MUSCLE (3.8) multiple sequence alignment

TBLA0E02040        MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD
KNAG0B02650        MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE
ACL157C            MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD
Ecym_4731          MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD
TBLA0E00480        MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD
KLLA0C16731g       MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD
SAKL0F10934g       MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD
KLTH0H01430g       MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD
Kwal_56.24610      MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD
KAFR0B00890        ----MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLD
KNAG0C03800        ----MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLD
ZYRO0F11550g       MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID
TPHA0D04560        MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD
KAFR0L01460        MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD
Suva_4.83          MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD
Skud_4.94          MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD
YDL161W            MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD
Smik_4.75          MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD
TDEL0C02050        MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID
CAGL0A03872g       MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD
Suva_10.300        MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD
Skud_12.270        MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD
Smik_12.264        MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD
YLR206W            MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD
Kpol_2001.70       MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD
NDAI0D00610        MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD
NCAS0H00670        MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD
                       ::*  ** .:**: .: ::*.**:*.        :  :.  ::.  .* :*. :::

TBLA0E02040        RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSD--S--AGI
KNAG0B02650        KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVD--D-GIGF
ACL157C            KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVD--E-STGV
Ecym_4731          RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVD--E-SSGT
TBLA0E00480        KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY
KLLA0C16731g       KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTD--E-FTEI
SAKL0F10934g       KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHED--E--MGV
KLTH0H01430g       KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHED--E--TGV
Kwal_56.24610      KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHED--E--LGI
KAFR0B00890        KRINSKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYED--E--SGM
KNAG0C03800        KRINDKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHED--A--GGE
ZYRO0F11550g       KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDD--D--GTQ
TPHA0D04560        KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYED--ENSGGV
KAFR0L01460        KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYED--D--TGI
Suva_4.83          KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDD--D--EGT
Skud_4.94          KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHED--D--EGV
YDL161W            KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHED--D--EGI
Smik_4.75          KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHED--D--EGI
TDEL0C02050        KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDD--D--GGV
CAGL0A03872g       KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHED--E-VSGS
Suva_10.300        KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHEN--E--SGF
Skud_12.270        KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHEN--E--SGF
Smik_12.264        KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHEN--E--SGF
YLR206W            KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHEN--E--SGF
Kpol_2001.70       KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYID--D--SDH
NDAI0D00610        KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLED--D---NV
NCAS0H00670        KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHED--D--GGA
                   .*:... . *.*: *:*   *:*:* *:* *. *..::   :  * :*   :        

TBLA0E02040        DQGQLIRVKAAELIDLLRDPERL------------ATERGMNMRGRRNA-----------
KNAG0B02650        DQGQIVRVKARDLVELLQSGEQLGGRKAKRARGASRRDRGRRRGGDRGGGEYRQRGDDPE
ACL157C            DHGQIIRVKARELVALLRDEERL------------REERNMRL-----------------
Ecym_4731          DHGQLIRVKAKELIALLRDDERL------------KEERNLRL-----------------
TBLA0E00480        DQGQIVRVRATELTSLLMDDERL------------REERSLHSRGGRRSAPPP-------
KLLA0C16731g       DNGEIVRVKAKELTALLRDEERL------------KEERMMRLKGRKRG-----------
SAKL0F10934g       DHGQIIRVKAKELTSLLRDEERL------------TEERNMRKKRRGKT-----------
KLTH0H01430g       DQGQIVRVKARELTALLQDEERL------------REERELKGRN---------------
Kwal_56.24610      DQGQIVRVKARELTALLLDDERL------------REERSLRTKN---------------
KAFR0B00890        DQGQMVRVRAKELTSLLMDEERL------------REERALNRRGG--------------
KNAG0C03800        DEGKIIRVKAKELTSLLMDEERL------------KEERAMNIRRR--------------
ZYRO0F11550g       DGGQIIRVKAKELTNLLMDDERL------------RMERGEDK-----------------
TPHA0D04560        DQGQIIRVKAKELTALLMDDERL------------REERRLNNRRDR-------------
KAFR0L01460        DQGQIIRVKAKELTSLLQDEERL------------REERRFNNRRNRRNN----------
Suva_4.83          DQGQIVRVKAKELTSLLSDEERL------------NEERNMNIKGRNRG-----------
Skud_4.94          DQGQIVRVKAKELTTLLSDDERL------------NEERNMNIKGRSRK-----------
YDL161W            DQGQIVRVKAKELTALLSDDERL------------NEERNMNIKGRNRK-----------
Smik_4.75          DQGQIVRVKSKELTALLSDDERL------------NEERNMNIKGRNRK-----------
TDEL0C02050        DQGQIIRVKAKELTNLLSDDERL------------REEREMNRKGRKNG-----------
CAGL0A03872g       DEGQIIRVKAKELTSLLTDDERL------------REERALNRANRRNGD----------
Suva_10.300        DEGQIIRVKAKELVSLLNDDERL------------REERTMNTRNRRTNKTAR-------
Skud_12.270        DEGQIIRVKAKELVSLLNDDERL------------REERSMNTRNRGANKAPR-------
Smik_12.264        DEGQIIRVKAKELVSLLNDDERL------------REERSMNTRNRRDRSAAR-------
YLR206W            DEGQIIRVKAKELVSLLNDEERL------------REERSMNTRNRRANRAAR-------
Kpol_2001.70       DQGQIIRVKAKELTSLLNDEERL------------RDERGMNRRGGRRER----------
NDAI0D00610        DESSIIRVKAKELTALLQDDERL------------KEERSINLKNNRRS-----------
NCAS0H00670        DQGQIIRVKAKELTSLLLDEERL------------KEERTINLKNRRDGD----------
                   * ..::**.: :*  ** . *.*              :*                     

TBLA0E02040        --------LPPRRMGPHRRPSMPRRPEDEEDVDRALEESKKTAEED--EARRR--KDQER
KNAG0B02650        DEYYPRPAGGPPP-QRQGYESGGARGNDDDDLQRAIEESKRTVQED--EERRRQLSMYDE
ACL157C            --------GRNPR-NRQASVPPPA-EDLDPDLQRALEESRITAEEE--ERRRREKTNQQQ
Ecym_4731          --------GRGKK-NPQNVPETNP-DGVDPDLKRALEESRITAEEE--ERRRK-LAEKTE
TBLA0E00480        ----RMAPQRRNT-SRSDFNRQRADDHYDDDLQKAIEESKRTAEED--ERRRR--NREGD
KLLA0C16731g       --------GRKNR-RDD--------NEDDDDLQRALEESRITAEEE--ERRRK-QLMMQG
SAKL0F10934g       --------RRPER-SRGG-------EEYDDDLQRALEESRLTAEEE--ERRRR-TDSGSN
KLTH0H01430g       --------RRPRR-RKNS-------DSYDDDMQRALEESRMTAEQEEAERRRK-LEMYDN
Kwal_56.24610      --------RKPRR-RPTA-------GSEDEDLQRAMEESRLTAEQEEAERRRK-LEIYDN
KAFR0B00890        --------GNRRR-AKSRN------SDDDDDLERAKEESRRTAREE--EELRR------R
KNAG0C03800        --------GGPKR-RSGGSRERN--NRSDEDLQRAIEESKRTAEEE--ERRRR---NGAS
ZYRO0F11550g       --------GAPPR-MMSPSPPTPRRNSYDSEMQRALDASRLTAEED--ERRRK---TLNN
TPHA0D04560        --------NRNRR-PPAR-------NGSDEDLQRALEESRRTAEED--ERKRR----LNQ
KAFR0L01460        --------RSANR-SRATSRSQSNIGPDDDDLQRVIEESKKTAEED--ERRRKELARYDE
Suva_4.83          --------GRRRR-RTNRS------SEDDDDLQRAIDASRMTADED--ERRRK-------
Skud_4.94          --------GRKRR-GTGRN------DEDDDDLQRAIDASRMTAEED--ERRRK-------
YDL161W            --------GRRRR-GTGRS------DENDDDLQRAISASRLTAEED--ERRRK-------
Smik_4.75          --------GRSRR-GTGRSS-----NDNDNDLQRALDASRMTAEED--EKRRK-------
TDEL0C02050        --------TRRRR-RTTGEQ-----DGFDDDLQRALDESRLTAEED--ERRRK---MLGS
CAGL0A03872g       --------AKRRR-RRSRSRSTSYRNAYDDDLQKALEESRMTAEEE--EARRREQAQYEN
Suva_10.300        ----PTPTPRPRR-QRTRSNLYDSPPTYQNDLEKALEESRITAQED--ELRRNEMAQYDD
Skud_12.270        --------PGPRR-QRTGSNPRDSSPSYQDELEKVLEESRITAQED--EQRRRELAQYDD
Smik_12.264        --------PRPRR-QRTRSNPHDSSPSYQNDLEKALEESRITAQED--EQRRRELAQYDD
YLR206W            --------PRPRR-QRTRSNPHDSSPSYQDDLEKALEESRITAQED--EQRRRELAQYDD
Kpol_2001.70       --------ARPRR-R----------PSDDDELQRAIEESKRTAEDD--DRRRR---MRDD
NDAI0D00610        --------ERKNR-SRRGTNATRRGTKSDEDLQKALEESRITAEED--ERRRRELAQYDN
NCAS0H00670        --------MKGRR-RRRGTRNGRGNDEDQDELQRALEESRLTAEED--ERRRRQMAQYDD
                                               : ::... . *. *. ::  :  *.       

