MUSCLE (3.8) multiple sequence alignment

ABL123C           ---------MSWAKLVL---VCSFTYALCLHLATQNRFLEATETSRIYKLLAPTRIVSEI
Ecym_4614         ---------MFFILTAV---ILFLRLSLAFFPSSERRFLHN---GKVGKVATADFWFPN-
KLLA0D01507g      MFFKNGIRSGVFRLIILITYIFNLTFVQAFYPCSGERYLSA---GSAFKVESKNSKYAA-
SAKL0D01408g      ---------MTGPLLVIFLGVLFPSLALGFFPTSRDRFLQD---NSCYEVNALNKQHEE-
                                  :   :        :.  :  *:*     .   :: :        

ABL123C           KTSADDSTGSTLLKYNRSGAETKKSAQCNS----LTFRPNISLLKRDPLSRVHIIQATFG
Ecym_4614         EQVPSVRVGREFSFGDDSADAVKQAADDVLDPTYVHLSPAITILTRDSNSHAYIVNVTIS
KLLA0D01507g      QF---VNINDALSKQALQGQATAKSSTKNV---EVPVKPGMSILSTDSNTQAYFVNVTIG
SAKL0D01408g      ATSLGNFAGSSYTPQHYKDTAVSNSSNETF--AKIQVKPGISILQSDEHSQAYFVDVTIG
                          .        .   . :::        : . * :::*  *  :..::::.*:.

ABL123C           GVSYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGP
Ecym_4614         DEEYSLILDTGSAFPWVYG-DSCSLRACEGRKLYPTGG-KQTVNGSTFRLDYPYGITSGA
KLLA0D01507g      DEIYPLVVDSGSAYLWVYG-SSCTSKSCTSNKLFSTDNVKRAADESTFSLIYSSGTASGD
SAKL0D01408g      DVAYPLIIDTGSAYLWVYG-DSCNSSSCKGRKLFPTTNVLQDV--ASFSLAYTSGVAVGD
                  .  *.*::*:***  **** .*..     ..: : : .    .  : * : *  * : * 

ABL123C           LYTGTLSINGLKI-QDFRFGVAIGVPSLLDAYALSGIFGLPSDPTDSDTSVVGLLQGSKL
Ecym_4614         IFQDSFIINNLNTSETFAFGVATSVPQMFENYPVSGILGLPANSPGTVEPALSVLYRSKS
KLLA0D01507g      VYEDRIIVNKLATTQNFTFGVANEVPDIFENYPVSGIFGLPSNNSDNIESIISVLSESNA
SAKL0D01408g      VYHDRIIVNELATTDNFTFGVASEVPDIFENYPASGIFGLPSDNSQSIENIISKLRSSNA
                  :: . : :* *   : * ****  **.::: *. ***:***:: . .    :. *  *: 

ABL123C           INKKSFSVLLSHIPS-ESRN---------LDDNNGLIVFGEPLGALYEGELSYTPLVPNP
Ecym_4614         IRSQKFTLYLDHIES-ENTT---------LNANSGLFAIGEPITELYKGDIYYSELVVNP
KLLA0D01507g      ISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLYTGDIHYASLITNE
SAKL0D01408g      ISMEKFSILIGHINA-EVSEEEDGDVQD-LTSNKGIFAIGDELEGLYKGEIYYNSLIPDK
                  *  :.*:: :. : : :            *  *.*:: :*: :  ** *:: *  *: : 

ABL123C           QNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYF
Ecym_4614         NNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYL
KLLA0D01507g      NHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLILPTQDALDLHTFF
SAKL0D01408g      NSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHTYF
                  : :* : *.  : ..  * : . :  :  :.   **.*:*:*:*:::**  *** :*:::

ABL123C           DDSISDGKNFAIYCNSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDI
Ecym_4614         PGSITDGNYFAVFCNSTVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAI
KLLA0D01507g      VNSVSDGTNFAIPCNSTEILSLEINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLEL
SAKL0D01408g      GNSITDGTNFAIMCNSTQTLTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDI
                   .*::**. **: ***:  : :*:.  :*.* ...::*: * :.* * *******:*  :

ABL123C           SSSWILGEVFLQDLYTVFDIEGRQVGFANRNTKATLVHNEPQNYYEKNNS----------
Ecym_4614         HSSWILGDVFIKNFYTVFDMDNQQVGFALKNSNVNLVQN---SNISTN------------
KLLA0D01507g      DESWILGAVFLKDKYAVFDVQNQQFGLANKNENAILVPY---VNSATNSSDTISGDRSST
SAKL0D01408g      DDAWILGDVFLEGIYAVFDVENQRLGFAEGNENALLVPYSKETNATTSSTNNTSEPSSQS
                   .:**** **::. *:***::....*:*  * :. **         ..            

