MUSCLE (3.8) multiple sequence alignment

ABR132C         LQSEQRKRNADTKLKFMTNIDESDEDRKLGTTEPAPLIISEVESDDDNSSLNSDHDAFPD
Ecym_8203       MLQTRSRRNADNQFKMMSNIEESEDEKKLETTEPAPLILSEVESDDDSLSINSDHDSFPD
                : . . .****.::*:*:**:**:::.** ********:********. *:*****:***

ABR132C         WQKLVYERLAARDQTTMNAIMLNFEKTGIVDLSTIDAQFLDNFRGAFVSAQQHLRRKGCV
Ecym_8203       WQKLVYERLGARDQTTMKAIIINFEKTGIVDLSNIDSNFLESFRTAFLSAQVYLQQKGCI
                *********.*******:**::***********.**::**:.** **:*** :*..***:

ABR132C         DEEQVNEQFGITSMMRILSGRTLYEEPVCSMSLLDQLKVTGAAPKGALQTNGDALPLRNA
Ecym_8203       DKSNVKEHFGITNIVRILSGRTLYEEPICSIELLDQLKQPSTP--------------HHS
                *:.:*:*:****.::************:**:.****** ..:.              .::

ABR132C         DDTPQVMAKPPYASQVPLADRISMYGLDGCESGA-SSDYEEGDAADELPFLVDDFDLPYS
Ecym_8203       YNLSQAIQKPPYESQIPLAERITLSGLEDCGSGGDSTEHDSNNTREGLPFLVDDFEVPYS
                 : .*.: **** **:***:**:: **:.* **. *::::..:: : ********::***

ABR132C         GLQSPAKKRNVDNNEQDQSNSSKRPRVGY
Ecym_8203       ELQSPVKRRNNTDNEKEDSSNIKRPRVA-
                 ****.*.**  :**:::*.. *****. 

FASTA FORMAT for MUSCLE Version 3.6

>ABR132C
LQSEQRKRNADTKLKFMTNIDESDEDRKLGTTEPAPLIISEVESDDDNSSLNSDHDAFPD
WQKLVYERLAARDQTTMNAIMLNFEKTGIVDLSTIDAQFLDNFRGAFVSAQQHLRRKGCV
DEEQVNEQFGITSMMRILSGRTLYEEPVCSMSLLDQLKVTGAAPKGALQTNGDALPLRNA
DDTPQVMAKPPYASQVPLADRISMYGLDGCESGA-SSDYEEGDAADELPFLVDDFDLPYS
GLQSPAKKRNVDNNEQDQSNSSKRPRVGY
>Ecym_8203
MLQTRSRRNADNQFKMMSNIEESEDEKKLETTEPAPLILSEVESDDDSLSINSDHDSFPD
WQKLVYERLGARDQTTMKAIIINFEKTGIVDLSNIDSNFLESFRTAFLSAQVYLQQKGCI
DKSNVKEHFGITNIVRILSGRTLYEEPICSIELLDQLKQPSTP--------------HHS
YNLSQAIQKPPYESQIPLAERITLSGLEDCGSGGDSTEHDSNNTREGLPFLVDDFEVPYS
ELQSPVKRRNNTDNEKEDSSNIKRPRVA-