TBLA0E02040        EKQDLKEAVKLSKEEDELKRLQDEANNK----------------------------PQYF
KNAG0B02650        EDPEFQAALQLSREEEELKNLQHLQRLQ-----------QQQQQQQ----QQQQLNTAYL
ACL157C            DNEELEVALQLSKEEEELRKLRELQQQR-----EQQMALWQQQQQQ----QPQ---AMYY
Ecym_4731          DAEELQAALQLSKEEEELRKLRELQQQR-----EQQMAFWQQQQVQQVQYQQQ---PMYY
TBLA0E00480        QEDDFETALQLSKEEEELKKLQELHAQQ-----------IALQNQQNATPTTQNVANVYT
KLLA0C16731g       DDSSLQAALELSKEEEELRRLQQLQAQQ-------QAALWQQQQQQ---------QPMYY
SAKL0F10934g       DDDDFQTALQLSKEEEELRRLRNLQMQQ------QQTAMFQQQQQQ----------PMYY
KLTH0H01430g       SADDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLQQQQT------QQ---PMYY
Kwal_56.24610      SSDDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLSQQQTQ----AQQ---PMYY
KAFR0B00890        QEAERQFALQLNQEEQELRALQQLQQQQ-------------QQQQQ----------PMYY
KNAG0C03800        SEADRQAALQLSREEEDLRRLQEQARLA-----------QQQQQQQ----QQQ---PMYY
ZYRO0F11550g       EDADLETALQLSKEEEELKRLQELQKAQ-------------QDQQR----LSQMQPQGYY
TPHA0D04560        DDSDLQAALQLSKEEEELKRLQELQSSM-----------HMQQQQ-----------PVYY
KAFR0L01460        EDPEFQAALQLSKEEEELKNLQDLQRQQ--------QQLQMLQQQQ----TSA---NVYY
Suva_4.83          QDEDYETALQLSKEEEELKRLQDLQRIQ-----------AQQQQQQ----QQQ---PMYC
Skud_4.94          QDEDYETALQLSKEEEELKRLQDLQRMQ-----------QVHAQQQ----QQQ---PMYY
YDL161W            QDEDYETALQLSKEEEELKRLQDLQRMQ-----------QQQGQQQ----LQQ---PMYY
Smik_4.75          MDEDYETALQLSKEEEELKRLQDLQRMQ-----------QLQTQQQ-----QQ---PMYY
TDEL0C02050        EDDDLQAALQLSKEEEELKRLQEMQKLQ-------------QQQTQ----QQP---SQYY
CAGL0A03872g       QDPDLLAALQLSKEEEELKKLQDMQRMQ-----------ELQAQQQ----QQ----NVYY
Suva_10.300        DDPDFQAALQLSKEEEELKQLQELQKQQ-----------QLQSQLQ----MPPQQQAAYY
Skud_12.270        EDPDFQAALQLSKEEEELKQLQELQRLQKQQQPLSQMPVPVQQQQQ----QQQQQLPAYY
Smik_12.264        EDPDFQAALQLSKEEEELKQLQELQRLQNQQQSLSQMQVPVQQQQE------Q---PAYY
YLR206W            EDPDFQAALQLSKEEEELKQLQELQRLQKQQQSLSQFQAPLQQQQP----QQQ---PAYY
Kpol_2001.70       EEADLQTALQLSKEEEELKRLQELQRLQ-------------QQQQQ----QQQQQQPMYY
NDAI0D00610        QDTDYQTALQLSKEEEELKKLQELQRLQ-QLQQQQQQQMQFQQQPQ----QQE---QVYY
NCAS0H00670        QDPDLQTALQLSKEEEELKKLQEMQRLQ-------------QQQGQ----MNQ--PQGYF
                      .   *::*..**::*. *.                                    * 

TBLA0E02040        DENGNPISQEEWLLREAQREEQQRLLEEQQRIAQQQALWLEQQRQAEMIALAQQQAALQQ
KNAG0B02650        DVFGNPVSQDEYQ-----------EYQRQQQVWEQ-----QQ----------EQQRLAQD
ACL157C            DIFGNPISLEEYL-----------QYQQQQQQ--------QQ----------QQQQLAQQ
Ecym_4731          DIFGNPITLEEYL-----------QYQQQQE---------QA----------QQQQLAQQ
TBLA0E00480        DIFGNPISYEEWL-----------QYQQQQQQQQLQQQQAQQALLEQQRLAEQQALWAQQ
KLLA0C16731g       DIFGNPISAEEYL-----------QYQ-------------------------QQQMLAQQ
SAKL0F10934g       DVFGNPITPEEYM-----------QYQQQLAA--------QQ----------QYQQLAAQ
KLTH0H01430g       DVFGNPISAEEYL-----------QYQQQM----------LE----------QQQMLEQQ
Kwal_56.24610      DVFGNPISAEEYL-----------QFQQ------------QM----------AQQQMAQQ
KAFR0B00890        DIFGNPITPEEYL-----------QF--------------QQ----------RQAALAQQ
KNAG0C03800        DVFGNPITPEEYL-----------QF--------------QQ----------QQALLAQQ
ZYRO0F11550g       DIFGNPISPEEYM-----------QYQQQQELLAKE----QQ----------QQELLAQQ
TPHA0D04560        DVFGNPISYEEYL-----------QYQMQQDQLQ------KQ----------QQNEWLLQ
KAFR0L01460        DVFGNPISYDEYM-----------EYQQQKQLWEQ-----QQ----------EQQRIAQE
Suva_4.83          DIFGNPITPEEYA-----------QFQLEQQ---------QQ----------QLLQLQQQ
Skud_4.94          DIFGNPITPEEYA-----------QFQL------------QQ----------QQQQLQQQ
YDL161W            DIFGNPITPEEYA-----------QFQLQQQQ--------QQ----------QQQQLQQQ
Smik_4.75          DIFGNPITPEEYA-----------QFQLQQQQQ-------LQ----------QQQLQQQQ
TDEL0C02050        DIFGNPISPEEYF-----------QY--------------QQ----------QQDLLAQQ
CAGL0A03872g       DIFGNPISPEEYY-----------QY--------------QE----------QQAALLAQ
Suva_10.300        DIFGNPISQDEYL-----------QYQYQ-----------QD----------QEQAMAQQ
Skud_12.270        DIFGNPISQDEYL-----------EYQYQ-----------QD----------QEQAMAQQ
Smik_12.264        DIFGNPISQDEYL-----------QYQYQ-----------QD----------QEQAMAQQ
YLR206W            DIFGNPISQDEYL-----------QYQYQ-----------QD----------QEQAMAQQ
Kpol_2001.70       DIFGNPISQEEYL-----------QYQLQQQQQQQQWLAQQQ----------QQELLAQQ
NDAI0D00610        DIFGNPISPEEYL-----------QF--------------QQ----------QQQAFAQQ
NCAS0H00670        DIFGNPISPDEYL-----------QF--------------QQ----------QQDAFAQQ
                   *  ***:: :*:                                               :

