MUSCLE (3.8) multiple sequence alignment

KLLA0C00528g             ---MAKKQDNARSRKNGNSSFNHSDNKISKKHSMKNNMKSNKKKNQMQVRQLD-K--LDL
KNAG0C00240              --MAGSKTVLGRKSKRNDTKRVQ---KHKKRGSPKTIPLSERKRNKLQVEKLN-RPTNGM
AFR743CA                 --MAAFQHRAKRSKNGASAKQGK-------------ISKADKKRAKLQVEKLD-K--RGV
TDEL0C06950              ---MAVKNNFKKTGKGVQKNQKNCK---------KAISRRDVKKTKFRVENLN-R--DTA
KLTH0F00528g             ---MARKGSGKKPRSTRDVSKGV-------------IRKHQKIRTKLKVEQAN-K--ESF
Kwal_YGOB_YCL058W-A      ----MGLKGPSKKLPTSKPRGSK-----------NVIKKHQKIRTKLKVEQAN-K--EVF
TBLA0A04950              MAKTTVRSKLKKSGKTPSRKLGKVKA--------NKISVGDKKRAKLQVEKMN-K--QDS
ZYRO0F18436g             ---MMVKPTKNQKAVRSKHNNGFKKPK-------KSISHSDKKRTKSKVEKLD-A--KGL
SAKL0C00506g             ---MAKPLSKTKKDNGSKKPSGG-------------IKKSQKKRTRIQVEQLN-K--QEF
TPHA0E03990              --MAKGKSNNIKKSFRNNGKNVKDRKNIKGK-----LSSQVRKSTKHKVEKLN-K--LEV
CAGL0B00374g             ----MSKKQSTKTSKTSKTFSSRSKSSVPKKTGVNKISASERKKSKILTARLNKD--ADV
NCAS0B09090              --MARSHSTKTKAATNNRNKTGKNQVKKNK----NSISFSDRKKAKHQVEKLNKK--ENL
NDAI0A00160              --MAARSNSLHRRRLPTGRKIRKPKNHTNKN---NVIKQSDRKKNKIKVAMFN-K--ESS
Suva_3.154               ----MGKSSMRKKTQGKNGGVGKKQQKK------RPISTAEMKRTKLQVERLN-KSSETM
Skud_3.5                 ----MGKSSLRMKTQGKNGGVGKKVQKK------RPISTAERKRTKLQVEKLN-KSSEIM
Smik_3.16                ----MGKNSMRRKSVGKNVGVGKKVQKR------RSISTAVKKRTKLQVEKLN-KSSEMM
YCL058W-A                ----MGKCSMKKKGVGKNVGVGKKVQKK------RSISTAERKRTKLQVEKLN-KSSETM
Kpol_2002.10             ----MAKSSVSMRKKGNVGKKSKRK---------NVISQSEKKRNKIKMEKIN-K--EGI
KAFR0D00160              ----MGKSKTARQAGGNRIKKIK-----SRK---NVISQSERKKNKLIVEKFN-Q--QTI
                                                                      .      :       

KLLA0C00528g             SIADIVPNKAQKK---------PRSSA-SLEGQKVREHYKEDKEVVKKHDKEKKATEKKI
KNAG0C00240              IEGNAVDIRNEIDKHNQEVEGQNRTVHRSLDVEKLAQDKSKDRIIQEQVAKKQKETDQSM
AFR743CA                 LLAELTAAAPAAK------------TG-VLQAASLAQDQRSDAQAQQQRAQERSNVDKKV
TDEL0C06950              SLSEIIKLNASTA-----VKGSARKAN-TLENRTLQKDWQKDQKIREKSKAEKEEMANNL
KLTH0F00528g             LISELNEREHNTK--------RTPALE-SLKVSDLIEDREKDKSMQKKMEEQKQSTDNNI
Kwal_YGOB_YCL058W-A      LISELNKREDTKR--------QSSPLE-SLKPSRLVKDIKKDQNAQKQLESQRKATDENV
TBLA0A04950              LLSDIINLNGKSK-------ELAKNVN-TLSSKQLKKDQEKDRLLNVEIKNKKKQTNDDL