ABL123C           SLQMVSTSSDTTSSAAATSLHVSSTSKNIAYTPRPHPLLEQLLSLIYILVL
Ecym_4614         TLEATPLSSTTISSSHSTS-KSEGT-----FPLKLHNYLYYLVIYFSLWL-
KLLA0D01507g      TISASNLPATSTAASSSTS-KSGSTSFGLGSTIKPQSFMSWVATLILLAF-
SAKL0D01408g      TVEAT---LTSTTSASTTS-SSSKSNVGLSFSPRSRSLMLTIVMMIFNTA-
                  ::.       : ::: :**     :      . . .  :  :   :     

FASTA FORMAT for MUSCLE Version 3.6

>ABL123C
---------MSWAKLVL---VCSFTYALCLHLATQNRFLEATETSRIYKLLAPTRIVSEI
KTSADDSTGSTLLKYNRSGAETKKSAQCNS----LTFRPNISLLKRDPLSRVHIIQATFG
GVSYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTVTDSIFTIFYRSGTAHGP
LYTGTLSINGLKI-QDFRFGVAIGVPSLLDAYALSGIFGLPSDPTDSDTSVVGLLQGSKL
INKKSFSVLLSHIPS-ESRN---------LDDNNGLIVFGEPLGALYEGELSYTPLVPNP
QNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGIRSGIIDTGSTLVVLPQEDALALHSYF
DDSISDGKNFAIYCNSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDI
SSSWILGEVFLQDLYTVFDIEGRQVGFANRNTKATLVHNEPQNYYEKNNS----------
SLQMVSTSSDTTSSAAATSLHVSSTSKNIAYTPRPHPLLEQLLSLIYILVL
>Ecym_4614
---------MFFILTAV---ILFLRLSLAFFPSSERRFLHN---GKVGKVATADFWFPN-
EQVPSVRVGREFSFGDDSADAVKQAADDVLDPTYVHLSPAITILTRDSNSHAYIVNVTIS
DEEYSLILDTGSAFPWVYG-DSCSLRACEGRKLYPTGG-KQTVNGSTFRLDYPYGITSGA
IFQDSFIINNLNTSETFAFGVATSVPQMFENYPVSGILGLPANSPGTVEPALSVLYRSKS
IRSQKFTLYLDHIES-ENTT---------LNANSGLFAIGEPITELYKGDIYYSELVVNP
NNYWLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDIHSYL
PGSITDGNYFAVFCNSTVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAI
HSSWILGDVFIKNFYTVFDMDNQQVGFALKNSNVNLVQN---SNISTN------------
TLEATPLSSTTISSSHSTS-KSEGT-----FPLKLHNYLYYLVIYFSLWL-
>KLLA0D01507g
MFFKNGIRSGVFRLIILITYIFNLTFVQAFYPCSGERYLSA---GSAFKVESKNSKYAA-
QF---VNINDALSKQALQGQATAKSSTKNV---EVPVKPGMSILSTDSNTQAYFVNVTIG
DEIYPLVVDSGSAYLWVYG-SSCTSKSCTSNKLFSTDNVKRAADESTFSLIYSSGTASGD
VYEDRIIVNKLATTQNFTFGVANEVPDIFENYPVSGIFGLPSNNSDNIESIISVLSESNA
ISMEKFSLIIGALNSKDNTTSEDSALQAPLTENKGLFIIGDLVEDLYTGDIHYASLITNE
NHYWQLKIDSVYVNSQAVNFSTSEAVTGSQSSYIRSGIVDSGTTLLILPTQDALDLHTFF
VNSVSDGTNFAIPCNSTEILSLEINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLEL
DESWILGAVFLKDKYAVFDVQNQQFGLANKNENAILVPY---VNSATNSSDTISGDRSST
TISASNLPATSTAASSSTS-KSGSTSFGLGSTIKPQSFMSWVATLILLAF-
>SAKL0D01408g
---------MTGPLLVIFLGVLFPSLALGFFPTSRDRFLQD---NSCYEVNALNKQHEE-
ATSLGNFAGSSYTPQHYKDTAVSNSSNETF--AKIQVKPGISILQSDEHSQAYFVDVTIG
DVAYPLIIDTGSAYLWVYG-DSCNSSSCKGRKLFPTTNVLQDV--ASFSLAYTSGVAVGD
VYHDRIIVNELATTDNFTFGVASEVPDIFENYPASGIFGLPSDNSQSIENIISKLRSSNA
ISMEKFSILIGHINA-EVSEEEDGDVQD-LTSNKGIFAIGDELEGLYKGEIYYNSLIPDK
NSYWSLKINNLYVNDYKVNFTNYENFTGSKSHNTRSSIIDSGTTLLILPKQDALDIHTYF
GNSITDGTNFAIMCNSTQTLTLEFDNKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDI
DDAWILGDVFLEGIYAVFDVENQRLGFAEGNENALLVPYSKETNATTSSTNNTSEPSSQS
TVEAT---LTSTTSASTTS-SSSKSNVGLSFSPRSRSLMLTIVMMIFNTA-