TBLA0E02040        QYEQAMIAQQQAALAQQ-YEQTALAQQQYEQAALAQQQYEQQAMLAQQQYEQQQAALAQ-
KNAG0B02650        QYMQLQQQQQ--------AQEQALQQQ--------------QQQAQEQALQLQQQQQAQE
ACL157C            MAEQYA------------AEQQYYAQQ--------------QYLAQQQQLAEQQYLAQQ-
Ecym_4731          QLLAQQLAEQQ-------ASADYYAQQ--------------QFLAQQRQMAEQQYLAQK-
TBLA0E00480        QQQQAALAHQQAEAAFYQQQAQAALEQ--------------QQLLQQQQAQAQAQAQAQQ
KLLA0C16731g       QQEQYM------------AEQQYLAAQ-------------QQYLAQQQMLAQQQQ-----
SAKL0F10934g       QQYQQLAQQQAL------AEQQYLAQQ--------------QYLQQQQQQQQQELAQQ--
KLTH0H01430g       QQQQALAQQL--------AQQQYLAQQ--------------QYLAQQQQQQQALAQQQYM
Kwal_56.24610      QYDQLAQQQQL-------AQQQQLAQQ--------------QYLAQQQYLSQQQQ-----
KAFR0B00890        QALLA---QQ---------------EQ--------------QYWAQQQA-----------
KNAG0C03800        ------------------QQQQAALEQ--------------QYWAQQQQNMLAQQQQQQQ
ZYRO0F11550g       QEQQRLLEQQ--------QEQQRLAEEQRRLAEEQQRQQEAQYWAMQQEALAQQQALAQQ
TPHA0D04560        QKQQDLLAQQ--------QQQEMLLQQ--------------QQFLLAQQQQQASYLAQQQ
KAFR0L01460        QYLAQ---QQQQAWE---EQQQALAQQ--------------QLWDQQQQQLQQQQQ----
Suva_4.83          QQQQQPMYYD--------MFGNPISPE--------------ELAQFQQEQQQQLYL----
Skud_4.94          QQQQEAMYYD--------VFGNPISPE--------------ELAHFQQQQYI--------
YDL161W            PMYYDVFGNP--------ITPEELAQ-----------------FQQQQQLQEQQYL----
Smik_4.75          PLYYDVFGNP--------ITPEELAQF--------------QQQQQQQQQQQQQYL----
TDEL0C02050        QREQELLAQQ--------QEQQRLAEQ--------------QYWAMQQEALAQQQALAEQ
CAGL0A03872g       QQQAVLLAQQ--------QQQAALLQQ------------------QQQQLYYDQM-----
Suva_10.300        RWLDQQ------------QEQQQLAEQ--------------QYFQQEQQAAAAAALQQQQ
Skud_12.270        KWLDQ---QQ---------EQQQLAEQ--------------QYFQQQQQAAASA------
Smik_12.264        RWLDQQ------------QEQQQLAEQ--------------QYFQQQQQAAAVAAT----
YLR206W            RWLDQQ------------QEQQQLAEQ--------------QYFQQQQQAAAAASALQQQ
Kpol_2001.70       QQQQELL-----------AQQELLAQQ--------------QYWALQQQQQQQQQA----
NDAI0D00610        QALQQ---QH--------LEQQRLAEE--------------QYRLLQQQQQQQQQ-----
NCAS0H00670        QLLQQ---QQ--------LEQQRQAEQ--------------QYLAMQQQQQQQQQ-----
                                                                  .            

TBLA0E02040        QQYEQQRYEQQLHEQQQLFEQQMAEQQESRPESGSNNPFALEKEEQDSGSNNPFSLTNYN
KNAG0B02650        QALQQQQQQQQALQQQQAQEQAMQQQQQQQ----QQFLQAQQQQPMTTGSNNPFAVNA--
ACL157C            QFLAQQQQQ----------------------------------PQFQSGPNNPFSLENMH
Ecym_4731          QYLSQQQQ------------------------------------PLQSGVNNPFSLNNMH
TBLA0E00480        AALAEQQRLAEQQRLAEQQRLAEQQAQQQQAALLAQQQTALNQQPMVTGTNNPFSLSN--
KLLA0C16731g       QLLAQQQQQ-------------------------------QFQMPLQTGSNNPFALNR--
SAKL0F10934g       QHLGQQLNF----------------------------QQQQQMQQAQTGSNNPFALGR--
KLTH0H01430g       QAYAQQQNA------------------------------QQQLLPLETGSNNPFAKNA--
Kwal_56.24610      QALAQQQYM--------------------------QAYAQQQLQPLETGSNNPFARHS--
KAFR0B00890        AFLSQQQQQ--------------------------------QQQPLATGSNNPFALNN--
KNAG0C03800        PLYGIQQQT------------------------------------LPTGSNNPFALNN--
ZYRO0F11550g       QALAQQQALARLQ-------------EQQRLAALQKQQEGYFQQPVSTGSNNPFALNG--
TPHA0D04560        AMMQQQQQM-----------------------------------PMQTGSNNPFALNN--
KAFR0L01460        QQLWQQEQV-----------------------------------PMVTGSNNPFSMDN--
Suva_4.83          SSLQQQQAT----------------------------------------SNNPFAKPN--
Skud_4.94          ASLQQQQQV---------------------------------------PSNNPFAKPN--
YDL161W            ASMQQQQQA---------------------------------------MSNNPFAKSE--
Smik_4.75          ASVQQQQQG---------------------------------------IPNNPFSKSE--
TDEL0C02050        QALAQQQAALQQN-------------QWYQ----QQQASGYYQQPMATGSNNPFALNN--
CAGL0A03872g       QQLQLQQPT------------------------------------LATGSNNPFSRDNI-
Suva_10.300        TAANMQQQQ------------------------QQQQQPANFQQALPTGSNNPFSMDNLE
Skud_12.270        AALQQQQTAANMQ-----------------------QQPANFQQPQPTGSNNPFSMDNLE
Smik_12.264        NAMEQQHTAANMQ---------------------QQQQPVDFQQPLPTGSNNPFSMDNLE
YLR206W            QTAANMQQQ--------------------------QQQPADFQQPLPTGSNNPFSMDNLE
Kpol_2001.70       ALLAQQQAA--------------------------------YQQPLATGSNNPFAMNN--
NDAI0D00610        QAYTQQQQS---------------------------------LQPLPTGSNNPFALNA--
NCAS0H00670        AALAAQQTA-------------------------LANQNAYYQQPLQTGSNNPFAMNN--
                                                                     ****:     

TBLA0E02040        TGTTTTTAAAATTAKYDSPQTSPVSPNEGLNLINANSNFTHMPMEEEGRSVSASTNAYSN
KNAG0B02650        -APIQQPNYTQSPNNYVSPQQNYAPPQ---------------------------------
ACL157C            KLNSD---GPQASGPYISTAGGFPDRA---------------------------------
Ecym_4731          KLESENYEKTASTSFGSPPGGTAGRSS---------------------------------
TBLA0E00480        --------------INNPQQQQPPLMS---------------------------------
KLLA0C16731g       ------------------------------------------------------------
SAKL0F10934g       ------------------------------------------------------------
KLTH0H01430g       ---------------QQPSAEDPSKYA---------------------------------
Kwal_56.24610      ------------NQNANEDASKYANVA---------------------------------
KAFR0B00890        --------------------------K---------------------------------
KNAG0C03800        -------------------------AT---------------------------------
ZYRO0F11550g       --------MPLQSNSKPQAASDLAGLN---------------------------------
TPHA0D04560        -------------QQTNNNNVQAASEL---------------------------------
KAFR0L01460        ----------------------LGKVN---------------------------------
Suva_4.83          --------------------------Q---------------------------------
Skud_4.94          --------------------------Q---------------------------------
YDL161W            ------------------------------------------------------------
Smik_4.75          --------------------------Q---------------------------------
TDEL0C02050        ------------------LQLQQARPA---------------------------------
CAGL0A03872g       --------------------------S---------------------------------
Suva_10.300        RQKQEQ--QHAQLQRQQEEARQQQEQL---------------------------------
Skud_12.270        RQKQEQ--QHAQLQRQQEEARQQQEAL---------------------------------
Smik_12.264        RQKQEQ--QHAQLQRQQEEARQQQEQL---------------------------------
YLR206W            RQKQEQ--QHAQLQRQQEEARQQQEQL---------------------------------
Kpol_2001.70       -----------QALQLNNQNDKAHSEL---------------------------------
NDAI0D00610        ------------------------TIN---------------------------------
NCAS0H00670        --------------------------F---------------------------------
                                                                               