ZYRO0F18436g             LPSEIFKLNRSAS-------SKTSNGSSSLLARNLEQDRKMDQDTRDKANAKKKETDNNI
SAKL0C00506g             LLSDLNMTNAGST--------KTKEKPKTLQAKALAQDQKKDKETRDKLEKQRKDTNDNM
TPHA0E03990              ISSDDINALNALN-----GKKREKQTS-VLEAKTLAKDNLKDRQLIEKIESKKKETNASL
CAGL0B00374g             AELKIIQELNDNK-----IAEEPKKRQTALDMNCLVKDQKRDKKVREHIEKINSETNSDM
NCAS0B09090              LPMNVLDLQKKKN-----LSKKPEPLKSILHARSLLQDQKKDKEIRNKIRAEQKATDDSI
NDAI0A00160              LHMNVSELNSQSMSPIKQKQDSLRKGS-SLSAHDLLNDQKKDIEANNRIQTEKKQVNDDM
Suva_3.154               IPTLLKEASKQDL--------DKKKTRSTLEAEELVKDQARDSKVREHIETEKSKTNDSM
Skud_3.5                 IPTLLRETATQEP--------TKKRAKSTLKAEELVKDQAKDCKVREQIQTEKSKTNDSM
Smik_3.16                IPTLLRETGAQEP--------AKRKTESTLKAGDLIKDQEKDSKVREHIQMEKSKTNDNM
YCL058W-A                IPTLLREASTQEP--------AKLKAETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSM
Kpol_2002.10             LPSDILQLNNETR-----NGQSEGNKERALESQKLQQDNVKDRETIAKIEASKKETDDSM
KAFR0D00160              --TNVQELNKDLK---KDKRRLSKTKN-ALETKKLLHDQARDHEVKQNIETKLKETEDSM
                                                      *    :      *           .    .:

KLLA0C00528g             EDQLELISGFSL
KNAG0C00240              LAQIEMISGFSL
AFR743CA                 VQQLEAIAGFSL
TDEL0C06950              EKQIEDISGFSL
KLTH0F00528g             IEQLELISGFSL
Kwal_YGOB_YCL058W-A      LRQLELISGFSL
TBLA0A04950              IAQIEMISGFSL
ZYRO0F18436g             LQQIEMISGFSL
SAKL0C00506g             LAQLEMISGFSL
TPHA0E03990              LQQIEMMSGFSL
CAGL0B00374g             LKQLELMSGFSL
NCAS0B09090              EKQIEMISGFTF
NDAI0A00160              LRQIEMISGFKF
Suva_3.154               LKQIEMISGFSL
Skud_3.5                 LEQIEMISGFSL
Smik_3.16                LKQIEMISGFSL
YCL058W-A                LKQIEMISGFSL
Kpol_2002.10             LKQIELMTGFSL
KAFR0D00160              LKQIEMISGFSL
                           *:* ::**.:

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0C00528g
---MAKKQDNARSRKNGNSSFNHSDNKISKKHSMKNNMKSNKKKNQMQVRQLD-K--LDL
SIADIVPNKAQKK---------PRSSA-SLEGQKVREHYKEDKEVVKKHDKEKKATEKKI
EDQLELISGFSL
>KNAG0C00240
--MAGSKTVLGRKSKRNDTKRVQ---KHKKRGSPKTIPLSERKRNKLQVEKLN-RPTNGM
IEGNAVDIRNEIDKHNQEVEGQNRTVHRSLDVEKLAQDKSKDRIIQEQVAKKQKETDQSM
LAQIEMISGFSL
>AFR743CA
--MAAFQHRAKRSKNGASAKQGK-------------ISKADKKRAKLQVEKLD-K--RGV
LLAELTAAAPAAK------------TG-VLQAASLAQDQRSDAQAQQQRAQERSNVDKKV
VQQLEAIAGFSL
>TDEL0C06950
