MUSCLE (3.8) multiple sequence alignment

TBLA0A02810        -MTEYISLDTNKRTPSNDL--NSTKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPL
ZYRO0F10076g       -MAEAEAELIHTAHEHINLHDNETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPL
TDEL0E01890        MLFHDLASDIQG---------SETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPV
KLLA0E02223g       MSSTTLSNQLPDG--------SCNKTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPL
AER403C            MMDPMANLPLSTYPPTDQLGKSQTKPLYITSVQVE-DGKDYPLSDGVLKSILSPVLAKPL
Ecym_4760          MVENNLRTNLDGH--EAALAKVQTKPLFITSVYVN-DVKLSPLSNSIFESILKPVLSQPF
SAKL0G02574g       MASPSLSTEFQKKVQLDALSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPL
KLTH0F16016g       MDLSDFSKELQKGSESSVVQRSSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPL
Kwal_55.21418      MTLPQFSESLQQEAEEHLLQKSSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPL
Kpol_1062.28       --MERFHEELKNEFVKENISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPI
TPHA0E01750        MIRDSIVF-------------SDTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPV
                                           *.::.:.: :        :*.     ::   :  *.

TBLA0A02810        QNLKTTLQTFENIEDKLYQTDLFEDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPI
ZYRO0F10076g       QSVENSINIFEDIRKKLLFTGLFSDVNITLDKDP--DTTSLSQLNKEISESYGIETPLST
TDEL0E01890        QNVGSSLYTFGDIRRKLLCTGLYQDVRITLEQDH--DAKSSEFANKDSPKEYGIESPLAT
KLLA0E02223g       QKVDSAFKSCEDIQKKLLFTGLFQSAEITLDHDV--DVRSSRLLTENVPKTLDIELPIPT
AER403C            QSLSSTLASLETIEKNLMYTGLYQDISITLDHDK--SRLVNQFLSNIAPKEYDIELPLPV
Ecym_4760          QNLRSTLSALGTIEKKLMYTGLYDDVNITLDQDK--SQYISDYLEEVAPKEYGLELPVPI
SAKL0G02574g       QNIDNAMNNFSEIKKKLFFTGLFQDVKITLDNDV--SGASFDFLKENVSKEYGVELPLPT
KLTH0F16016g       QTLDQSLSNFAEIKKKLIYTGLFRDVKISLDNEV--SSDELQSLPKDLVKGYALEMPIPT
Kwal_55.21418      QTLEQSLANFTEIKKKLIYTGMFSDVKISLDKDT--SGNGLKDLHQDAIKELSLESPVPT
Kpol_1062.28       QNVDTALGSFIDIKRNLLFTGLYNDVDVTLGADK--GGSLLNLSLKMVTDKIGIESIVPT
TPHA0E01750        KSVQDVNLIFQNIRNNLILSGLYKNVDVKLDLDE--RASLLNHSLKLSTEQIGIESVVPI
                   :.:         *  :*  :.:: .  :.*  :            .       ::  :. 

TBLA0A02810        TANIFIKPNKPLVDPN--YTWTISNNKSIFSWSKNWINSLNRADQHYINASATYDLDSTK
ZYRO0F10076g       QAKVLLKRPD-YNTIS--GTTTLSDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQ
TDEL0E01890        HARIILKPSGVYNSTA--GTTSLVDDSASVAISRSYMNLLGRADSESFHLGLKYNPQTSK
KLLA0E02223g       IAQVKLVPAV-YNKGS--LSTTTRDTYSSAGARLFWINKFGNAETISLQGDVNYTPFNGK
AER403C            KALVKVLPAP-YQRLS--LVTTTRDSYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGK
Ecym_4760          KAQIQLVPAF-YQPLS--LVTTTRDSYAAAGIHLSSLNKFQQAETIILQGELNCTPFSGK
SAKL0G02574g       VAKIDLIPAL-YNKLC--LTSGTSDMLSSMGGRISFINALGKAETLILQSDINYVPFSGK
KLTH0F16016g       IARIRLTPIN-LNRAS--LTSFTGDTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQST
Kwal_55.21418      IARILLKPLE-FNKLC--FTSSTNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNT
Kpol_1062.28       SATIRLKPNDLVTNLQ--TTFTTTSNDCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTS
TPHA0E01750        SATLNMTPLY-LTPYKNYVTFNTSNTQNSVSLNRDWINLFGTSDTGTIKLSADLNQTKSE
                    * : :                  .            * :  ::   :            

TBLA0A02810        WKNFKFDGLSTYPLVPFTSVKSVSGISL---------FKPLQQSKDYIQYLVESGFRKDM
ZYRO0F10076g       WDGKDARFSFSLPLVKVPSVRAIVEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQK--
TDEL0E01890        WEGKSLKGSFSLPLAKNPSVRASLNFDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQK--
KLLA0E02223g       LDERLLGAKLALPFPKNPSVKAAVYANHTYLDLFKQPFIGESDEHKQSQFGLSAGIEK--
AER403C            LDDKLVDLRCLVPFQNNPSIKAVFDVNYAMLDLYNQPWINEDDQHKQRQIGFNIGIQK--
Ecym_4760          IDEKLLSLKCLVPLQKLPSMKAVFDINYALVDLFKQSWLPESDQHKQNQIGFNIGIQE--
SAKL0G02574g       LNEKSLDGKFLLPLQKNPSIKAVIDVNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQK--
KLTH0F16016g       FDEKVLEAKLLIPLQKNPSVKAVFDANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQK--
Kwal_55.21418      ALEKTLDAKVVVPLQKNPSVKAVFDTNYANIDLHGQPFVEKKDQHRQRQVSVNVGVQK--
Kpol_1062.28       WIQKYFKGEFILPFTKVPSLRTVLSVDVS---------EDKVSHLQRLNCNYKAGIQK--
TPHA0E01750        IDKKSIDAKFTMPLLRNSSIRTILESKCS---------IAKPRNDTMKQFELNIGLTK--
                               *:   .*:.:    .                     :     *. :  

TBLA0A02810        RFPEEVGVKSSNLYTGLAINGAIKD---EGNNNCLVLNKTILENMQIYKKT-SILSKFST
ZYRO0F10076g       RWICNISKSVPLLYTGVSVVR--RN--LNEFKP--TASELYAPFKGPFDKT-SFVTSFTH
TDEL0E01890        RWILEQTNSVPNFYAGITSTN--RD--ISGLGA--QASKVFSNYSGKFNKV-SLESKFHN
KLLA0E02223g       NFLYNNNKSVIETFNGMTMVA--RN--IYGFADALAVSDSIKQFQGTFTKS-SFISELKS
AER403C            QWLSKRLYS-PTAFAGVSIVG--RN--LHGIQLD-RASYHVSAWADSSLKT-SFVTQFLH
Ecym_4760          QQISSSKFRGPIIYSGISILG--RN--LLDLKKT-EVSSSINSWVES-SKV-SYVFQILQ
SAKL0G02574g       NWLCNKTGNAPILFNGVSTVI--RN--LYGFNDIANVSESIKQFNGSFIKS-SFVSQITN
KLTH0F16016g       QWVNIKTGLAPVLYNGFSVVA--RN--LDEVRK--EASEAIRQFDAPFVKN-SFVSQLLV
Kwal_55.21418      QWLTSKMNLSPVFYNGFSVVA--RN--LHDVPN--EASGAIRQFNAPFLKN-SFVSQLVI
Kpol_1062.28       LWLKDDLNTFPVFYSGLSIVN--NK----PIFNGEIPIDVPSPEQTPSYQS-GWLTTFSK
TPHA0E01750        LKLIGGIKSLPIFYSGLNIQR--KQTTLGPLSDEESETEIIGNISDEVINSLSLKSEYIT
                                : *.      ..                        :  .       

