MUSCLE (3.8) multiple sequence alignment

AFR291C         ---------MAQREVR--RGAVL-----RQE------------GRRPLRVMARAAAPLAT
Ecym_4014       MHGHRNIKQDTQRQARSRRSGVLVVVPPRTESGCSSPAGVAPAGRRPLHAMLTSSSSRKV
                          :**:.*  *..**     * *            *****..*  :::.  .

AFR291C         GRWLCEVVPAAVAVRAVRAAPATAAMQALV--CAGRRTSPGQSS----------------
Ecym_4014       PQNTSSCTMTSIMHRATGSTSSSSGTAAALDRYTKRRRRLGSESDGTLSTLLFPSGNRQQ
                 .. .. . :::  **. ::.:::.  * :   : **   *..*                

AFR291C         ----QAVRMGGR-GADMPERIQSALGRFATECKVRRSRSRLGMERDGP------------
Ecym_4014       LAGVQTLRSALRPSAEVAPRLQSALFRFATESKVRRHRGGAAEPSEEALTAAASAATGAL
                    *::* . * .*::. *:**** *****.**** *.  .   : .            

AFR291C         -----TGPQVVVAICPV-------------------------GA----------------
Ecym_4014       GDSRVNGMQQVVSVRPIFDPQGCAGRSARCGGPLDDIMGAGHGAECQEGVPRAEQRQPGQ
                     .* * **:: *:                         **                

AFR291C         ------------RLVALHTAMGTIVVVAGG--PGGGWQLGDRICTDGPLTFALYTGVYWS
Ecym_4014       QGRFPGQDPPRRRFYWLQVASGETVIIDGTLQREDAVRAGSTIYVDGSVTFQLYDKVYWC
                            *:  *:.* *  *:: *     .. . *. * .**.:** **  ***.

AFR291C         VGWRAEREASV--------
Ecym_4014       LRWSTKKDGEEEEEQQQQQ
                : * ::.:..         

FASTA FORMAT for MUSCLE Version 3.6

>AFR291C
---------MAQREVR--RGAVL-----RQE------------GRRPLRVMARAAAPLAT
GRWLCEVVPAAVAVRAVRAAPATAAMQALV--CAGRRTSPGQSS----------------
----QAVRMGGR-GADMPERIQSALGRFATECKVRRSRSRLGMERDGP------------
-----TGPQVVVAICPV-------------------------GA----------------
------------RLVALHTAMGTIVVVAGG--PGGGWQLGDRICTDGPLTFALYTGVYWS
VGWRAEREASV--------
>Ecym_4014
MHGHRNIKQDTQRQARSRRSGVLVVVPPRTESGCSSPAGVAPAGRRPLHAMLTSSSSRKV
PQNTSSCTMTSIMHRATGSTSSSSGTAAALDRYTKRRRRLGSESDGTLSTLLFPSGNRQQ
LAGVQTLRSALRPSAEVAPRLQSALFRFATESKVRRHRGGAAEPSEEALTAAASAATGAL
GDSRVNGMQQVVSVRPIFDPQGCAGRSARCGGPLDDIMGAGHGAECQEGVPRAEQRQPGQ
QGRFPGQDPPRRRFYWLQVASGETVIIDGTLQREDAVRAGSTIYVDGSVTFQLYDKVYWC
LRWSTKKDGEEEEEQQQQQ