MUSCLE (3.8) multiple sequence alignment

AFR288C                  MRRKRIALPDAAAGREQAHARRYQRGARTRTGRGGGCELLVRCRGRARHWVHTVCGPLVS
CAGL0G02519g             ------------------------------------------------------------
KAFR0H00200              ------------------------------------------------------------
KLLA0A00550g             ------------------------------------------------------------
KNAG0C06610              ------------------------------------------------------------
TPHA0D04620              ------------------------------------------------------------
NDAI0E05050              ------------------------------------------------------------
KLTH0E01012g             ------------------------------------------------------------
Kwal_55.19688            ------------------------------------------------------------
SAKL0E14960g             ------------------------------------------------------------
TDEL0B02160              ------------------------------------------------------------
Kpol_YGOB_Anc_5.704      ------------------------------------------------------------
ZYRO0G06556g             ------------------------------------------------------------
NCAS0A03190              ------------------------------------------------------------
                                                                                     

AFR288C                  SVAAMAARGSRAAKKCGRRGRQETGVAAGDMKETELFCKEGLE-YAVAELW----EEGKL
CAGL0G02519g             -----------------------------MAAIVELCRNNGIK-YSVEIVE----VKGKV
KAFR0H00200              -------------------------MSQLATTIEPLCTVNGSQSFEVKITK----DGSKY
KLLA0A00550g             ---------------------MARMPDESNVTKQELGIYNGVS-FTIVTKL----LAEGA
KNAG0C06610              ---------------------------MITTVRKHLVDFCGER-ISVEIDK----DGSKY
TPHA0D04620              -----------------------MTTEIDSLERLKLVQIGDMV-YDVVAEK----KGSKY
NDAI0E05050              -----------------------MSTNGQEKNEKYLITIDNIH-YSVKFTRKQNSDPSKY
KLTH0E01012g             ---------------------------MKQVVEVPLVSTAKTQ-FWACVET----DDNKY
Kwal_55.19688            ---------------------------MAQIVEVPLVCSHNTQ-FSVVVET----EGSKN
SAKL0E14960g             ---------------------------MAKAVNKPLLQIGSTL-YSVDIEK----DGSVY
TDEL0B02160              ---------------------------MSSTEEIKLLNIHGIC-YSVISEP----SESRF
Kpol_YGOB_Anc_5.704      ------------------------------------------------------------
ZYRO0G06556g             -----------------------------MASKESLGIFGEFE-YYVTFAK----DGSKY
NCAS0A03190              ---------------------------MSKSIKQYLLTIDHDH-YYVETVL----EGSAY
                                                                                     

AFR288C                  RSVELAVREGR------------------GAEARAP--------GGPLVVLDSVRSGAGR
CAGL0G02519g             ESYKLI-----------------------KANDRSTDCFLKFDRDTQIIVIDSVKSGTSR
KAFR0H00200              HAFKLVAK---------------------EVKDDKP---CSPPHYENVVVIDSVSSGTGR
KLLA0A00550g             KSYQLGSK---------------------LLDDEKLLANKKFEYSGELLIVDSVFSGSGR
KNAG0C06610              TKFALLSEPCP------------------QECAPPQ-----LFTRENLIVLDSVHSGTGR
TPHA0D04620              SSFKLESYKCT------------------EESAALEVHSLL--ASSELVVIDSICSGVGR
NDAI0E05050              DSLQLIQKQQQQQQQQQQQLHNNNIPTILTTSKDLILNSDYEKNNTKLIIIDSTHSGLGR
KLTH0E01012g             TSFSLVSRPNE------------------YGDASLD-PQL-TRGQKDILIVDSIKSGTGR
Kwal_55.19688            VSFSLLRHPND------------------QFSATLD-PELVSRKKGDILVVDSIKSGTGR
SAKL0E14960g             SSFVLKAEKLS------------------TVSSSLI---SLPSANSELIILDSVMSGIGR
TDEL0B02160              QLVKTAT----------------------TTEDDRT-----VQNQPNLIVIDSVHSGKGR
Kpol_YGOB_Anc_5.704      ------------------------------------------------------------
ZYRO0G06556g             TSFQL--EKSH------------------AKQSSRA---STRSDDSTLIVLDSLKSGIGR
NCAS0A03190              KSFNLLIEDST------------------PLSVDRKLQFVPLKDTAQLIVIDSIHSGGGR
                                                                                     

AFR288C                  EPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRT-S-----ETTVLVMSGD