TBLA0A02810        DSRIFVKGIPRYGSYFNIYYEYVLNGLNDSK--KLSPELLHLSNVSRFGINFEKYFTLFQ
ZYRO0F10076g       DTRRFIGNFPLSGCQFQLNNEYVISQSQGSS--KQLN---HDNNFNKTAFHLEHHASHWK
TDEL0E01890        DTRKYYGTFPVSGYELLVNNEYVISQTKGSS--QVLP---QEDNFSKFDFSLQHHTSHWK
KLLA0E02223g       DSREFYNRFPVSGKRVQLFHEYILSQGFTNS--KPLP---HESNFDKLSVSYETHRPFFN
AER403C            SNRKLIGTFPVQGMKFNAVNELVLSQTVAGT-----P---QEETFNKFLVTYEKHVSFLR
Ecym_4760          NNKKFLGTLPISGWKFNLFNEAVLGQTVAGE-----K---QESGFGKVAFSYEGYSSFLR
SAKL0G02574g       DTRKFVGLFPISGSRFNLVNEYVLTQAFSKN--KTVP---QENNFDKACLSYEQHNSYLN
KLTH0F16016g       DNRKFFGLFPASGLKFSINNEYVLSESFDKKAGTAVS---QNEGFDKLAVDFEAHRAFFG
Kwal_55.21418      DNRKFFGLFPASGVKIALNNEYVLSQRFEKDSGNDMA---LDEGFNKCALSLEAQRSFFK
Kpol_1062.28       DSTKWLGSFPNSGECLNLKNEYVLSQLDSDN----KP---INTNINRFEANFEKYVSILN
TPHA0E01750        DSRFYTSKFPSGGHLFKLVHQHVLNETNSIS--NEIK-----KNISNINMSFEKHISTLN
                   ..      :*  *  .    : ::                    ...     :   .   

TBLA0A02810        DAILCSLLVRTGTSIKPSINMFNWETKRRE----ANEFPVPSYLEERPHEKN-----DGI
ZYRO0F10076g       DKITRSFQLQGGG-------IYPLGSEAQT-VHPLDRFQLGGLNSLKGFHLNGVGTGGQN
TDEL0E01890        NKLTNSLDLQFGG-------IIPFSEKTE--VHPMDKWYLGGLDSMKGFQTNGVGFGGNS
KLLA0E02223g       TKLVTSLHLDAGA-------IFPWKNKSKPLVHLLDSFYLGGPKSLKGFERNCVGNRGGL
AER403C            NLVTTSLDLSCGS-------LISTKQAAKPMVHIMDQFYLGGLSSLKGFHRNSVGSRGGD
Ecym_4760          NHIITSLDLSFGT-------IFRYKSGSELKVHIMDQFYLGGLSSLKGFQRNSVGTRGGN
SAKL0G02574g       NRITSSLDFSCGA-------IIPTGSKAAI-VHTMDRFYLGGLKSLKGFELNTVGSSGGN
KLTH0F16016g       NKIINSLELACGG-------IFSAGKSSSL-VHHIDKFYLGGMSSLKGFERNSVGQHGGK
Kwal_55.21418      NKIINSLDIACGG-------ILPTGNSASL-VHHMDKFYLGGLASLKGFERNAVGQHGGN
Kpol_1062.28       SRVITTVLMNGGF-------QFPIDESTRS-------TFVGESWDKRNSLIKDIILNKSD
TPHA0E01750        DQITSSFIFDGHV-------GVPLQST-------FANLNSGEFWDNEKEIFKTLCQNDIK
                     :  :. .                                   .      :        

TBLA0A02810        AFYNVCLNASVPLFSKCKFSPLRFQNSIQLERYNNCCPH--KQRKPDITGTLGLVYKSES
ZYRO0F10076g       FFYKLGLSISHKLINTPTKSPLRLQYFFNLGNASSDYKT--IFNSYAAATGLSLVYKTPQ
TDEL0E01890        FFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDLNT--ATNSYAAATGISLTYKTPQ
KLLA0E02223g       YFYKLGISSSFKLPNTPIDSPLRLQSFINFGDVLNNWRDANLERKPALSTGISLIYSASF
AER403C            LFYRLSLKSSVHLPGTPLDSPLRLQAFFNAGDVFHFRRQ--IPEDVAAATGLSLVYESPI
Ecym_4760          SFYKVAFKSSFHIPGTPLASPLRLQAFVNAGDVFNSERG--IPEDLATATGISLVYQSHL
SAKL0G02574g       FFYRLGITSSYRLPNATANSPLRFQVFFNAGDSLN-KRE--LPQSFAAATGFSLVYKTAL
KLTH0F16016g       LFYKLGLASSFKLPNTPANSPLRLQFFFNAGDVQNKKPT---QFSCAASSGVSLLYKSSL
Kwal_55.21418      FFYKLHVASSFKLPRTPQQSPLRLQFFLNAGEVSNEKPT---SVSCAASSGISLLYKSPL
Kpol_1062.28       MNFKCGFISSFKLPNTELDSPLRLQISALTENKFKGLAN--YFDGCAADTGVSLVYKTKD
TPHA0E01750        VSHKVGLVSSFRVPNIPITSPIRFQLSVLGINKSKRMAE--YLKNYSADTGVSLVYKGDH
                     ..  .  *  :      **:*::                          ..* *.   

