAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMNDNLRKFLGREPNNRAFLRGLGFN
Ecym_1011       FAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKAFLKELGL-
                ******:* * .**::::** .*** *** *** *::*.* :********.***. **: 

AGR405C         ATSLSRLLQVESAESVLLPRSDLRELFTI
Ecym_1011       -----------------------------
                                             

FASTA FORMAT for MUSCLE Version 3.6

>AGR405C
-----------MTKDLLGYW--------------------ESLVPPQPPPVWNYTATEVI
DLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDLLWNQLIFLRNVSPDPKVR
EASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFKVTNYELYKYMEKDASYYNR
NKRNLTNAESIELGQVTRKISVDTLQFSINLGEETEYITFTEEELEGVSPLVLDQFERII
EGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRVAANEQLLFETLDLRRRMAQL
RGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDREILKSKKAEDYKSKNLTFD
GEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEGMLDTYQTLFRLKFVEVTDPSQ
KNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKYSHAANFGMASAFRKKDGSQSY
PVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHLVANNKLAAHNSLGSVPWDFVE
APSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNSSGLGSGLYYLGQLRLGLFDM
YVHT-REYHGLEVRKLWNDMRREISLINSQNYTSTGYNTFGHIMTGSYSAGYYGYLWSQV
FAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMNDNLRKFLGREPNNRAFLRGLGFN
ATSLSRLLQVESAESVLLPRSDLRELFTI
>Ecym_1011
MLQFLKRFNILKNSATVSFLLLPALAIAGNRSVHNQERNMSSLLSPKLAPSWDFAADEIV
SLAQKAIDEGTKFYDSVASLETP-DLENFVVAVIDHEDETDGYMSQLTFLQHVSADKEVR
DASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDENLKKNDPELYWYMENVNKDYIH
AGMGLPEESRNKIKEIKKKLANNSLAFSNNLGEQNDYIAFTKDELVGVSETTLGQFEKVI
EDGVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNELAEI
HGHPTYASYQLEMKMAKKQETVFNFLYDLKDKLLPGGKKDLENLKSLKEQEYKELGLPYN
GSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECG
KNVWHEDVKQFAVWDLDKCN-PEFVGWIYFDLHPREGKYGHAANFGLYSPYVTEEGTRHY
PVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVE
APSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDM
TVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIMSG-YSAGYYGYMWSEV
FAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKAFLKELGL-
-----------------------------