CAGL0G02519g             NDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSG----FKYDILFLSGD
KAFR0H00200              NKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLS-K-----SYTVIFISGD
KLLA0A00550g             DKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDST-R-----QYTVLFLSGD
KNAG0C06610              TSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPT-Q-----SYTILFVSGD
TPHA0D04620              TGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEAS-K-----DYTIIFLSGD
NDAI0E05050              NKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFSIKTKDTTKIDYNLIFLSGD
KLTH0E01012g             DSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTE-----NTILIFLSGD
Kwal_55.19688            DVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQ-----NTTVIFLSGD
SAKL0E14960g             KTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPS-K-----SYTIIFLSGD
TDEL0B02160              TAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDIS-Q-----SHTVLFLSGD
Kpol_YGOB_Anc_5.704      ------------------------------------------------------------
ZYRO0G06556g             TENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPL-Q-----DYEIWIISGD
NCAS0A03190              TSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLT-K-----HYEIFFLSGD
                                                                                     

AFR288C                  TTISEFVNALGSGA------------GVTVYALPLGTANAWAHSVGLGTPAKALQAFVQG
CAGL0G02519g             TSISEFINALDTTI----LRS--AKYRISILPVPLGSGNALATSLGFKTPLQALITYLNS
KAFR0H00200              TSISEFINNLPPLL----ETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHN
KLLA0A00550g             TSISEFVNNLPLNH-----------DCISVLPFPMGTGNAWASSLKLMDPAVIFSQFVNG
KNAG0C06610              TSVSEFFNGVGAGV----PS---PRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRG
TPHA0D04620              TSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVFQKFLNN
NDAI0E05050              TTISEFFNNLPPQQ----PQT--SKINLNILTIPMGTANAWSNSLNLNCPIDIFQKFLLN
KLTH0E01012g             TTISEFLNGLNRRV----FEG--LRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFLQG
Kwal_55.19688            TSISEFVNNLTQEQ----QGT--IRPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQG
SAKL0E14960g             TSISEFLNHIPTQN----SN---SKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKN
TDEL0B02160              TSISEFINNLPQGA---------PSANLSILSFPMGSGNAWASSLGIMCPVKTFGQFIRG
Kpol_YGOB_Anc_5.704      ------------------------------------------------------------
ZYRO0G06556g             TTISEFCNNLPNKK----I----TRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNH
NCAS0A03190              TTISEFINGLPKQS----LDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTS
                                                                                     

AFR288C                  RVHAVPFPLYRARFPSG-------------YSIRFFIVLSAGFHANLLHLC-NDERYQRL
CAGL0G02519g             NKKCSPLPLYDAQLPNS-------------TSMIFFIILSLGFHANLLHCA-EDPKYKSM
KAFR0H00200              RTQPSHFPLYEVIFPNG-------------KTVIFFIILSLGLHANVLHLCENDPQYKKY
KLLA0A00550g             KLSCNDFPLYRATFDNG-------------YVLKFFIILSLGFHANLLHLC-EEDEYQKM
KNAG0C06610              ELVTAEFPLYRAILPDG------------ETSVVFFIVLSLGFHANLLHAA-ENEKYKSM
TPHA0D04620              ELIIKDFPLYTVTLPNK-------------KTIIFFIIFSMGFHANLLHAC-DSDEYQKM
NDAI0E05050              KLTVSPFPLYSLILPHSPSSSSSSGKTGGKNTIYFFIVLSMGFHANLLHLCSNDEKYSNL
KLTH0E01012g             QLTPRKFPLYKATFPNG-------------FEMIFFIILSIGFHANLLHLC-KQQRFQSL
Kwal_55.19688            FLKPKNFPLYKAIFPNG-------------YEIVFFIILSIGFHANLLHLC-DQPRFKKL
SAKL0E14960g             DLIASKFPLYRASFPNG-------------YSTIFFIILSIGFHANLLHLC-NHSKYKVM
TDEL0B02160              EMSHSPFPLYKAVFPNG-------------YSIVFFIILSMGFHANLVHAC-ERPEYQRM
Kpol_YGOB_Anc_5.704      ----------MATFPDD-------------SRIYFFIILSLGFHATLLHAC-SRPELLKM
ZYRO0G06556g             NLKPRDIPLYRAALPNG-------------YSIIFFMIFSLGFHANLLHAC-EDPKYAKM
NCAS0A03190              NYSINNFPLYKAIFPNG-------------NEIVFFVILSLGFHANLLHCC-EAPHYKKL
                                      :                    **:::* *:**.::* . .       