---MAVKNNFKKTGKGVQKNQKNCK---------KAISRRDVKKTKFRVENLN-R--DTA
SLSEIIKLNASTA-----VKGSARKAN-TLENRTLQKDWQKDQKIREKSKAEKEEMANNL
EKQIEDISGFSL
>KLTH0F00528g
---MARKGSGKKPRSTRDVSKGV-------------IRKHQKIRTKLKVEQAN-K--ESF
LISELNEREHNTK--------RTPALE-SLKVSDLIEDREKDKSMQKKMEEQKQSTDNNI
IEQLELISGFSL
>Kwal_YGOB_YCL058W-A
----MGLKGPSKKLPTSKPRGSK-----------NVIKKHQKIRTKLKVEQAN-K--EVF
LISELNKREDTKR--------QSSPLE-SLKPSRLVKDIKKDQNAQKQLESQRKATDENV
LRQLELISGFSL
>TBLA0A04950
MAKTTVRSKLKKSGKTPSRKLGKVKA--------NKISVGDKKRAKLQVEKMN-K--QDS
LLSDIINLNGKSK-------ELAKNVN-TLSSKQLKKDQEKDRLLNVEIKNKKKQTNDDL
IAQIEMISGFSL
>ZYRO0F18436g
---MMVKPTKNQKAVRSKHNNGFKKPK-------KSISHSDKKRTKSKVEKLD-A--KGL
LPSEIFKLNRSAS-------SKTSNGSSSLLARNLEQDRKMDQDTRDKANAKKKETDNNI
LQQIEMISGFSL
>SAKL0C00506g
---MAKPLSKTKKDNGSKKPSGG-------------IKKSQKKRTRIQVEQLN-K--QEF
LLSDLNMTNAGST--------KTKEKPKTLQAKALAQDQKKDKETRDKLEKQRKDTNDNM
LAQLEMISGFSL
>TPHA0E03990
--MAKGKSNNIKKSFRNNGKNVKDRKNIKGK-----LSSQVRKSTKHKVEKLN-K--LEV
ISSDDINALNALN-----GKKREKQTS-VLEAKTLAKDNLKDRQLIEKIESKKKETNASL
LQQIEMMSGFSL
>CAGL0B00374g
----MSKKQSTKTSKTSKTFSSRSKSSVPKKTGVNKISASERKKSKILTARLNKD--ADV
AELKIIQELNDNK-----IAEEPKKRQTALDMNCLVKDQKRDKKVREHIEKINSETNSDM
LKQLELMSGFSL
>NCAS0B09090
--MARSHSTKTKAATNNRNKTGKNQVKKNK----NSISFSDRKKAKHQVEKLNKK--ENL
LPMNVLDLQKKKN-----LSKKPEPLKSILHARSLLQDQKKDKEIRNKIRAEQKATDDSI
EKQIEMISGFTF
>NDAI0A00160
--MAARSNSLHRRRLPTGRKIRKPKNHTNKN---NVIKQSDRKKNKIKVAMFN-K--ESS
LHMNVSELNSQSMSPIKQKQDSLRKGS-SLSAHDLLNDQKKDIEANNRIQTEKKQVNDDM
LRQIEMISGFKF
>Suva_3.154
----MGKSSMRKKTQGKNGGVGKKQQKK------RPISTAEMKRTKLQVERLN-KSSETM
IPTLLKEASKQDL--------DKKKTRSTLEAEELVKDQARDSKVREHIETEKSKTNDSM
LKQIEMISGFSL
>Skud_3.5
----MGKSSLRMKTQGKNGGVGKKVQKK------RPISTAERKRTKLQVEKLN-KSSEIM
IPTLLRETATQEP--------TKKRAKSTLKAEELVKDQAKDCKVREQIQTEKSKTNDSM
LEQIEMISGFSL
>Smik_3.16
----MGKNSMRRKSVGKNVGVGKKVQKR------RSISTAVKKRTKLQVEKLN-KSSEMM
IPTLLRETGAQEP--------AKRKTESTLKAGDLIKDQEKDSKVREHIQMEKSKTNDNM
LKQIEMISGFSL
>YCL058W-A
----MGKCSMKKKGVGKNVGVGKKVQKK------RSISTAERKRTKLQVEKLN-KSSETM
IPTLLREASTQEP--------AKLKAETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSM
LKQIEMISGFSL
>Kpol_2002.10
----MAKSSVSMRKKGNVGKKSKRK---------NVISQSEKKRNKIKMEKIN-K--EGI
LPSDILQLNNETR-----NGQSEGNKERALESQKLQQDNVKDRETIAKIEASKKETDDSM
LKQIELMTGFSL
>KAFR0D00160
----MGKSKTARQAGGNRIKKIK-----SRK---NVISQSERKKNKLIVEKFN-Q--QTI
--TNVQELNKDLK---KDKRRLSKTKN-ALETKKLLHDQARDHEVKQNIETKLKETEDSM
LKQIEMISGFSL