MUSCLE (3.8) multiple sequence alignment

CAGL0G02535g             MSKNNTRDLSHTF-------------TLTCITFLICTGYIYR---------DLHVPFETA
AFR289W                  ----------MDH-------------TL-----------------------HLHVPFESA
Ecym_4016                --MKQSREQSMDYKLYVSLAALESNKNLVCATSFLKKSLDHRSLTLPSPNRCLEVPFENG
KNAG0C06620              MTTKTARPAALDH-------------TL-----------------------TLNVPFETP
KLLA0A00539g             ---MNKGDTSFEH-------------SL-----------------------HLEIPFESI
ZYRO0B16368g             -------MNHLDH-------------NL-----------------------HLTIPFPND
TPHA0E00200              ----MFKKQSLE---------------------------------------KLNIPFETS
KLTH0E00990g             --MKGTRQSDLAY-------------TL-----------------------YLEVPFKTA
Kwal_YGOB_Anc_5.705      --MKSSRPLNLAY-------------TL-----------------------YLEVPFQND
SAKL0E14982g             --MKNTRQMSLDH-------------HL-----------------------YLEIPLETP
NDAI0E05060              -------MRTLDY-------------TL-----------------------EIRIPFPEE
TBLA0G01030              -MSKRDNNMQMEH-------------TL-----------------------TLNIPFATS
TDEL0B02150              --------MSLNH-------------SL-----------------------KLEIPFQTA
NCAS0A03180              --MKNGREMSLDY-------------VL-----------------------NLEIPFTTS
Suva_11.332              --MKSQREMPLDH-------------TLVERIFKGRPSEVFTNYGMFQNTRELKIPFETE
Smik_11.359              --MSSKREMPLHH-------------TL-----------------------ELKVPFKTE
Skud_11.335              --MTSKREMSLDY-------------TLVEQVFQ-----------------ELQIPFETE
YKR095W-A                --MTSKREKSLDH-------------TL-----------------------ELKIPFETE
Kpol_YGOB_1043.72        --MKTQRTIEMDH-------------TL-----------------------DFEIPFETA
KAFR0H00190              --------MNLDH-------------TL-----------------------KLEIPFEDA
                                                                             : :*:   

CAGL0G02535g             RDALIAQRVLQPDPILRPEDFQVEY----EAKATVLDIHFKAIDDRVLRTYAYQGSMSIF
AFR289W                  RLADIAARALAPDPLLRPEELSVSF----ASDGASLNIKLAAIDARVLRV----ATNSIF
Ecym_4016                KQAEIAREVLHHDPVLRPEDFRVDY----TIQHEKLLVNFNSIDARSLRV----GVSSVI
KNAG0C06620              RQALIASQVLQPDPILKPQDFAVSY----AAQGPCLEARFCGRDARVLRV----GVSSVI
KLLA0A00539g             KQADVARKVLLPDPIMKPEDFQVTY----STQDTKLICDFESVDERILRV----GVNSVI
ZYRO0B16368g             RYSEVAVKVLRPDPILRPEDFQVEY----KSKGNLLEIDFKSVDDRVLRV----GVSSVI
TPHA0E00200              KQASIAAQVLKPDPQLRPEEFKVDY----SSQGSDLVVNFQSVDDRVLRV----GVSNVI
KLTH0E00990g             KQAETAVKVLKPDPILKPQDFHVEY----SSKAHNLCVSFEGVDDRVLRV----GVSSVI
Kwal_YGOB_Anc_5.705      KQAATAVQVLKPDPILKPQDFHVEY----TSSANNLCVLFEGVDDRVLRV----GVSSVI
SAKL0E14982g             SQAIIAMKALKPDPVLKPEDFQVEY----SAADYKLCVSFKSIDDRVLRV----GVSSVI
NDAI0E05060              RMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDERVLRV----GVSSVL
TBLA0G01030              KQADIACQVLRPDPILRPQDFQVKY----TSKGNELVMEFQSIDDRVLRV----GVSSVI
TDEL0B02150              AQANIAKQVLLPDPILKPQDFQVDY----TTTDNVLVVGFQSIDDRVLRV----GVSSVI