TBLA0A02810        AYFDIGYTLPIGKIAGHDTKAGFAMNASISFL
ZYRO0F10076g       ALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF
TDEL0E01890        ANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF
KLLA0E02223g       ANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF
AER403C            ANLDLTYALPLTSRPVDLAKPGFSFGVAIAYR
Ecym_4760          ASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM
SAKL0G02574g       ANMDLTYALPLTEREQDVAKPGFSFGVELSFF
KLTH0F16016g       ANMDLTYAFPLTNRGQDIQKPGFSFGVSLSLY
Kwal_55.21418      ANMDLTYALPLSNRAQDVAKPGFSFGVSLSLY
Kpol_1062.28       TNMALSYKVPLMQSSNSPATSGFSFDIAITYC
TPHA0E01750        SQMKLSYQIPL-IHGNDNKHSGLSFDVAVTYC
                   : : : *  *:         .*:::.  .:  

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0A02810
-MTEYISLDTNKRTPSNDL--NSTKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPL
QNLKTTLQTFENIEDKLYQTDLFEDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPI
TANIFIKPNKPLVDPN--YTWTISNNKSIFSWSKNWINSLNRADQHYINASATYDLDSTK
WKNFKFDGLSTYPLVPFTSVKSVSGISL---------FKPLQQSKDYIQYLVESGFRKDM
RFPEEVGVKSSNLYTGLAINGAIKD---EGNNNCLVLNKTILENMQIYKKT-SILSKFST
DSRIFVKGIPRYGSYFNIYYEYVLNGLNDSK--KLSPELLHLSNVSRFGINFEKYFTLFQ
DAILCSLLVRTGTSIKPSINMFNWETKRRE----ANEFPVPSYLEERPHEKN-----DGI
AFYNVCLNASVPLFSKCKFSPLRFQNSIQLERYNNCCPH--KQRKPDITGTLGLVYKSES
AYFDIGYTLPIGKIAGHDTKAGFAMNASISFL
>ZYRO0F10076g
-MAEAEAELIHTAHEHINLHDNETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPL
QSVENSINIFEDIRKKLLFTGLFSDVNITLDKDP--DTTSLSQLNKEISESYGIETPLST
QAKVLLKRPD-YNTIS--GTTTLSDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQ
WDGKDARFSFSLPLVKVPSVRAIVEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQK--
RWICNISKSVPLLYTGVSVVR--RN--LNEFKP--TASELYAPFKGPFDKT-SFVTSFTH
DTRRFIGNFPLSGCQFQLNNEYVISQSQGSS--KQLN---HDNNFNKTAFHLEHHASHWK
DKITRSFQLQGGG-------IYPLGSEAQT-VHPLDRFQLGGLNSLKGFHLNGVGTGGQN
FFYKLGLSISHKLINTPTKSPLRLQYFFNLGNASSDYKT--IFNSYAAATGLSLVYKTPQ
ALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF
>TDEL0E01890
MLFHDLASDIQG---------SETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPV
QNVGSSLYTFGDIRRKLLCTGLYQDVRITLEQDH--DAKSSEFANKDSPKEYGIESPLAT
HARIILKPSGVYNSTA--GTTSLVDDSASVAISRSYMNLLGRADSESFHLGLKYNPQTSK
WEGKSLKGSFSLPLAKNPSVRASLNFDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQK--
RWILEQTNSVPNFYAGITSTN--RD--ISGLGA--QASKVFSNYSGKFNKV-SLESKFHN
DTRKYYGTFPVSGYELLVNNEYVISQTKGSS--QVLP---QEDNFSKFDFSLQHHTSHWK