TBLA0E02040        GNAYTNASYVHGTNTSYLTQNTLPTASTYQSSYSTGHEFTSSNINSSPLQNSKYVLHDHD
KNAG0B02650        --------------------------------------------PPRPSQPSQQQSPQQS
ACL157C            --------------------------------------------SSSPSLPQQKQQPQVL
Ecym_4731          --------------------------------------------SSTPLQQQPPQKPFPQ
TBLA0E00480        --------------------------------------------SSSTTLPDLSSFKQST
KLLA0C16731g       --------------------------------------------PPSPQEIEEIEEPDFT
SAKL0F10934g       --------------------------------------------QEPDEEQITPKVSESV
KLTH0H01430g       --------------------------------------------AASSPQRTQQLSPQLQ
Kwal_56.24610      --------------------------------------------PSPPQDNQLLSQQQQL
KAFR0B00890        --------------------------------------------KLQQHTPEPSVIDTTL
KNAG0C03800        --------------------------------------------QPSAPASTTAARPAAI
ZYRO0F11550g       --------------------------------------------NWGNNSTGQLEMPKYQ
TPHA0D04560        --------------------------------------------PDFTKPQAQSYQPAKL
KAFR0L01460        --------------------------------------------NAPPPQPVPQPQLAVQ
Suva_4.83          --------------------------------------------EASPQRQDQPSMNTSS
Skud_4.94          --------------------------------------------EVTSQKQDQSFMASSS
YDL161W            --------------------------------------------QSSSSPKRNQLVAASS
Smik_4.75          --------------------------------------------KSGIEEQGQSSTVDSS
TDEL0C02050        --------------------------------------------QSSPVPNFTSTQAQSP
CAGL0A03872g       --------------------------------------------NNNNTSANNALLPDLQ
Suva_10.300        --------------------------------------------KLQQLQRQQQEQAQLQ
Skud_12.270        --------------------------------------------KLQQQQRLQQEEAQLQ
Smik_12.264        --------------------------------------------KLQQLQRQQQEEAQLQ
YLR206W            --------------------------------------------KLQQLQRQQQEEAQLH
Kpol_2001.70       --------------------------------------------PDFNAKPVSAYQPAEL
NDAI0D00610        --------------------------------------------TSPIRPAEQQPQPQFT
NCAS0H00670        --------------------------------------------NNKP--AVESTQAYTA
                                                                               

TBLA0E02040        HDFVSRDSELVSRNSELVSHDQELLSHNNELSSQDDPFSNMHTLLPTNNNTNPSPSSSPL
KNAG0B02650        PQQ-------AYNPYSSPQQVPNAQFSGNVPTGSPG---------QEAHGRAPAPVPQPM
ACL157C            QQP---------------------------GQHSSP---------VPQLPRPQSQPGPQL
Ecym_4731          TQP--------------------------PSQSQSQ---------PQSQP-------QQL
TBLA0E00480        SVP---------------------------PATQSS---------YTTKTNASSLPPQPI
KLLA0C16731g       PVQ------------------------------LPP---------SPSPAAVPQQEFKPV
SAKL0F10934g       ATT------------------------------------------AGTTTATTTTQQQAL
KLTH0H01430g       PQP---------------------------EQFQQQ---------QQQIPQ------QPL
Kwal_56.24610      QQE---------------------------QQQQQQ---------QQQQPQPQPQP-QPL
KAFR0B00890        NTQ------------------------------------------------------APL
KNAG0C03800        ETP------------------------------------------ATQT--------KPL
ZYRO0F11550g       PRP-----------------------------QQPQ---------HNTAPE----P-QPM
TPHA0D04560        PEQ---------------------------IEIQQP---------VQQPVQ------QPL
KAFR0L01460        SPP----------------------------QQIPQ---------VAMPPLPQQQEQQPL
Suva_4.83          MPQ---------------------------QQQQQQ---------QQQQQQ----Q-EPL
Skud_4.94          MQQ------------------------------------------QQQQ--------QPL
YDL161W            PQQ------------------------------------------LQQQKQQ-----EPL
Smik_4.75          MQQ------------------------------------------QQQQQK----QQEPL
TDEL0C02050        PKP---------------------------QPQAQP---------QKQAPLPQQPQ-QAL
CAGL0A03872g       PKP---------------------------APSPQP---------QQQQPQ----Q-QPL
Suva_10.300        QQR-----------QQQEAQLQQQMQQQEAQLQQQR---------LQEQAQLQQQQQQPL
Skud_12.270        QKRQQQQQQQQAQLQQQQQQQQQQQQQQQAQLQQQQLLQQ-----QQLLLQQQQQQQQPL
Smik_12.264        QRR--------------------QQEESHLQQQQAQ---------LQLQQQQTQFQQQPL
YLR206W            QKR----------------------QEEAQLQQQQA---------QLLQQQAQFQQQQPL
Kpol_2001.70       PPQ--------------------------QQISLPP---------QPQQPQ------QPL
NDAI0D00610        APQ------------------------------------------QQQQPLQ-----QPL
NCAS0H00670        SAP---------------------------QLNQQP---------AQQQPQ----Q-QPL
                                                                              :

TBLA0E02040        QPMHTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVT
KNAG0B02650        PRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVN
ACL157C            QPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVG
Ecym_4731          QATRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVS
TBLA0E00480        PQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYI
KLLA0C16731g       PKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQIT
SAKL0F10934g       NPTRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVT
KLTH0H01430g       KQTRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVS
Kwal_56.24610      KQTRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVS
KAFR0B00890        KQTRTGSQSISDKYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQVS
KNAG0C03800        TQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVN
ZYRO0F11550g       QPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQYS
TPHA0D04560        QQNRTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQS
KAFR0L01460        KQNRTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVT
Suva_4.83          TQTRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVS
Skud_4.94          TQTRTGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQVS
YDL161W            IQNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVS
Smik_4.75          TQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVS
TDEL0C02050        KPVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVT
CAGL0A03872g       QKTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVT
Suva_10.300        TQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVV
Skud_12.270        EQTRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVT
Smik_12.264        KQTRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVI
YLR206W            KQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVT
Kpol_2001.70       KQTRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVT
NDAI0D00610        KQTRTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIV
NCAS0H00670        KQTRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVT
                      .:*.  :: *.. ** **.  ** ***** *  *:.:*** * .****:***:.*  

TBLA0E02040        S---SS--SPIPLLPTQYTGLPAQTAVHVPSPSPL--QPSEK------------------
KNAG0B02650        SEGKDP--NSNPFLNSQYTGLPSTGIVPAYTGYGFGNQSDQQNAPQQQQQY---------
ACL157C            N---EPP-KHNPFIATQYTGLPSTNMVPSHTGYGFGNAGNGF------------------
Ecym_4731          N---EPP-KHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQ------------------
TBLA0E00480        N---DP--KNNPFMSNQYTGLPSTNVVPSYTGYGFGNQPQPQTTASQPNT----------
KLLA0C16731g       ND--AP--KHNPFLTSQYTGIPSSAIAPSYTGYGFGNQASSS------------------
SAKL0F10934g       ND--QP--KNNPFLAAQYTGLPSTSVVPSYTGYGFGNQQLSSQQGQQLQ-----------
KLTH0H01430g       N---MPQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQK------------------
Kwal_56.24610      S---TP--KHNPFLGQQYTGLPSTNVVPSYTGYGFGNQPNQN------------------
KAFR0B00890        T---NG--FNNVFLNSQYTGLPSSNIVPSQTGYGFGN-----------------------
KNAG0C03800        N---DD--KPNPFLNGQYTGLPSTNIVPTQTGFGFGNQANSS------------------
ZYRO0F11550g       N---EP--KKNPFLPTQFTGIPTSSVVPSHTGYGFGNQQAQN------------------
TPHA0D04560        G---ES--KVNPFLSNQYTGLPSSNIIPTQTGYGFGNQPQQQ------------------
KAFR0L01460        N---ERS-KNNPFLNTQYTGLPSSNIVPSSTGYGFGNQPQDSAQNQYSQQQ---------
Suva_4.83          N---DP--KHNPFLNSQYTGLPSTNVVPAQTGYGFGNQPQQQ------------------
Skud_4.94          N---DP--KQNPFLNSQYTGLPSTNIVPTQTGYGFGNQPQQQ------------------
YDL161W            D---DP--NHNPFLNSQYTGLPSTSVVPTQTGYGFGNQSQQQ------------------
Smik_4.75          N---DP--KYNPFLSGQYTGLPSTNVVPTQTGYGFGNQPQQQ------------------
TDEL0C02050        G---EP--KKNPFLQSQYTGIPSSNIVPAHTGYGFGNQPSQQ------------------
CAGL0A03872g       N---EP--KNNPFLSSQYTGLPSTNIVPSHTGYGFGNQQQQQ------------------
Suva_10.300        N---EP--KNNPFLNSQYTGLPSTSIVPTQTGYGFGNQPQNPGMNSPPQNPANVNYSQPQ
Skud_12.270        S---EP--KNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQNPAVNSPPQNSTNINYS---
Smik_12.264        N---EP--KNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQSPPANSPPQNSINVSYS---
YLR206W            N---EP--KNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQSPPTNSPQQNPTGISYSQPQ
Kpol_2001.70       N---DP--KNNPFLNSQYTGLPSTNIVPSHTGYGFGNQQQQQ------------------
NDAI0D00610        N---DPV-KKNPFLNNQYTGLPSSNIVPSHTGYGFGNGPQQG------------------
NCAS0H00670        N---DP--KNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSQQ------------------
                               ::  *:**:*:       :   :                         