AFR288C                  GVERFREASTEILDRYALAEHVRVRAAD--GSEQLAGLYAYFALLNTPHLEETYVPSPLS
CAGL0G02519g             GVERFQVASKTVFESYDLNVGIAVNGLQ-------SQSYSYFAVIAAPNLEPTYKPSPKS
KAFR0H00200              GEERFKLAFEKVMTTYDLNVRLQIPELD------LSGAFSYFILINTPNLESSYIPSPLS
KLLA0A00550g             GIERFRVASQRILREYKLESRVSIPDIL-------EGSFSYFALINTTNLEPTYMPSPDS
KNAG0C06610              GVERFQEASGDILQNYKLQEQITLDKQG------VAGSYAYFALVNVPNLEASYIPSPQS
TPHA0D04620              GTERFAKASENIFKNYDLNIGLTTKNGS----ESISRNYAYFAIINTPNLELNYMPSPDS
NDAI0E05050              GLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSFSYFNLMNTPKLEYNYIPSPLS
KLTH0E01012g             GVERFKIASLEILQKYPLEYRLQVSGLP-------TRDYSYFALINTPNLEASYKPSPQS
Kwal_55.19688            GVERFRLASKEIFEDYILDYPLQVTQRP-------LEHYSYFALINTPNLEQNYKPSPKS
SAKL0E14960g             GVERFKAASAQIFKNYDLKYKVSIPNRV-------SGCYAYFAIINTPNLEPTYKPSPLS
TDEL0B02160              GIEKFQLAGSVILKEYELDLKITVNSLA--------ASYSYFALINTPNLEPAYRPSPES
Kpol_YGOB_Anc_5.704      GTERFQLAAKEILETYDLDLNIKVNKST--------RRYAYFAIINTSNLELTYCPSPKS
ZYRO0G06556g             GAERFQIAAQSILESYSLDLDISLDGLR--------RSYAYFALINTPNLEATYKPSPRS
NCAS0A03190              GVERFRIASEDILANYDLDLNISIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQS
                         * *.*  *   ::  * *   :                ::** :: ..:**  * *** *

AFR288C                  DPLLKQLHVLAFEA-ELSRDKLNELLMAGYSTIR-G----SALSAPGLVYRNLGD----S
CAGL0G02519g             SVLKKELHILGYKA-GICLEDLQDKIMRGYHNKD-G----EDIQEIGTIYQCFQK----N
KAFR0H00200              DPFLEQLHVLGYSS-SLNNEDLLNYVTQGYSNKLGD----ELVESSNMVYKPISR----N
KLLA0A00550g             DPLESQLHVLAYQS-SLDRVEFQKRVFMGYSNTK-H----SNILQNGTFYRPLPF----C
KNAG0C06610              DPFKHELHLLAYSS-SLNRKQLLERIMAGYKNRRGD----ELTADPYTTYKRISE----G
TPHA0D04620              DVFKNELHLLGYDA-SLSTEKLVNKIMAGYSYKERE----KINNKDNLTYYYPVNLSGTG
NDAI0E05050              DPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNEL-GQKNIQNIDEDGIIYFPIND---KK
KLTH0E01012g             NSLHFQLHVLGYSS-KLQQASLVSKIMKGYSNRA-G----DDISGDGVIYEPYNH----A
Kwal_55.19688            NPLTSELHLLGYSS-GLPQPMLINRIMKGYSNQP-E----TDINEEGVTYQAFSN----D
SAKL0E14960g             DPLTSALHLLGFES-SLKSSELIKRITRGRTAQK-G----DDIMDTGVIYEKLEK----D
TDEL0B02160              DPLKEELYLLGYSS-GLSKDQFLTKVMKGYELGPSD----KLPLDSDTIYVPFTK----G
Kpol_YGOB_Anc_5.704      NVLENSLQLLGYSS-KLSRAELVDKIMKGYIIRK-G----DVIKTDEYTYYETLDLSQSG
ZYRO0G06556g             NPLERELRLLGYSS-SLGRQELVEKIMQGYQNKPNG----DLPTNEDMIYKSITH----D
NCAS0A03190              NPLRSQLHIIAYSS-SLPKDELMARILKGYENNI-G----DVVNNTGVTYLPIED----N
