MUSCLE (3.8) multiple sequence alignment

TBLA0E02050        ------------------------------------------------------------
ACL155W            ------------------------------------------------------------
TPHA0D04570        ------------------------------------------------------------
KLLA0D12496g       ------------------------------------------------------------
Kpol_2001.71       ------------------------------------------------------------
KNAG0C03740        ------------------------------------------------------------
KLTH0H01408g       ------------------------------------------------------------
Kwal_56.24616      ------------------------------------------------------------
KAFR0B00830        ------------------------------------------------------------
ZYRO0F11572g       ------------------------------------------------------------
Smik_4.74          MTLYKISNRISAATACFTCASALSSPSLILMYTFIEMTDGIFHLTRKRVKMKFKRNILSD
YDL164C            ------------------------------------------------------------
Suva_4.82          ------------------------------------------------------------
Skud_4.93          ------------------------------------------------------------
CAGL0I03410g       ------------------------------------------------------------
SAKL0F10912g       ------------------------------------------------------------
TDEL0C02040        ------------------------------------------------------------
NCAS0A14110        ------------------------------------------------------------
NDAI0A01940        ------------------------------------------------------------
                                                                               

TBLA0E02050        ---------------------------MSRYWLAARRPLSVTCRHYSCCRCRYYSFSPTL
ACL155W            ---------------------------------------------MSA------------
TPHA0D04570        ---------------------------MAIGRLQTTIF-----RQLSYCRPFVSSLRFGT
KLLA0D12496g       ----------------------------MFRLPII--------RNWIVQRPVTFKVPSQQ
Kpol_2001.71       ----------------------------MLKSLYA--------THWRY---IIMSGSSAV
KNAG0C03740        ----------------------------MWKSVC---------KPLLTNRLTTIHPK---
KLTH0H01408g       ----------------------------MLRLVR---------AEMSS------------
Kwal_56.24616      ----------------------------MIRTVR---------LSMSS------------
KAFR0B00830        ----------------------------MLKLLCCNKYPAQRLTPLVYIYSGIMSSN---
ZYRO0F11572g       ----------------------------MLARV----------HQLSVIGVRRFGMATSS
Smik_4.74          LHSSVLVHGKYNDFGDLYKSILQRCFINYMRRLLGGLLISST-HPLILRLPLSMSSSLPS
YDL164C            -----------------------------MRRLLTGCLLSSA-RPLKSRLPLLMSSSLPS
Suva_4.82          ----------------------------MHRSLAGLILTSV--RPSSSKLLLFMSSSLPS
Skud_4.93          -----------------------------MRRLLAGLLFSPA-RSLNPRLSLLMPPSLPS
CAGL0I03410g       ----------------------------MFSRLA---------PPIRFISARIIKEPTRP
SAKL0F10912g       ----------------------------MLK------------NPLRIMS----------
TDEL0C02040        ----------------------------MFRVVG---------RPLVE---LLINKGMSS
NCAS0A14110        ----------------------------MLRSILAGK------KPFIIPKSIMSSPAGFP
NDAI0A01940        ----------------------------MLRQLGTTRILLPNLRPIRY---ITMPPATPS
                                                                               