TBLA0E02040        ---EHQTQQT--------------------------------------------------
KNAG0B02650        ---QQQPQQQ-------QQQQQQPQQQYQQQPQQPYQQQPQQQ-----------------
ACL157C            ---QQSGNSN--------------------------------------------------
Ecym_4731          ---QTASKPN--------------------------------------------------
TBLA0E00480        ---QQYQQPN-----------------------------------------------QQH
KLLA0C16731g       ---SQQNNFS--------------------------------------------------
SAKL0F10934g       ---QQQQQQQ--------------------------------------------------
KLTH0H01430g       ---QTNQNRA--------------------------------------------------
Kwal_56.24610      ---QQNQNQS--------------------------------------------------
KAFR0B00890        ---STVNNNN--------------------------------------------------
KNAG0C03800        ---GTNNNNN--------------------------------------------------
ZYRO0F11550g       ---QQISQPP--------------------------------------------------
TPHA0D04560        ---QYQQQQQ--------------------------------------------------
KAFR0L01460        ---QQYSQPQYNQAYPQQQQQQQQPNQQYQQMAYQQQYNLQQP----------------Q
Suva_4.83          ---SQTNGTN--------------------------------------------------
Skud_4.94          ---SQNNRSN--------------------------------------------------
YDL161W            ---SQNNGSN--------------------------------------------------
Smik_4.75          ---SQNNHLN--------------------------------------------------
TDEL0C02050        ---NQAQQHQ--------------------------------------------------
CAGL0A03872g       ---QQQQQQQ-------QQQQQQPQQNYNYNQQQNYQYQQQPQ------------QYQQQ
Suva_10.300        ---QQQQQPQYTQSY--QQQQPQYTQNYQQQPQYAQNYQQAPPQQQQQQQ---QQQQPQQ
Skud_12.270        ---QPQQQPQYTQNY---QQQPQYAEIPQQQQQ-----TQQPQYTQNYQQGSS---QPQQ
Smik_12.264        ---QSQQQPQYTQGYQQQQQQPQYAQNIQQQPQYAQNIQQQPQYTQNYHQGSSQQQQQQQ
YLR206W            QQQQPQQQPQYMQNF--QQQQPQYAQNFQQQPQYTQNYQQQPQYIQPHQQ--QQQQQQQQ
Kpol_2001.70       ---QQQQQQQ-------QQQQQLQQQQYQQQQQQQQQYQPQQQYQQQYQQ----------
NDAI0D00610        ---QGQAPPP--------------------------------------------------
NCAS0H00670        ---QQQQQQQ--------------------------------------------------
                                                                               

TBLA0E02040        ---------QGFTLVDL
KNAG0B02650        ----QQPPDQVVSLIDL
ACL157C            -----KPNEQNISLIDI
Ecym_4731          --------DQGMSLIDL
TBLA0E00480        AQQQQNSNAQGFSLIDL
KLLA0C16731g       NRNGNSNNINNTNLIDL
SAKL0F10934g       --QQRGNPDQGISLIDL
KLTH0H01430g       -----NGADQGVSLIDL
Kwal_56.24610      -----NGADQGMSLIDL
KAFR0B00890        -------------LVDL
KNAG0C03800        --------NNG-TLVDL
ZYRO0F11550g       ---QQQQADQGVSLIDL
TPHA0D04560        -----QNNNQGVSLIDL
KAFR0L01460        QQSNSAAPDQSISLIDL
Suva_4.83          --------SQGYALIDL
Skud_4.94          --------SQGYTLIDL
YDL161W            --------NRGYTLIDL
Smik_4.75          --------NQGYALIDL
TDEL0C02050        ------TADQGVSLIDL
CAGL0A03872g       QQQQFATPDQGVSLIDL
Suva_10.300        QQQQGYAPDQGISLIDL
Skud_12.270        PQQQGYTPDQGISLIDL
Smik_12.264        QQQQGYAPDQGISLIDL
YLR206W            QQQQGYTPDQGVSLIDL
Kpol_2001.70       -QPQQQSYDQGVSLIDL
NDAI0D00610        -QQQQQQSQQSFSLIDL
NCAS0H00670        ----QQRPDQGFSLIDL
                                *:*:

