MUSCLE (3.8) multiple sequence alignment

SAKL0B05434g       MGYIQFDKVNIPQDNLVSLGLLNKQLQKLKDEREQALQVENDNDKSSSVSGQGISSTNFN
KLTH0H15048g       MGYIQFDKVDVPEDNVVSLGLLSRQLQKQQ--LGQLGELAGLGDEYASEYASGFG-----
Kwal_34.15946      MGYIQFDRVDVPEDNVVSLGLLNKQLERQRGSVEMG-EIGAEMGVTCD------------
AFR531W            MGYIQFHGVYLPEDNVVSLGVLSKHLQRQQ-------EFTGQPGRQHNLQIGGQG-----
Ecym_1475          MGYIQFHPVGVPQGNVVSLGLLNEQLQRQRAILPDT-DLSNEISQVNSSSTGYYNAAQTN
                   ******  * :*:.*:****:*. :*:. .       :.    .   .            

SAKL0B05434g       LGSLDEFLQDEKFGFLLQGVSPSKEHGIEETNNSPGHTTDLEKNDTDASEFWNLFMSGQT
KLTH0H15048g       ----------REYGGEYSGEYGHEYRG--EYARKSVHTT-LSATSASIAQTWHALLGFDH
Kwal_34.15946      -----------------------------EIDSKPVHTR-LCATSASIAQMWESLLGFEH
AFR531W            -----------------------------------------KDEEANMAQLWDVLMGNDG
Ecym_1475          NSNNSVAVKNYNDYNDYNYRENYNYNDNSQYACRTDNTSIVQKNELTTTQLWDFLMTADN
                                                               .   :: *  ::  : 

SAKL0B05434g       D------SVSSSILTSSLSNQ--SSIFEP-SLDEEICG-LRFNTMTTTNLSSP------P
KLTH0H15048g       Y--------------DSASD------GKP-SLDEETCG-VRFDTVPAA-----IAAASMA
Kwal_34.15946      Y--------------SEVPNA-----GQP-SLDEETCG-LRFDTVPSVE--SFCTDADLA
AFR531W            L---PAGAEVQPLRAAEVPTL--RCSPEPSSLEEDMQGQFQYKDLISVHL-SPCTQDEQA
Ecym_1475          LSLRSAGEDSQSLAAEEPPAALGSSCAEPSSLDEEICSGFSFKLPGSSSLVSPVNFDDIS
                                   . .        :* **:*:  . . :.   :            .

SAKL0B05434g       STLSSNTSTLSLEDRKLI--PTSLSETPCRTVGTSSTSYKVHKKKHMTRSIRQELIALSP
KLTH0H15048g       SSSSSSC-----------------TERSALVPASPASSTECGS------------AGAKP
Kwal_34.15946      ASASSTCSYSVVDDLDHVHQPGNGTRPPACLETQPSSFGDTPS------------AINTP
AFR531W            SGDSSDAPQI--------------SETPVDVAVEA--------------------PAQSP
Ecym_1475          STDSGDSVQIL--DISLEDQNYSSNITPSSFASNSATHENYHR------------IVCHP
                   :  *.                   .  .      .                        *

SAKL0B05434g       EL--GAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRK
KLTH0H15048g       AALSGAAMQQPFQCAFCPSSFKVKGYLTRHMKKHLVTKDFQCPFWSEDCRCHASGEFSRK
Kwal_34.15946      AA-AAAASTAMFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRK
AFR531W            TF---ARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRK
Ecym_1475          PT---TESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRK
                        :     :.*..***.***.******:***:  * :.**:** **.**.:******

SAKL0B05434g       DTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLFEVK
KLTH0H15048g       DTYKTHLKSVHFVYPVGVAKSQRGQSKGRCAACYHEFASNAEWLLRHVETRQCEALVKLK
Kwal_34.15946      DTYKTHLKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGLHK--
AFR531W            DTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRCTE-FKLR
Ecym_1475          DTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKD-FKIK
                   **:.*****:*******..*:**  * ******:  * .*  **  *:::  *    :  

SAKL0B05434g       NEEQ--------
KLTH0H15048g       HEGAARAQDFGR
Kwal_34.15946      ------------
AFR531W            QDEKTHVYGTF-
Ecym_1475          LEAHKSNL----
                               