                         . :   * ::.:.:       :   :  *                    *          

AFR288C                  FTLSIENGASD------RVANELCVDGHLLNLVDLQAPGDVF---DGSIEVGV-----VP
CAGL0G02519g             LELSIKTGHNAP-----KYRYDMCIDGYLLNLEDCNSKDN-----EYKILIRF---IDDH
KAFR0H00200              VSIVLTEDEESE-----KYKYDICCDGLLFNLRDMLPENPTKE--DYVLKTNFK--SRDS
KLLA0A00550g             FNVEVLDDPSQ------KSNFEVCCDGQLLNLLELEGKNTP----PSTIRIET------C
KNAG0C06610              FEIKLQNKQEGPN----DPAFELCLDGQLYNLLQYKSDQH-----QEELTIQVELIDSAL
TPHA0D04620              LQIILETDSDKKLE---KYKYDICCDGLLLNLDDINNQHGVAESNKNKITISK---FPND
NDAI0E05050              FKITLNNPSPISSSLSLSHNYELCCDGMLFNLLNYQTNQGK----QDKISFEIEANSNKI
KLTH0E01012g             LEVVFDQVPENVS----NTYFEICCDGHLLNMLSLQPQDQKF---DGRIRIQF---LKNF
Kwal_55.19688            LDVVFAQDPELVP----RSAFDICCDGHLLNMLSQQPAHGSF---DGRIHVKF---LKEH
SAKL0E14960g             FDIVVEHSPSASD----RIKFEICCDGQLLNLLDMQGTEGSF---DGTIKVSF---LQDY
TDEL0B02160              FDVTLDFPLLESP----RYKSEICCDGVLLNLQDLQADLEV----SNKFSIEF---LNHY
Kpol_YGOB_Anc_5.704      IDIIVDEKMNNSN----THKFEICCDGLLLDLMEKSKGRTD----NLTIHINS---VKDY
ZYRO0G06556g             FTLVLNDSLEDSS----MHKFEICCDGILLNLLDYQSPDKHKP--SNEIRFQF---LNDY
NCAS0A03190              FIIKLNYSQEYSP----SSKFQLCCDGLLFNLNDFIHKNDNGPCKNNEILIEF---LSTY
                         . : .                ::* ** * :: .              :           

AFR288C                  ASFGLKALVPAHIS--
CAGL0G02519g             AIMVYQNQM-------
KAFR0H00200              LPFEVQVLK-------
KLLA0A00550g             TEPSLKVLHSL-----
KNAG0C06610              GSFDILVMGKH-----
TPHA0D04620              LNFQLNLFA-------
NDAI0E05050              SSFRIFALS-------
KLTH0E01012g             SSFELNVMVP------
Kwal_55.19688            SSFHLKVLSKYVSDNF
SAKL0E14960g             SPFNLKVLSPA-----
TDEL0B02160              SKFNIKAMSSN-----
Kpol_YGOB_Anc_5.704      LSFDLQVLTTLQDSSI
ZYRO0G06556g             SGFQLQVYSL------
NCAS0A03190              SPFQLSLMS-------
                                         

FASTA FORMAT for MUSCLE Version 3.6

>AFR288C
MRRKRIALPDAAAGREQAHARRYQRGARTRTGRGGGCELLVRCRGRARHWVHTVCGPLVS
SVAAMAARGSRAAKKCGRRGRQETGVAAGDMKETELFCKEGLE-YAVAELW----EEGKL
RSVELAVREGR------------------GAEARAP--------GGPLVVLDSVRSGAGR
EPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRT-S-----ETTVLVMSGD
TTISEFVNALGSGA------------GVTVYALPLGTANAWAHSVGLGTPAKALQAFVQG
RVHAVPFPLYRARFPSG-------------YSIRFFIVLSAGFHANLLHLC-NDERYQRL
GVERFREASTEILDRYALAEHVRVRAAD--GSEQLAGLYAYFALLNTPHLEETYVPSPLS
DPLLKQLHVLAFEA-ELSRDKLNELLMAGYSTIR-G----SALSAPGLVYRNLGD----S