NKLTNSLDLQFGG-------IIPFSEKTE--VHPMDKWYLGGLDSMKGFQTNGVGFGGNS
FFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDLNT--ATNSYAAATGISLTYKTPQ
ANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF
>KLLA0E02223g
MSSTTLSNQLPDG--------SCNKTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPL
QKVDSAFKSCEDIQKKLLFTGLFQSAEITLDHDV--DVRSSRLLTENVPKTLDIELPIPT
IAQVKLVPAV-YNKGS--LSTTTRDTYSSAGARLFWINKFGNAETISLQGDVNYTPFNGK
LDERLLGAKLALPFPKNPSVKAAVYANHTYLDLFKQPFIGESDEHKQSQFGLSAGIEK--
NFLYNNNKSVIETFNGMTMVA--RN--IYGFADALAVSDSIKQFQGTFTKS-SFISELKS
DSREFYNRFPVSGKRVQLFHEYILSQGFTNS--KPLP---HESNFDKLSVSYETHRPFFN
TKLVTSLHLDAGA-------IFPWKNKSKPLVHLLDSFYLGGPKSLKGFERNCVGNRGGL
YFYKLGISSSFKLPNTPIDSPLRLQSFINFGDVLNNWRDANLERKPALSTGISLIYSASF
ANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF
>AER403C
MMDPMANLPLSTYPPTDQLGKSQTKPLYITSVQVE-DGKDYPLSDGVLKSILSPVLAKPL
QSLSSTLASLETIEKNLMYTGLYQDISITLDHDK--SRLVNQFLSNIAPKEYDIELPLPV
KALVKVLPAP-YQRLS--LVTTTRDSYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGK
LDDKLVDLRCLVPFQNNPSIKAVFDVNYAMLDLYNQPWINEDDQHKQRQIGFNIGIQK--
QWLSKRLYS-PTAFAGVSIVG--RN--LHGIQLD-RASYHVSAWADSSLKT-SFVTQFLH
SNRKLIGTFPVQGMKFNAVNELVLSQTVAGT-----P---QEETFNKFLVTYEKHVSFLR
NLVTTSLDLSCGS-------LISTKQAAKPMVHIMDQFYLGGLSSLKGFHRNSVGSRGGD
LFYRLSLKSSVHLPGTPLDSPLRLQAFFNAGDVFHFRRQ--IPEDVAAATGLSLVYESPI
ANLDLTYALPLTSRPVDLAKPGFSFGVAIAYR
>Ecym_4760
MVENNLRTNLDGH--EAALAKVQTKPLFITSVYVN-DVKLSPLSNSIFESILKPVLSQPF
QNLRSTLSALGTIEKKLMYTGLYDDVNITLDQDK--SQYISDYLEEVAPKEYGLELPVPI
KAQIQLVPAF-YQPLS--LVTTTRDSYAAAGIHLSSLNKFQQAETIILQGELNCTPFSGK
IDEKLLSLKCLVPLQKLPSMKAVFDINYALVDLFKQSWLPESDQHKQNQIGFNIGIQE--
QQISSSKFRGPIIYSGISILG--RN--LLDLKKT-EVSSSINSWVES-SKV-SYVFQILQ
NNKKFLGTLPISGWKFNLFNEAVLGQTVAGE-----K---QESGFGKVAFSYEGYSSFLR
NHIITSLDLSFGT-------IFRYKSGSELKVHIMDQFYLGGLSSLKGFQRNSVGTRGGN
SFYKVAFKSSFHIPGTPLASPLRLQAFVNAGDVFNSERG--IPEDLATATGISLVYQSHL
ASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM
>SAKL0G02574g
MASPSLSTEFQKKVQLDALSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPL
QNIDNAMNNFSEIKKKLFFTGLFQDVKITLDNDV--SGASFDFLKENVSKEYGVELPLPT
VAKIDLIPAL-YNKLC--LTSGTSDMLSSMGGRISFINALGKAETLILQSDINYVPFSGK
LNEKSLDGKFLLPLQKNPSIKAVIDVNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQK--
NWLCNKTGNAPILFNGVSTVI--RN--LYGFNDIANVSESIKQFNGSFIKS-SFVSQITN
DTRKFVGLFPISGSRFNLVNEYVLTQAFSKN--KTVP---QENNFDKACLSYEQHNSYLN
NRITSSLDFSCGA-------IIPTGSKAAI-VHTMDRFYLGGLKSLKGFELNTVGSSGGN