FASTA FORMAT for MUSCLE Version 3.6

>SAKL0B05434g
MGYIQFDKVNIPQDNLVSLGLLNKQLQKLKDEREQALQVENDNDKSSSVSGQGISSTNFN
LGSLDEFLQDEKFGFLLQGVSPSKEHGIEETNNSPGHTTDLEKNDTDASEFWNLFMSGQT
D------SVSSSILTSSLSNQ--SSIFEP-SLDEEICG-LRFNTMTTTNLSSP------P
STLSSNTSTLSLEDRKLI--PTSLSETPCRTVGTSSTSYKVHKKKHMTRSIRQELIALSP
EL--GAVHREIFQCPHCPSNFKVKGYLTRHLKKHLPNKDYHCPYWSPDCKCHTTGEFSRK
DTFKTHLKSIHFVYPVGVVKSQRSYSKGRCAACFQEFESNVVWLNEHIETGICRGLFEVK
NEEQ--------
>KLTH0H15048g
MGYIQFDKVDVPEDNVVSLGLLSRQLQKQQ--LGQLGELAGLGDEYASEYASGFG-----
----------REYGGEYSGEYGHEYRG--EYARKSVHTT-LSATSASIAQTWHALLGFDH
Y--------------DSASD------GKP-SLDEETCG-VRFDTVPAA-----IAAASMA
SSSSSSC-----------------TERSALVPASPASSTECGS------------AGAKP
AALSGAAMQQPFQCAFCPSSFKVKGYLTRHMKKHLVTKDFQCPFWSEDCRCHASGEFSRK
DTYKTHLKSVHFVYPVGVAKSQRGQSKGRCAACYHEFASNAEWLLRHVETRQCEALVKLK
HEGAARAQDFGR
>Kwal_34.15946
MGYIQFDRVDVPEDNVVSLGLLNKQLERQRGSVEMG-EIGAEMGVTCD------------
-----------------------------EIDSKPVHTR-LCATSASIAQMWESLLGFEH
Y--------------SEVPNA-----GQP-SLDEETCG-LRFDTVPSVE--SFCTDADLA
ASASSTCSYSVVDDLDHVHQPGNGTRPPACLETQPSSFGDTPS------------AINTP
AA-AAAASTAMFQCAFCPSNFKVKGYLTRHMKKHLVTKDFRCPFWSVDCRCHASGEFSRK
DTYKTHLKSIHFVYPVGVAKSQRSRSTGRCAACYQEFRNNNEWLTQHVESRSCSGLHK--
------------
>AFR531W
MGYIQFHGVYLPEDNVVSLGVLSKHLQRQQ-------EFTGQPGRQHNLQIGGQG-----
-----------------------------------------KDEEANMAQLWDVLMGNDG
L---PAGAEVQPLRAAEVPTL--RCSPEPSSLEEDMQGQFQYKDLISVHL-SPCTQDEQA
SGDSSDAPQI--------------SETPVDVAVEA--------------------PAQSP
TF---ARDSAVYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRK
DTFRTHLKSIHFVYPVGTTKAQRNNSVGRCAACYEQFNNNKDWLKYHIDAGRCTE-FKLR
QDEKTHVYGTF-
>Ecym_1475
MGYIQFHPVGVPQGNVVSLGLLNEQLQRQRAILPDT-DLSNEISQVNSSSTGYYNAAQTN
NSNNSVAVKNYNDYNDYNYRENYNYNDNSQYACRTDNTSIVQKNELTTTQLWDFLMTADN
LSLRSAGEDSQSLAAEEPPAALGSSCAEPSSLDEEICSGFSFKLPGSSSLVSPVNFDDIS
STDSGDSVQIL--DISLEDQNYSSNITPSSFASNSATHENYHR------------IVCHP
PT---TESTTIYKCPYCPSSFKVRGYLTRHLKKHMPNKAFRCPYWSEDCRCHPSGEFSRK
DTFRTHLKSIHFVYPVGTTKAQRANSAGRCAACYEHFNSNKDWLKYHIDADNCKD-FKIK
LEAHKSNL----