FTLSIENGASD------RVANELCVDGHLLNLVDLQAPGDVF---DGSIEVGV-----VP
ASFGLKALVPAHIS--
>CAGL0G02519g
------------------------------------------------------------
-----------------------------MAAIVELCRNNGIK-YSVEIVE----VKGKV
ESYKLI-----------------------KANDRSTDCFLKFDRDTQIIVIDSVKSGTSR
NDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSG----FKYDILFLSGD
TSISEFINALDTTI----LRS--AKYRISILPVPLGSGNALATSLGFKTPLQALITYLNS
NKKCSPLPLYDAQLPNS-------------TSMIFFIILSLGFHANLLHCA-EDPKYKSM
GVERFQVASKTVFESYDLNVGIAVNGLQ-------SQSYSYFAVIAAPNLEPTYKPSPKS
SVLKKELHILGYKA-GICLEDLQDKIMRGYHNKD-G----EDIQEIGTIYQCFQK----N
LELSIKTGHNAP-----KYRYDMCIDGYLLNLEDCNSKDN-----EYKILIRF---IDDH
AIMVYQNQM-------
>KAFR0H00200
------------------------------------------------------------
-------------------------MSQLATTIEPLCTVNGSQSFEVKITK----DGSKY
HAFKLVAK---------------------EVKDDKP---CSPPHYENVVVIDSVSSGTGR
NKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLS-K-----SYTVIFISGD
TSISEFINNLPPLL----ETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSFLHN
RTQPSHFPLYEVIFPNG-------------KTVIFFIILSLGLHANVLHLCENDPQYKKY
GEERFKLAFEKVMTTYDLNVRLQIPELD------LSGAFSYFILINTPNLESSYIPSPLS
DPFLEQLHVLGYSS-SLNNEDLLNYVTQGYSNKLGD----ELVESSNMVYKPISR----N
VSIVLTEDEESE-----KYKYDICCDGLLFNLRDMLPENPTKE--DYVLKTNFK--SRDS
LPFEVQVLK-------
>KLLA0A00550g
------------------------------------------------------------
---------------------MARMPDESNVTKQELGIYNGVS-FTIVTKL----LAEGA
KSYQLGSK---------------------LLDDEKLLANKKFEYSGELLIVDSVFSGSGR
DKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDST-R-----QYTVLFLSGD
TSISEFVNNLPLNH-----------DCISVLPFPMGTGNAWASSLKLMDPAVIFSQFVNG
KLSCNDFPLYRATFDNG-------------YVLKFFIILSLGFHANLLHLC-EEDEYQKM
GIERFRVASQRILREYKLESRVSIPDIL-------EGSFSYFALINTTNLEPTYMPSPDS
DPLESQLHVLAYQS-SLDRVEFQKRVFMGYSNTK-H----SNILQNGTFYRPLPF----C
FNVEVLDDPSQ------KSNFEVCCDGQLLNLLELEGKNTP----PSTIRIET------C
TEPSLKVLHSL-----
>KNAG0C06610
------------------------------------------------------------
---------------------------MITTVRKHLVDFCGER-ISVEIDK----DGSKY
TKFALLSEPCP------------------QECAPPQ-----LFTRENLIVLDSVHSGTGR
TSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPT-Q-----SYTILFVSGD
TSVSEFFNGVGAGV----PS---PRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRG
ELVTAEFPLYRAILPDG------------ETSVVFFIVLSLGFHANLLHAA-ENEKYKSM
GVERFQEASGDILQNYKLQEQITLDKQG------VAGSYAYFALVNVPNLEASYIPSPQS
DPFKHELHLLAYSS-SLNRKQLLERIMAGYKNRRGD----ELTADPYTTYKRISE----G
FEIKLQNKQEGPN----DPAFELCLDGQLYNLLQYKSDQH-----QEELTIQVELIDSAL
GSFDILVMGKH-----
>TPHA0D04620
------------------------------------------------------------