NCAS0A03180              RQAQIAAKVLVPDPILKPQDFQVEY----LSQDNILAVHFRGIDDRVLRV----GVSSVI
Suva_11.332              KQANIATRVLSPDPILKPQDFQADY----SSENNVMLARFRSIDDRVLRV----GVSSVI
Smik_11.359              QQAVIATRVLSPDPILKPQDFQIDY----SSEKNVMLVQFRSIDDRVLRV----GVSSVI
Skud_11.335              GQASIATKVLSPDPILKPQDFQVDY----SSEKNIMLVRFRSIDDRVLRV----GVSSVI
YKR095W-A                RQATIATKVLSPDPILKPQDFQVDY----SSEKNVMLVQFRSIDDRVLRV----GVSSII
Kpol_YGOB_1043.72        RQAEIAVQVLKPDPILKPQDFQVSY----SSNDNLLIMKFKSIDDRVLRV----GVSSVI
KAFR0H00190              KQANIAVDVLKPDPILRPQDFQVSY----KARDNVFVAEFESIDDRVLRV----GVSNVI
                           :  *  .*  ** :.*:::   :          :   : . * * **.    .  .::

CAGL0G02535g             HLLGTDDSEVVSKLRYIGQGRRGLKSSSYQVYHKMLLCTIRYTDHI
AFR289W                  EALKT----VVETADELDF---------------------------
Ecym_4016                ESIKT----VVETMDEFSL---------------------------
KNAG0C06620              DSLKT----IIESLDELDQTGPSSTEASM-----------------
KLLA0A00539g             ESIKT----IVETIDELC----------------------------
ZYRO0B16368g             DSVKT----IVETIDELDYM--------------------------
TPHA0E00200              DSIKT----IIETIDELQDF--------------------------
KLTH0E00990g             ESIKT----IIETIDEFSH---------------------------
Kwal_YGOB_Anc_5.705      ESIKT----IVETIDEFS----------------------------
SAKL0E14982g             ESVKT----IIETMDEFGS---------------------------
NDAI0E05060              DSIKT----ILETMDEL-----------------------------
TBLA0G01030              DSVKT----IIETFDELE----------------------------
TDEL0B02150              DSIKT----IVETIDELGPETKELQSL-------------------
NCAS0A03180              DSIKT----IIETIDELD----------------------------
Suva_11.332              DSIKT----IIETMDELS----------------------------
Smik_11.359              DSIKT----VVEAMDELS----------------------------
Skud_11.335              DSIKT----IVETIDELS----------------------------
YKR095W-A                DSIKT----IVEAMDVLS----------------------------
Kpol_YGOB_1043.72        DSVKT----IIETMDELS----------------------------
KAFR0H00190              DSLKT----IIETMDELS----------------------------
                           : *    ::.    :                             

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0G02535g
MSKNNTRDLSHTF-------------TLTCITFLICTGYIYR---------DLHVPFETA
RDALIAQRVLQPDPILRPEDFQVEY----EAKATVLDIHFKAIDDRVLRTYAYQGSMSIF
HLLGTDDSEVVSKLRYIGQGRRGLKSSSYQVYHKMLLCTIRYTDHI
>AFR289W
----------MDH-------------TL-----------------------HLHVPFESA
RLADIAARALAPDPLLRPEELSVSF----ASDGASLNIKLAAIDARVLRV----ATNSIF
EALKT----VVETADELDF---------------------------
>Ecym_4016
--MKQSREQSMDYKLYVSLAALESNKNLVCATSFLKKSLDHRSLTLPSPNRCLEVPFENG
KQAEIAREVLHHDPVLRPEDFRVDY----TIQHEKLLVNFNSIDARSLRV----GVSSVI
ESIKT----VVETMDEFSL---------------------------
>KNAG0C06620
MTTKTARPAALDH-------------TL-----------------------TLNVPFETP
RQALIASQVLQPDPILKPQDFAVSY----AAQGPCLEARFCGRDARVLRV----GVSSVI