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0E02040
MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD
RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSD--S--AGI
DQGQLIRVKAAELIDLLRDPERL------------ATERGMNMRGRRNA-----------
--------LPPRRMGPHRRPSMPRRPEDEEDVDRALEESKKTAEED--EARRR--KDQER
EKQDLKEAVKLSKEEDELKRLQDEANNK----------------------------PQYF
DENGNPISQEEWLLREAQREEQQRLLEEQQRIAQQQALWLEQQRQAEMIALAQQQAALQQ
QYEQAMIAQQQAALAQQ-YEQTALAQQQYEQAALAQQQYEQQAMLAQQQYEQQQAALAQ-
QQYEQQRYEQQLHEQQQLFEQQMAEQQESRPESGSNNPFALEKEEQDSGSNNPFSLTNYN
TGTTTTTAAAATTAKYDSPQTSPVSPNEGLNLINANSNFTHMPMEEEGRSVSASTNAYSN
GNAYTNASYVHGTNTSYLTQNTLPTASTYQSSYSTGHEFTSSNINSSPLQNSKYVLHDHD
HDFVSRDSELVSRNSELVSHDQELLSHNNELSSQDDPFSNMHTLLPTNNNTNPSPSSSPL
QPMHTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVT
S---SS--SPIPLLPTQYTGLPAQTAVHVPSPSPL--QPSEK------------------
---EHQTQQT--------------------------------------------------
---------QGFTLVDL
>KNAG0B02650
MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE
KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVD--D-GIGF
DQGQIVRVKARDLVELLQSGEQLGGRKAKRARGASRRDRGRRRGGDRGGGEYRQRGDDPE
DEYYPRPAGGPPP-QRQGYESGGARGNDDDDLQRAIEESKRTVQED--EERRRQLSMYDE
EDPEFQAALQLSREEEELKNLQHLQRLQ-----------QQQQQQQ----QQQQLNTAYL
DVFGNPVSQDEYQ-----------EYQRQQQVWEQ-----QQ----------EQQRLAQD
QYMQLQQQQQ--------AQEQALQQQ--------------QQQAQEQALQLQQQQQAQE
QALQQQQQQQQALQQQQAQEQAMQQQQQQQ----QQFLQAQQQQPMTTGSNNPFAVNA--
-APIQQPNYTQSPNNYVSPQQNYAPPQ---------------------------------
--------------------------------------------PPRPSQPSQQQSPQQS
PQQ-------AYNPYSSPQQVPNAQFSGNVPTGSPG---------QEAHGRAPAPVPQPM
PRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVN
SEGKDP--NSNPFLNSQYTGLPSTGIVPAYTGYGFGNQSDQQNAPQQQQQY---------
---QQQPQQQ-------QQQQQQPQQQYQQQPQQPYQQQPQQQ-----------------
----QQPPDQVVSLIDL
>ACL157C
MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD
KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVD--E-STGV
DHGQIIRVKARELVALLRDEERL------------REERNMRL-----------------
--------GRNPR-NRQASVPPPA-EDLDPDLQRALEESRITAEEE--ERRRREKTNQQQ
DNEELEVALQLSKEEEELRKLRELQQQR-----EQQMALWQQQQQQ----QPQ---AMYY
DIFGNPISLEEYL-----------QYQQQQQQ--------QQ----------QQQQLAQQ
MAEQYA------------AEQQYYAQQ--------------QYLAQQQQLAEQQYLAQQ-
QFLAQQQQQ----------------------------------PQFQSGPNNPFSLENMH
KLNSD---GPQASGPYISTAGGFPDRA---------------------------------
--------------------------------------------SSSPSLPQQKQQPQVL
QQP---------------------------GQHSSP---------VPQLPRPQSQPGPQL
QPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVG
N---EPP-KHNPFIATQYTGLPSTNMVPSHTGYGFGNAGNGF------------------
---QQSGNSN--------------------------------------------------
-----KPNEQNISLIDI
>Ecym_4731
MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD
RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVD--E-SSGT
DHGQLIRVKAKELIALLRDDERL------------KEERNLRL-----------------
--------GRGKK-NPQNVPETNP-DGVDPDLKRALEESRITAEEE--ERRRK-LAEKTE
DAEELQAALQLSKEEEELRKLRELQQQR-----EQQMAFWQQQQVQQVQYQQQ---PMYY
DIFGNPITLEEYL-----------QYQQQQE---------QA----------QQQQLAQQ
QLLAQQLAEQQ-------ASADYYAQQ--------------QFLAQQRQMAEQQYLAQK-
QYLSQQQQ------------------------------------PLQSGVNNPFSLNNMH
KLESENYEKTASTSFGSPPGGTAGRSS---------------------------------
--------------------------------------------SSTPLQQQPPQKPFPQ
TQP--------------------------PSQSQSQ---------PQSQP-------QQL
QATRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVS
N---EPP-KHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQ------------------
---QTASKPN--------------------------------------------------
--------DQGMSLIDL
>TBLA0E00480
MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD
KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY
DQGQIVRVRATELTSLLMDDERL------------REERSLHSRGGRRSAPPP-------
----RMAPQRRNT-SRSDFNRQRADDHYDDDLQKAIEESKRTAEED--ERRRR--NREGD
QEDDFETALQLSKEEEELKKLQELHAQQ-----------IALQNQQNATPTTQNVANVYT
DIFGNPISYEEWL-----------QYQQQQQQQQLQQQQAQQALLEQQRLAEQQALWAQQ
QQQQAALAHQQAEAAFYQQQAQAALEQ--------------QQLLQQQQAQAQAQAQAQQ
AALAEQQRLAEQQRLAEQQRLAEQQAQQQQAALLAQQQTALNQQPMVTGTNNPFSLSN--
--------------INNPQQQQPPLMS---------------------------------
--------------------------------------------SSSTTLPDLSSFKQST
SVP---------------------------PATQSS---------YTTKTNASSLPPQPI
PQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYI
N---DP--KNNPFMSNQYTGLPSTNVVPSYTGYGFGNQPQPQTTASQPNT----------
---QQYQQPN-----------------------------------------------QQH
AQQQQNSNAQGFSLIDL
>KLLA0C16731g
MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD
KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTD--E-FTEI
DNGEIVRVKAKELTALLRDEERL------------KEERMMRLKGRKRG-----------
--------GRKNR-RDD--------NEDDDDLQRALEESRITAEEE--ERRRK-QLMMQG
DDSSLQAALELSKEEEELRRLQQLQAQQ-------QAALWQQQQQQ---------QPMYY
DIFGNPISAEEYL-----------QYQ-------------------------QQQMLAQQ
QQEQYM------------AEQQYLAAQ-------------QQYLAQQQMLAQQQQ-----
QLLAQQQQQ-------------------------------QFQMPLQTGSNNPFALNR--
------------------------------------------------------------
--------------------------------------------PPSPQEIEEIEEPDFT
PVQ------------------------------LPP---------SPSPAAVPQQEFKPV
PKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQIT
ND--AP--KHNPFLTSQYTGIPSSAIAPSYTGYGFGNQASSS------------------
---SQQNNFS--------------------------------------------------
NRNGNSNNINNTNLIDL
>SAKL0F10934g
MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD
KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHED--E--MGV
DHGQIIRVKAKELTSLLRDEERL------------TEERNMRKKRRGKT-----------
--------RRPER-SRGG-------EEYDDDLQRALEESRLTAEEE--ERRRR-TDSGSN
DDDDFQTALQLSKEEEELRRLRNLQMQQ------QQTAMFQQQQQQ----------PMYY
DVFGNPITPEEYM-----------QYQQQLAA--------QQ----------QYQQLAAQ
QQYQQLAQQQAL------AEQQYLAQQ--------------QYLQQQQQQQQQELAQQ--
QHLGQQLNF----------------------------QQQQQMQQAQTGSNNPFALGR--
------------------------------------------------------------
--------------------------------------------QEPDEEQITPKVSESV
ATT------------------------------------------AGTTTATTTTQQQAL
NPTRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVT
ND--QP--KNNPFLAAQYTGLPSTSVVPSYTGYGFGNQQLSSQQGQQLQ-----------
---QQQQQQQ--------------------------------------------------
--QQRGNPDQGISLIDL
>KLTH0H01430g
MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD
KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHED--E--TGV
DQGQIVRVKARELTALLQDEERL------------REERELKGRN---------------
--------RRPRR-RKNS-------DSYDDDMQRALEESRMTAEQEEAERRRK-LEMYDN
SADDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLQQQQT------QQ---PMYY
DVFGNPISAEEYL-----------QYQQQM----------LE----------QQQMLEQQ
QQQQALAQQL--------AQQQYLAQQ--------------QYLAQQQQQQQALAQQQYM
QAYAQQQNA------------------------------QQQLLPLETGSNNPFAKNA--
---------------QQPSAEDPSKYA---------------------------------
--------------------------------------------AASSPQRTQQLSPQLQ
PQP---------------------------EQFQQQ---------QQQIPQ------QPL
KQTRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVS
N---MPQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQK------------------
---QTNQNRA--------------------------------------------------
-----NGADQGVSLIDL
>Kwal_56.24610
MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD
KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHED--E--LGI
DQGQIVRVKARELTALLLDDERL------------REERSLRTKN---------------
--------RKPRR-RPTA-------GSEDEDLQRAMEESRLTAEQEEAERRRK-LEIYDN
SSDDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLSQQQTQ----AQQ---PMYY
DVFGNPISAEEYL-----------QFQQ------------QM----------AQQQMAQQ
QYDQLAQQQQL-------AQQQQLAQQ--------------QYLAQQQYLSQQQQ-----
QALAQQQYM--------------------------QAYAQQQLQPLETGSNNPFARHS--
------------NQNANEDASKYANVA---------------------------------
--------------------------------------------PSPPQDNQLLSQQQQL
QQE---------------------------QQQQQQ---------QQQQPQPQPQP-QPL
KQTRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVS
S---TP--KHNPFLGQQYTGLPSTNVVPSYTGYGFGNQPNQN------------------
---QQNQNQS--------------------------------------------------
