MUSCLE (3.8) multiple sequence alignment

ACR019W         MQEHMRSSGTERMTEVE-------RAGQAIQLSGSRAH---ESPEVGDKTLDVAAVAAVV
Ecym_3010       ----MSSSRSESVTPTSIALSINTNSDVCMRFDNSENQAICDGTKHGDEDEDRMNTVTGI
                    * ** :* :* ..       .:. .:.:..*  :   :..: **:  *   ..: :

ACR019W         AGEKVRGLPLMAGDLLGEDGS--LGHDMHALGKRQRILKDQLQSMSPQERLERQRAMRRK
Ecym_3010       S-ERTPPYSVSTRNTLVDANSSVLDSEILSLGKRQRILKGQLQSMSPQERLERQRAMRRR
                : *..   .: : : * : .*  *. :: :*********.*******************.

ACR019W         RDNAYRARKRATELTVDPELRQLFMALDKNKKFHSISAKYDAAALTPEFFPRVLLTKAET
Ecym_3010       RDNAYRARKRATELTVDPDLEQLFTTLDTSKQFHSISVKYDAASLSQEFFPRVLLNKSET
                ******************:* *** :**..*:*****.*****:*: ********.*:**

ACR019W         DDAALYKAPFDSFIECLRNKIRSFSGTKLSKERTSVHVTSVSCVLYCSQDKSHQRLLQTK
Ecym_3010       DDPAPYKAPFDSFIEGLRNKIKNVCGIKLSKERTSVHITSVSCVLYCSQDKSHQRLIQSK
                **.* ********** *****....* **********:******************:*:*

ACR019W         ETKKNSNLDNLKQYHCQSYMRVNYSFKTQVLSIKFRHIQHGDSPLLIGSDSNHPSCFDEK
Ecym_3010       DIQKSHNLDNAKQYQCQSYMRVNYSFKTHVLSIKFRHTKHNEQAILPSSTRI--------
                : :*. **** ***:*************:******** :*.:..:* .*           

FASTA FORMAT for MUSCLE Version 3.6

>ACR019W
MQEHMRSSGTERMTEVE-------RAGQAIQLSGSRAH---ESPEVGDKTLDVAAVAAVV
AGEKVRGLPLMAGDLLGEDGS--LGHDMHALGKRQRILKDQLQSMSPQERLERQRAMRRK
RDNAYRARKRATELTVDPELRQLFMALDKNKKFHSISAKYDAAALTPEFFPRVLLTKAET
DDAALYKAPFDSFIECLRNKIRSFSGTKLSKERTSVHVTSVSCVLYCSQDKSHQRLLQTK
ETKKNSNLDNLKQYHCQSYMRVNYSFKTQVLSIKFRHIQHGDSPLLIGSDSNHPSCFDEK
>Ecym_3010
----MSSSRSESVTPTSIALSINTNSDVCMRFDNSENQAICDGTKHGDEDEDRMNTVTGI
S-ERTPPYSVSTRNTLVDANSSVLDSEILSLGKRQRILKGQLQSMSPQERLERQRAMRRR
RDNAYRARKRATELTVDPDLEQLFTTLDTSKQFHSISVKYDAASLSQEFFPRVLLNKSET
DDPAPYKAPFDSFIEGLRNKIKNVCGIKLSKERTSVHITSVSCVLYCSQDKSHQRLIQSK
DIQKSHNLDNAKQYQCQSYMRVNYSFKTHVLSIKFRHTKHNEQAILPSSTRI--------