-----------------------MTTEIDSLERLKLVQIGDMV-YDVVAEK----KGSKY
SSFKLESYKCT------------------EESAALEVHSLL--ASSELVVIDSICSGVGR
TGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEAS-K-----DYTIIFLSGD
TSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQVFQKFLNN
ELIIKDFPLYTVTLPNK-------------KTIIFFIIFSMGFHANLLHAC-DSDEYQKM
GTERFAKASENIFKNYDLNIGLTTKNGS----ESISRNYAYFAIINTPNLELNYMPSPDS
DVFKNELHLLGYDA-SLSTEKLVNKIMAGYSYKERE----KINNKDNLTYYYPVNLSGTG
LQIILETDSDKKLE---KYKYDICCDGLLLNLDDINNQHGVAESNKNKITISK---FPND
LNFQLNLFA-------
>NDAI0E05050
------------------------------------------------------------
-----------------------MSTNGQEKNEKYLITIDNIH-YSVKFTRKQNSDPSKY
DSLQLIQKQQQQQQQQQQQLHNNNIPTILTTSKDLILNSDYEKNNTKLIIIDSTHSGLGR
NKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFSIKTKDTTKIDYNLIFLSGD
TTISEFFNNLPPQQ----PQT--SKINLNILTIPMGTANAWSNSLNLNCPIDIFQKFLLN
KLTVSPFPLYSLILPHSPSSSSSSGKTGGKNTIYFFIVLSMGFHANLLHLCSNDEKYSNL
GLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSFSYFNLMNTPKLEYNYIPSPLS
DPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNEL-GQKNIQNIDEDGIIYFPIND---KK
FKITLNNPSPISSSLSLSHNYELCCDGMLFNLLNYQTNQGK----QDKISFEIEANSNKI
SSFRIFALS-------
>KLTH0E01012g
------------------------------------------------------------
---------------------------MKQVVEVPLVSTAKTQ-FWACVET----DDNKY
TSFSLVSRPNE------------------YGDASLD-PQL-TRGQKDILIVDSIKSGTGR
DSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTE-----NTILIFLSGD
TTISEFLNGLNRRV----FEG--LRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFLQG
QLTPRKFPLYKATFPNG-------------FEMIFFIILSIGFHANLLHLC-KQQRFQSL
GVERFKIASLEILQKYPLEYRLQVSGLP-------TRDYSYFALINTPNLEASYKPSPQS
NSLHFQLHVLGYSS-KLQQASLVSKIMKGYSNRA-G----DDISGDGVIYEPYNH----A
LEVVFDQVPENVS----NTYFEICCDGHLLNMLSLQPQDQKF---DGRIRIQF---LKNF
SSFELNVMVP------
>Kwal_55.19688
------------------------------------------------------------
---------------------------MAQIVEVPLVCSHNTQ-FSVVVET----EGSKN
VSFSLLRHPND------------------QFSATLD-PELVSRKKGDILVVDSIKSGTGR
DVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQ-----NTTVIFLSGD
TSISEFVNNLTQEQ----QGT--IRPTVNLLALPLGTGNAWANSLGFRTAATALAEFLQG
FLKPKNFPLYKAIFPNG-------------YEIVFFIILSIGFHANLLHLC-DQPRFKKL
GVERFRLASKEIFEDYILDYPLQVTQRP-------LEHYSYFALINTPNLEQNYKPSPKS
NPLTSELHLLGYSS-GLPQPMLINRIMKGYSNQP-E----TDINEEGVTYQAFSN----D
LDVVFAQDPELVP----RSAFDICCDGHLLNMLSQQPAHGSF---DGRIHVKF---LKEH
SSFHLKVLSKYVSDNF
>SAKL0E14960g
------------------------------------------------------------
---------------------------MAKAVNKPLLQIGSTL-YSVDIEK----DGSVY
SSFVLKAEKLS------------------TVSSSLI---SLPSANSELIILDSVMSGIGR
KTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPS-K-----SYTIIFLSGD
TSISEFLNHIPTQN----SN---SKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKN
DLIASKFPLYRASFPNG-------------YSTIFFIILSIGFHANLLHLC-NHSKYKVM
GVERFKAASAQIFKNYDLKYKVSIPNRV-------SGCYAYFAIINTPNLEPTYKPSPLS
DPLTSALHLLGFES-SLKSSELIKRITRGRTAQK-G----DDIMDTGVIYEKLEK----D
FDIVVEHSPSASD----RIKFEICCDGQLLNLLDMQGTEGSF---DGTIKVSF---LQDY
SPFNLKVLSPA-----
>TDEL0B02160
------------------------------------------------------------
---------------------------MSSTEEIKLLNIHGIC-YSVISEP----SESRF
QLVKTAT----------------------TTEDDRT-----VQNQPNLIVIDSVHSGKGR
TAQNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDIS-Q-----SHTVLFLSGD
TSISEFINNLPQGA---------PSANLSILSFPMGSGNAWASSLGIMCPVKTFGQFIRG
EMSHSPFPLYKAVFPNG-------------YSIVFFIILSMGFHANLVHAC-ERPEYQRM
GIEKFQLAGSVILKEYELDLKITVNSLA--------ASYSYFALINTPNLEPAYRPSPES
DPLKEELYLLGYSS-GLSKDQFLTKVMKGYELGPSD----KLPLDSDTIYVPFTK----G
FDVTLDFPLLESP----RYKSEICCDGVLLNLQDLQADLEV----SNKFSIEF---LNHY
SKFNIKAMSSN-----
>Kpol_YGOB_Anc_5.704
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------MATFPDD-------------SRIYFFIILSLGFHATLLHAC-SRPELLKM
GTERFQLAAKEILETYDLDLNIKVNKST--------RRYAYFAIINTSNLELTYCPSPKS
NVLENSLQLLGYSS-KLSRAELVDKIMKGYIIRK-G----DVIKTDEYTYYETLDLSQSG
IDIIVDEKMNNSN----THKFEICCDGLLLDLMEKSKGRTD----NLTIHINS---VKDY
LSFDLQVLTTLQDSSI
>ZYRO0G06556g
------------------------------------------------------------
-----------------------------MASKESLGIFGEFE-YYVTFAK----DGSKY
TSFQL--EKSH------------------AKQSSRA---STRSDDSTLIVLDSLKSGIGR
TENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPL-Q-----DYEIWIISGD
TTISEFCNNLPNKK----I----TRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNH
NLKPRDIPLYRAALPNG-------------YSIIFFMIFSLGFHANLLHAC-EDPKYAKM
GAERFQIAAQSILESYSLDLDISLDGLR--------RSYAYFALINTPNLEATYKPSPRS
NPLERELRLLGYSS-SLGRQELVEKIMQGYQNKPNG----DLPTNEDMIYKSITH----D
FTLVLNDSLEDSS----MHKFEICCDGILLNLLDYQSPDKHKP--SNEIRFQF---LNDY
SGFQLQVYSL------
>NCAS0A03190
------------------------------------------------------------
---------------------------MSKSIKQYLLTIDHDH-YYVETVL----EGSAY
KSFNLLIEDST------------------PLSVDRKLQFVPLKDTAQLIVIDSIHSGGGR
TSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLT-K-----HYEIFFLSGD
TTISEFINGLPKQS----LDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNYLTS
NYSINNFPLYKAIFPNG-------------NEIVFFVILSLGFHANLLHCC-EAPHYKKL
GVERFRIASEDILANYDLDLNISIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQS
NPLRSQLHIIAYSS-SLPKDELMARILKGYENNI-G----DVVNNTGVTYLPIED----N
FIIKLNYSQEYSP----SSKFQLCCDGLLFNLNDFIHKNDNGPCKNNEILIEF---LSTY
SPFQLSLMS-------