-----NGADQGMSLIDL
>KAFR0B00890
----MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLD
KRINSKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYED--E--SGM
DQGQMVRVRAKELTSLLMDEERL------------REERALNRRGG--------------
--------GNRRR-AKSRN------SDDDDDLERAKEESRRTAREE--EELRR------R
QEAERQFALQLNQEEQELRALQQLQQQQ-------------QQQQQ----------PMYY
DIFGNPITPEEYL-----------QF--------------QQ----------RQAALAQQ
QALLA---QQ---------------EQ--------------QYWAQQQA-----------
AFLSQQQQQ--------------------------------QQQPLATGSNNPFALNN--
--------------------------K---------------------------------
--------------------------------------------KLQQHTPEPSVIDTTL
NTQ------------------------------------------------------APL
KQTRTGSQSISDKYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQVS
T---NG--FNNVFLNSQYTGLPSSNIVPSQTGYGFGN-----------------------
---STVNNNN--------------------------------------------------
-------------LVDL
>KNAG0C03800
----MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLD
KRINDKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHED--A--GGE
DEGKIIRVKAKELTSLLMDEERL------------KEERAMNIRRR--------------
--------GGPKR-RSGGSRERN--NRSDEDLQRAIEESKRTAEEE--ERRRR---NGAS
SEADRQAALQLSREEEDLRRLQEQARLA-----------QQQQQQQ----QQQ---PMYY
DVFGNPITPEEYL-----------QF--------------QQ----------QQALLAQQ
------------------QQQQAALEQ--------------QYWAQQQQNMLAQQQQQQQ
PLYGIQQQT------------------------------------LPTGSNNPFALNN--
-------------------------AT---------------------------------
--------------------------------------------QPSAPASTTAARPAAI
ETP------------------------------------------ATQT--------KPL
TQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVN
N---DD--KPNPFLNGQYTGLPSTNIVPTQTGFGFGNQANSS------------------
---GTNNNNN--------------------------------------------------
--------NNG-TLVDL
>ZYRO0F11550g
MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID
KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDD--D--GTQ
DGGQIIRVKAKELTNLLMDDERL------------RMERGEDK-----------------
--------GAPPR-MMSPSPPTPRRNSYDSEMQRALDASRLTAEED--ERRRK---TLNN
EDADLETALQLSKEEEELKRLQELQKAQ-------------QDQQR----LSQMQPQGYY
DIFGNPISPEEYM-----------QYQQQQELLAKE----QQ----------QQELLAQQ
QEQQRLLEQQ--------QEQQRLAEEQRRLAEEQQRQQEAQYWAMQQEALAQQQALAQQ
QALAQQQALARLQ-------------EQQRLAALQKQQEGYFQQPVSTGSNNPFALNG--
--------MPLQSNSKPQAASDLAGLN---------------------------------
--------------------------------------------NWGNNSTGQLEMPKYQ
PRP-----------------------------QQPQ---------HNTAPE----P-QPM
QPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQYS
N---EP--KKNPFLPTQFTGIPTSSVVPSHTGYGFGNQQAQN------------------
---QQISQPP--------------------------------------------------
---QQQQADQGVSLIDL
>TPHA0D04560
MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD
KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYED--ENSGGV
DQGQIIRVKAKELTALLMDDERL------------REERRLNNRRDR-------------
--------NRNRR-PPAR-------NGSDEDLQRALEESRRTAEED--ERKRR----LNQ
DDSDLQAALQLSKEEEELKRLQELQSSM-----------HMQQQQ-----------PVYY
DVFGNPISYEEYL-----------QYQMQQDQLQ------KQ----------QQNEWLLQ
QKQQDLLAQQ--------QQQEMLLQQ--------------QQFLLAQQQQQASYLAQQQ
AMMQQQQQM-----------------------------------PMQTGSNNPFALNN--
-------------QQTNNNNVQAASEL---------------------------------
--------------------------------------------PDFTKPQAQSYQPAKL
PEQ---------------------------IEIQQP---------VQQPVQ------QPL
QQNRTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQS
G---ES--KVNPFLSNQYTGLPSSNIIPTQTGYGFGNQPQQQ------------------
---QYQQQQQ--------------------------------------------------
-----QNNNQGVSLIDL
>KAFR0L01460
MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD
KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYED--D--TGI
DQGQIIRVKAKELTSLLQDEERL------------REERRFNNRRNRRNN----------
--------RSANR-SRATSRSQSNIGPDDDDLQRVIEESKKTAEED--ERRRKELARYDE
EDPEFQAALQLSKEEEELKNLQDLQRQQ--------QQLQMLQQQQ----TSA---NVYY
DVFGNPISYDEYM-----------EYQQQKQLWEQ-----QQ----------EQQRIAQE
QYLAQ---QQQQAWE---EQQQALAQQ--------------QLWDQQQQQLQQQQQ----
QQLWQQEQV-----------------------------------PMVTGSNNPFSMDN--
----------------------LGKVN---------------------------------
--------------------------------------------NAPPPQPVPQPQLAVQ
SPP----------------------------QQIPQ---------VAMPPLPQQQEQQPL
KQNRTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVT
N---ERS-KNNPFLNTQYTGLPSSNIVPSSTGYGFGNQPQDSAQNQYSQQQ---------
---QQYSQPQYNQAYPQQQQQQQQPNQQYQQMAYQQQYNLQQP----------------Q
QQSNSAAPDQSISLIDL
>Suva_4.83
MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD
KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDD--D--EGT
DQGQIVRVKAKELTSLLSDEERL------------NEERNMNIKGRNRG-----------
--------GRRRR-RTNRS------SEDDDDLQRAIDASRMTADED--ERRRK-------
QDEDYETALQLSKEEEELKRLQDLQRIQ-----------AQQQQQQ----QQQ---PMYC
DIFGNPITPEEYA-----------QFQLEQQ---------QQ----------QLLQLQQQ
QQQQQPMYYD--------MFGNPISPE--------------ELAQFQQEQQQQLYL----
SSLQQQQAT----------------------------------------SNNPFAKPN--
--------------------------Q---------------------------------
--------------------------------------------EASPQRQDQPSMNTSS
MPQ---------------------------QQQQQQ---------QQQQQQ----Q-EPL
TQTRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVS
N---DP--KHNPFLNSQYTGLPSTNVVPAQTGYGFGNQPQQQ------------------
---SQTNGTN--------------------------------------------------
--------SQGYALIDL
>Skud_4.94
MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD
KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHED--D--EGV
DQGQIVRVKAKELTTLLSDDERL------------NEERNMNIKGRSRK-----------
--------GRKRR-GTGRN------DEDDDDLQRAIDASRMTAEED--ERRRK-------
QDEDYETALQLSKEEEELKRLQDLQRMQ-----------QVHAQQQ----QQQ---PMYY
DIFGNPITPEEYA-----------QFQL------------QQ----------QQQQLQQQ
QQQQEAMYYD--------VFGNPISPE--------------ELAHFQQQQYI--------
ASLQQQQQV---------------------------------------PSNNPFAKPN--
--------------------------Q---------------------------------
--------------------------------------------EVTSQKQDQSFMASSS
MQQ------------------------------------------QQQQ--------QPL
TQTRTGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQVS
N---DP--KQNPFLNSQYTGLPSTNIVPTQTGYGFGNQPQQQ------------------
---SQNNRSN--------------------------------------------------
--------SQGYTLIDL
>YDL161W
MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD
KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHED--D--EGI
DQGQIVRVKAKELTALLSDDERL------------NEERNMNIKGRNRK-----------
--------GRRRR-GTGRS------DENDDDLQRAISASRLTAEED--ERRRK-------
QDEDYETALQLSKEEEELKRLQDLQRMQ-----------QQQGQQQ----LQQ---PMYY
DIFGNPITPEEYA-----------QFQLQQQQ--------QQ----------QQQQLQQQ
PMYYDVFGNP--------ITPEELAQ-----------------FQQQQQLQEQQYL----
ASMQQQQQA---------------------------------------MSNNPFAKSE--
------------------------------------------------------------
--------------------------------------------QSSSSPKRNQLVAASS
PQQ------------------------------------------LQQQKQQ-----EPL
IQNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVS
D---DP--NHNPFLNSQYTGLPSTSVVPTQTGYGFGNQSQQQ------------------
---SQNNGSN--------------------------------------------------
--------NRGYTLIDL
>Smik_4.75
MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD
KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHED--D--EGI
DQGQIVRVKSKELTALLSDDERL------------NEERNMNIKGRNRK-----------
--------GRSRR-GTGRSS-----NDNDNDLQRALDASRMTAEED--EKRRK-------
MDEDYETALQLSKEEEELKRLQDLQRMQ-----------QLQTQQQ-----QQ---PMYY
DIFGNPITPEEYA-----------QFQLQQQQQ-------LQ----------QQQLQQQQ
PLYYDVFGNP--------ITPEELAQF--------------QQQQQQQQQQQQQYL----
ASVQQQQQG---------------------------------------IPNNPFSKSE--
--------------------------Q---------------------------------
--------------------------------------------KSGIEEQGQSSTVDSS
MQQ------------------------------------------QQQQQK----QQEPL
TQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVS
N---DP--KYNPFLSGQYTGLPSTNVVPTQTGYGFGNQPQQQ------------------
---SQNNHLN--------------------------------------------------
--------NQGYALIDL
>TDEL0C02050
MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID
KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDD--D--GGV
DQGQIIRVKAKELTNLLSDDERL------------REEREMNRKGRKNG-----------
--------TRRRR-RTTGEQ-----DGFDDDLQRALDESRLTAEED--ERRRK---MLGS
EDDDLQAALQLSKEEEELKRLQEMQKLQ-------------QQQTQ----QQP---SQYY
DIFGNPISPEEYF-----------QY--------------QQ----------QQDLLAQQ
QREQELLAQQ--------QEQQRLAEQ--------------QYWAMQQEALAQQQALAEQ
QALAQQQAALQQN-------------QWYQ----QQQASGYYQQPMATGSNNPFALNN--
------------------LQLQQARPA---------------------------------
--------------------------------------------QSSPVPNFTSTQAQSP
PKP---------------------------QPQAQP---------QKQAPLPQQPQ-QAL
KPVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVT
G---EP--KKNPFLQSQYTGIPSSNIVPAHTGYGFGNQPSQQ------------------
---NQAQQHQ--------------------------------------------------
------TADQGVSLIDL
>CAGL0A03872g
MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD
KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHED--E-VSGS
DEGQIIRVKAKELTSLLTDDERL------------REERALNRANRRNGD----------
--------AKRRR-RRSRSRSTSYRNAYDDDLQKALEESRMTAEEE--EARRREQAQYEN
QDPDLLAALQLSKEEEELKKLQDMQRMQ-----------ELQAQQQ----QQ----NVYY
DIFGNPISPEEYY-----------QY--------------QE----------QQAALLAQ
QQQAVLLAQQ--------QQQAALLQQ------------------QQQQLYYDQM-----
QQLQLQQPT------------------------------------LATGSNNPFSRDNI-
--------------------------S---------------------------------
--------------------------------------------NNNNTSANNALLPDLQ
PKP---------------------------APSPQP---------QQQQPQ----Q-QPL
QKTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVT
N---EP--KNNPFLSSQYTGLPSTNIVPSHTGYGFGNQQQQQ------------------
---QQQQQQQ-------QQQQQQPQQNYNYNQQQNYQYQQQPQ------------QYQQQ
QQQQFATPDQGVSLIDL
>Suva_10.300
MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD
KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHEN--E--SGF
DEGQIIRVKAKELVSLLNDDERL------------REERTMNTRNRRTNKTAR-------
----PTPTPRPRR-QRTRSNLYDSPPTYQNDLEKALEESRITAQED--ELRRNEMAQYDD
DDPDFQAALQLSKEEEELKQLQELQKQQ-----------QLQSQLQ----MPPQQQAAYY
DIFGNPISQDEYL-----------QYQYQ-----------QD----------QEQAMAQQ
RWLDQQ------------QEQQQLAEQ--------------QYFQQEQQAAAAAALQQQQ
TAANMQQQQ------------------------QQQQQPANFQQALPTGSNNPFSMDNLE
RQKQEQ--QHAQLQRQQEEARQQQEQL---------------------------------
--------------------------------------------KLQQLQRQQQEQAQLQ
QQR-----------QQQEAQLQQQMQQQEAQLQQQR---------LQEQAQLQQQQQQPL
TQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVV
N---EP--KNNPFLNSQYTGLPSTSIVPTQTGYGFGNQPQNPGMNSPPQNPANVNYSQPQ
---QQQQQPQYTQSY--QQQQPQYTQNYQQQPQYAQNYQQAPPQQQQQQQ---QQQQPQQ
QQQQGYAPDQGISLIDL
>Skud_12.270
MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD
KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHEN--E--SGF
DEGQIIRVKAKELVSLLNDDERL------------REERSMNTRNRGANKAPR-------
--------PGPRR-QRTGSNPRDSSPSYQDELEKVLEESRITAQED--EQRRRELAQYDD
EDPDFQAALQLSKEEEELKQLQELQRLQKQQQPLSQMPVPVQQQQQ----QQQQQLPAYY
DIFGNPISQDEYL-----------EYQYQ-----------QD----------QEQAMAQQ
KWLDQ---QQ---------EQQQLAEQ--------------QYFQQQQQAAASA------
AALQQQQTAANMQ-----------------------QQPANFQQPQPTGSNNPFSMDNLE
RQKQEQ--QHAQLQRQQEEARQQQEAL---------------------------------
--------------------------------------------KLQQQQRLQQEEAQLQ
QKRQQQQQQQQAQLQQQQQQQQQQQQQQQAQLQQQQLLQQ-----QQLLLQQQQQQQQPL
EQTRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVT
S---EP--KNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQNPAVNSPPQNSTNINYS---
---QPQQQPQYTQNY---QQQPQYAEIPQQQQQ-----TQQPQYTQNYQQGSS---QPQQ
PQQQGYTPDQGISLIDL
>Smik_12.264
MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD
KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHEN--E--SGF
DEGQIIRVKAKELVSLLNDDERL------------REERSMNTRNRRDRSAAR-------
--------PRPRR-QRTRSNPHDSSPSYQNDLEKALEESRITAQED--EQRRRELAQYDD
EDPDFQAALQLSKEEEELKQLQELQRLQNQQQSLSQMQVPVQQQQE------Q---PAYY
DIFGNPISQDEYL-----------QYQYQ-----------QD----------QEQAMAQQ
RWLDQQ------------QEQQQLAEQ--------------QYFQQQQQAAAVAAT----
NAMEQQHTAANMQ---------------------QQQQPVDFQQPLPTGSNNPFSMDNLE
RQKQEQ--QHAQLQRQQEEARQQQEQL---------------------------------
--------------------------------------------KLQQLQRQQQEEAQLQ
QRR--------------------QQEESHLQQQQAQ---------LQLQQQQTQFQQQPL
KQTRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVI
N---EP--KNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQSPPANSPPQNSINVSYS---
---QSQQQPQYTQGYQQQQQQPQYAQNIQQQPQYAQNIQQQPQYTQNYHQGSSQQQQQQQ
QQQQGYAPDQGISLIDL
>YLR206W
MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD
KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHEN--E--SGF
DEGQIIRVKAKELVSLLNDEERL------------REERSMNTRNRRANRAAR-------
--------PRPRR-QRTRSNPHDSSPSYQDDLEKALEESRITAQED--EQRRRELAQYDD
EDPDFQAALQLSKEEEELKQLQELQRLQKQQQSLSQFQAPLQQQQP----QQQ---PAYY
DIFGNPISQDEYL-----------QYQYQ-----------QD----------QEQAMAQQ
RWLDQQ------------QEQQQLAEQ--------------QYFQQQQQAAAAASALQQQ
QTAANMQQQ--------------------------QQQPADFQQPLPTGSNNPFSMDNLE
RQKQEQ--QHAQLQRQQEEARQQQEQL---------------------------------
--------------------------------------------KLQQLQRQQQEEAQLH
QKR----------------------QEEAQLQQQQA---------QLLQQQAQFQQQQPL
KQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVT
N---EP--KNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQSPPTNSPQQNPTGISYSQPQ
QQQQPQQQPQYMQNF--QQQQPQYAQNFQQQPQYTQNYQQQPQYIQPHQQ--QQQQQQQQ
QQQQGYTPDQGVSLIDL
>Kpol_2001.70
MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD
KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYID--D--SDH
DQGQIIRVKAKELTSLLNDEERL------------RDERGMNRRGGRRER----------
--------ARPRR-R----------PSDDDELQRAIEESKRTAEDD--DRRRR---MRDD
EEADLQTALQLSKEEEELKRLQELQRLQ-------------QQQQQ----QQQQQQPMYY
DIFGNPISQEEYL-----------QYQLQQQQQQQQWLAQQQ----------QQELLAQQ
QQQQELL-----------AQQELLAQQ--------------QYWALQQQQQQQQQA----
ALLAQQQAA--------------------------------YQQPLATGSNNPFAMNN--
-----------QALQLNNQNDKAHSEL---------------------------------
--------------------------------------------PDFNAKPVSAYQPAEL
PPQ--------------------------QQISLPP---------QPQQPQ------QPL
KQTRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVT
N---DP--KNNPFLNSQYTGLPSTNIVPSHTGYGFGNQQQQQ------------------
---QQQQQQQ-------QQQQQLQQQQYQQQQQQQQQYQPQQQYQQQYQQ----------
-QPQQQSYDQGVSLIDL
>NDAI0D00610
MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD
KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLED--D---NV
DESSIIRVKAKELTALLQDDERL------------KEERSINLKNNRRS-----------
--------ERKNR-SRRGTNATRRGTKSDEDLQKALEESRITAEED--ERRRRELAQYDN
QDTDYQTALQLSKEEEELKKLQELQRLQ-QLQQQQQQQMQFQQQPQ----QQE---QVYY
DIFGNPISPEEYL-----------QF--------------QQ----------QQQAFAQQ
QALQQ---QH--------LEQQRLAEE--------------QYRLLQQQQQQQQQ-----
QAYTQQQQS---------------------------------LQPLPTGSNNPFALNA--
------------------------TIN---------------------------------
--------------------------------------------TSPIRPAEQQPQPQFT
APQ------------------------------------------QQQQPLQ-----QPL
KQTRTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIV
N---DPV-KKNPFLNNQYTGLPSSNIVPSHTGYGFGNGPQQG------------------
---QGQAPPP--------------------------------------------------
-QQQQQQSQQSFSLIDL
>NCAS0H00670
MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD
KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHED--D--GGA
DQGQIIRVKAKELTSLLLDEERL------------KEERTINLKNRRDGD----------
--------MKGRR-RRRGTRNGRGNDEDQDELQRALEESRLTAEED--ERRRRQMAQYDD
QDPDLQTALQLSKEEEELKKLQEMQRLQ-------------QQQGQ----MNQ--PQGYF
DIFGNPISPDEYL-----------QF--------------QQ----------QQDAFAQQ
QLLQQ---QQ--------LEQQRQAEQ--------------QYLAMQQQQQQQQQ-----
AALAAQQTA-------------------------LANQNAYYQQPLQTGSNNPFAMNN--
--------------------------F---------------------------------
--------------------------------------------NNKP--AVESTQAYTA
SAP---------------------------QLNQQP---------AQQQPQ----Q-QPL
KQTRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVT
N---DP--KNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSQQ------------------
---QQQQQQQ--------------------------------------------------
----QQRPDQGFSLIDL