DSLKT----IIESLDELDQTGPSSTEASM-----------------
>KLLA0A00539g
---MNKGDTSFEH-------------SL-----------------------HLEIPFESI
KQADVARKVLLPDPIMKPEDFQVTY----STQDTKLICDFESVDERILRV----GVNSVI
ESIKT----IVETIDELC----------------------------
>ZYRO0B16368g
-------MNHLDH-------------NL-----------------------HLTIPFPND
RYSEVAVKVLRPDPILRPEDFQVEY----KSKGNLLEIDFKSVDDRVLRV----GVSSVI
DSVKT----IVETIDELDYM--------------------------
>TPHA0E00200
----MFKKQSLE---------------------------------------KLNIPFETS
KQASIAAQVLKPDPQLRPEEFKVDY----SSQGSDLVVNFQSVDDRVLRV----GVSNVI
DSIKT----IIETIDELQDF--------------------------
>KLTH0E00990g
--MKGTRQSDLAY-------------TL-----------------------YLEVPFKTA
KQAETAVKVLKPDPILKPQDFHVEY----SSKAHNLCVSFEGVDDRVLRV----GVSSVI
ESIKT----IIETIDEFSH---------------------------
>Kwal_YGOB_Anc_5.705
--MKSSRPLNLAY-------------TL-----------------------YLEVPFQND
KQAATAVQVLKPDPILKPQDFHVEY----TSSANNLCVLFEGVDDRVLRV----GVSSVI
ESIKT----IVETIDEFS----------------------------
>SAKL0E14982g
--MKNTRQMSLDH-------------HL-----------------------YLEIPLETP
SQAIIAMKALKPDPVLKPEDFQVEY----SAADYKLCVSFKSIDDRVLRV----GVSSVI
ESVKT----IIETMDEFGS---------------------------
>NDAI0E05060
-------MRTLDY-------------TL-----------------------EIRIPFPEE
RMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDERVLRV----GVSSVL
DSIKT----ILETMDEL-----------------------------
>TBLA0G01030
-MSKRDNNMQMEH-------------TL-----------------------TLNIPFATS
KQADIACQVLRPDPILRPQDFQVKY----TSKGNELVMEFQSIDDRVLRV----GVSSVI
DSVKT----IIETFDELE----------------------------
>TDEL0B02150
--------MSLNH-------------SL-----------------------KLEIPFQTA
AQANIAKQVLLPDPILKPQDFQVDY----TTTDNVLVVGFQSIDDRVLRV----GVSSVI
DSIKT----IVETIDELGPETKELQSL-------------------
>NCAS0A03180
--MKNGREMSLDY-------------VL-----------------------NLEIPFTTS
RQAQIAAKVLVPDPILKPQDFQVEY----LSQDNILAVHFRGIDDRVLRV----GVSSVI
DSIKT----IIETIDELD----------------------------
>Suva_11.332
--MKSQREMPLDH-------------TLVERIFKGRPSEVFTNYGMFQNTRELKIPFETE
KQANIATRVLSPDPILKPQDFQADY----SSENNVMLARFRSIDDRVLRV----GVSSVI
DSIKT----IIETMDELS----------------------------
>Smik_11.359
--MSSKREMPLHH-------------TL-----------------------ELKVPFKTE
QQAVIATRVLSPDPILKPQDFQIDY----SSEKNVMLVQFRSIDDRVLRV----GVSSVI
DSIKT----VVEAMDELS----------------------------
>Skud_11.335
--MTSKREMSLDY-------------TLVEQVFQ-----------------ELQIPFETE
GQASIATKVLSPDPILKPQDFQVDY----SSEKNIMLVRFRSIDDRVLRV----GVSSVI
DSIKT----IVETIDELS----------------------------
>YKR095W-A
--MTSKREKSLDH-------------TL-----------------------ELKIPFETE
RQATIATKVLSPDPILKPQDFQVDY----SSEKNVMLVQFRSIDDRVLRV----GVSSII
DSIKT----IVEAMDVLS----------------------------
>Kpol_YGOB_1043.72
--MKTQRTIEMDH-------------TL-----------------------DFEIPFETA
RQAEIAVQVLKPDPILKPQDFQVSY----SSNDNLLIMKFKSIDDRVLRV----GVSSVI
DSVKT----IIETMDELS----------------------------
>KAFR0H00190
--------MNLDH-------------TL-----------------------KLEIPFEDA
KQANIAVDVLKPDPILRPQDFQVSY----KARDNVFVAEFESIDDRVLRV----GVSNVI
DSLKT----IIETMDELS----------------------------