FFYRLGITSSYRLPNATANSPLRFQVFFNAGDSLN-KRE--LPQSFAAATGFSLVYKTAL
ANMDLTYALPLTEREQDVAKPGFSFGVELSFF
>KLTH0F16016g
MDLSDFSKELQKGSESSVVQRSSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPL
QTLDQSLSNFAEIKKKLIYTGLFRDVKISLDNEV--SSDELQSLPKDLVKGYALEMPIPT
IARIRLTPIN-LNRAS--LTSFTGDTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQST
FDEKVLEAKLLIPLQKNPSVKAVFDANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQK--
QWVNIKTGLAPVLYNGFSVVA--RN--LDEVRK--EASEAIRQFDAPFVKN-SFVSQLLV
DNRKFFGLFPASGLKFSINNEYVLSESFDKKAGTAVS---QNEGFDKLAVDFEAHRAFFG
NKIINSLELACGG-------IFSAGKSSSL-VHHIDKFYLGGMSSLKGFERNSVGQHGGK
LFYKLGLASSFKLPNTPANSPLRLQFFFNAGDVQNKKPT---QFSCAASSGVSLLYKSSL
ANMDLTYAFPLTNRGQDIQKPGFSFGVSLSLY
>Kwal_55.21418
MTLPQFSESLQQEAEEHLLQKSSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPL
QTLEQSLANFTEIKKKLIYTGMFSDVKISLDKDT--SGNGLKDLHQDAIKELSLESPVPT
IARILLKPLE-FNKLC--FTSSTNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNT
ALEKTLDAKVVVPLQKNPSVKAVFDTNYANIDLHGQPFVEKKDQHRQRQVSVNVGVQK--
QWLTSKMNLSPVFYNGFSVVA--RN--LHDVPN--EASGAIRQFNAPFLKN-SFVSQLVI
DNRKFFGLFPASGVKIALNNEYVLSQRFEKDSGNDMA---LDEGFNKCALSLEAQRSFFK
NKIINSLDIACGG-------ILPTGNSASL-VHHMDKFYLGGLASLKGFERNAVGQHGGN
FFYKLHVASSFKLPRTPQQSPLRLQFFLNAGEVSNEKPT---SVSCAASSGISLLYKSPL
ANMDLTYALPLSNRAQDVAKPGFSFGVSLSLY
>Kpol_1062.28
--MERFHEELKNEFVKENISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPI
QNVDTALGSFIDIKRNLLFTGLYNDVDVTLGADK--GGSLLNLSLKMVTDKIGIESIVPT
SATIRLKPNDLVTNLQ--TTFTTTSNDCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTS
WIQKYFKGEFILPFTKVPSLRTVLSVDVS---------EDKVSHLQRLNCNYKAGIQK--
LWLKDDLNTFPVFYSGLSIVN--NK----PIFNGEIPIDVPSPEQTPSYQS-GWLTTFSK
DSTKWLGSFPNSGECLNLKNEYVLSQLDSDN----KP---INTNINRFEANFEKYVSILN
SRVITTVLMNGGF-------QFPIDESTRS-------TFVGESWDKRNSLIKDIILNKSD
MNFKCGFISSFKLPNTELDSPLRLQISALTENKFKGLAN--YFDGCAADTGVSLVYKTKD
TNMALSYKVPLMQSSNSPATSGFSFDIAITYC
>TPHA0E01750
MIRDSIVF-------------SDTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPV
KSVQDVNLIFQNIRNNLILSGLYKNVDVKLDLDE--RASLLNHSLKLSTEQIGIESVVPI
SATLNMTPLY-LTPYKNYVTFNTSNTQNSVSLNRDWINLFGTSDTGTIKLSADLNQTKSE
IDKKSIDAKFTMPLLRNSSIRTILESKCS---------IAKPRNDTMKQFELNIGLTK--
LKLIGGIKSLPIFYSGLNIQR--KQTTLGPLSDEESETEIIGNISDEVINSLSLKSEYIT
DSRFYTSKFPSGGHLFKLVHQHVLNETNSIS--NEIK-----KNISNINMSFEKHISTLN
DQITSSFIFDGHV-------GVPLQST-------FANLNSGEFWDNEKEIFKTLCQNDIK
VSHKVGLVSSFRVPNIPITSPIRFQLSVLGINKSKRMAE--YLKNYSADTGVSLVYKGDH
SQMKLSYQIPL-IHGNDNKHSGLSFDVAVTYC