TBLA0E02050        PLPM--------------SKKQVTLARFFAKRE------PKDEEKQSSSPVKEQVQI---
ACL155W            ------------------PKKQATLGRFFTALK-------RPQDGATAAATVKKSKVEAA
TPHA0D04570        ASLLYTRTMSNSLEP---SKKQATLARFFTSMG------KKTPPAVEVAT----------
KLLA0D12496g       MSTK--------------RSKQLTLDGFLRPNK------KQKVDEEG-------------
Kpol_2001.71       NGGG--------------AKKQATLARFFSSMP------KRKIDDDSSTDST--------
KNAG0C03740        ------------------MKRQMTLNNFFTSVK------KSDTNTPASTTPKKME-----
KLTH0H01408g       ------------------IKKQATLAKFFSSKK------RSVEEEKSHEPAKKLHSDP--
Kwal_56.24616      ------------------AKKQATLAKFFSSKK------RSNDEKEGPQESAKKSQLNA-
KAFR0B00830        ------------------SKRQATLARFFTSIK------PSADDQ---------------
ZYRO0F11572g       SQPKK-------------QAKQATLAKFFSSVK------DRNSPTKKNATPAFPTT----
Smik_4.74          SAGK--------------KPKQATLARFFTSMK------NKPSGNTSPPDKSAKHMLQDS
YDL164C            SAGK--------------KPKQATLARFFTSMK------NKPTEGTPSPKKSSKHMLEDR
Suva_4.82          SAGK--------------KPKQATLARFFTSMK------NKPSGGSSSPEKAVKHKIENG
Skud_4.93          SAGK--------------KPKQATLARFFSSMK------NEPSGSSSSPEKAPKHKLENN
CAGL0I03410g       LIV---------------MKRQATLARFFSSVK------KDADGDKKGEQADVKTAAVDL
SAKL0F10912g       ------------------TKKQVTLARFFSSAK------KGGNKEDKLEPQAKRAKV---
TDEL0C02040        ------------------GKKQATLARFFSAVQ------KDDTKEKVNGDVKIIE-----
NCAS0A14110        K-----------------KQKQATLAKFFSSMKNEKPADKKDPEDSTTTTTEKPSLSPYT
NDAI0A01940        SSSSSSSSSARENNVSKGRKQQATLGRFFSSIN------HKKPTKDTALKNESKEETKE-
                                       .* **  *:                               

TBLA0E02050        -QGQPQQEQVKIQPQEQ------------KQIVVPQ----------------EVTTSTQT
ACL155W            ECLAAPAGHEQDAEVKNSLP---------ELADKPAPGGVLPQA--------ASAVPRAQ
TPHA0D04570        -KQESPENHVDKKR---------------KVEVHPSQSVG------------ASEKAESP
KLLA0D12496g       -DSAMPDETAAAPPVKSESS---------LSNITPPKS--------------RGETLTPV
Kpol_2001.71       -TINKDDDSDTSKKIKL------------NSDETPTTSAGSVTSKD------EPSLTSSP
KNAG0C03740        -KDESPQIPATKTAEEKHENM--------DVDTDPVISSSEVSAKR------NSPLTSPS
KLTH0H01408g       -IGAGSGSPSSSPPLATGSS---------DAGSVKVETSATSTGENTKAGTPTLPDSDEP
Kwal_56.24616      -IDAKPESSKGSQPNVDETNH--------ETLQKPQLSAAEP----------KTEFAMNP
KAFR0B00830        -NSKTSSSPVPPPSSSSSSTT--------ANGSSPLKKPKLSPI--------ESSKTDSS
ZYRO0F11572g       -TNVKRESPVRSNSNEKESSP--------MFDDSNGRSSACSSAG-------LEMESAPA
Smik_4.74          VDDDSSVGVRNVKKSQQVAVA--------QAATVQPFMSSFPSSLPSSAPSSSGADLSQK
YDL164C            MDNVSGEEEYATKKLKQTAVT--------HTVAAPSSMGSNFSSIPSSAPSSGVADSPQQ
Suva_4.82          TNEISSEGASAIKKLKHLSAV--------QTPVEQSDMSSSSSPLPSSAPSSSGVDASQK
Skud_4.93          IDNNSSEGADATKKLKQVSTV--------QTLVAPSTMGSSPFSLPSSAPSSSGVDVSQE
CAGL0I03410g       NSHEVDANKSPLKKMKLESTGS-------LTATKNGNQGKEEH---------EGTPIAST
SAKL0F10912g       -DPANTSELITNEAVARSVSP--------PTPVVPV------------------APIIST
TDEL0C02040        -SRDNQDEPVTKK----------------FKSSSPVKLQTSSLSPV------KSAGVESG
NCAS0A14110        ANSKKTFEEILNRPASNLASSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPS
NDAI0A01940        -ENKDDSDSIPRKKIRLSTSSSSPSIMAESKPKSPIKLNTERSSSP------ASASASTT
                                                                               

TBLA0E02050        PRPTK-----------KSKPATSSLPYADLCQLFETIESESSRLTITNLCTAFFSRTLQL
ACL155W            SSPVKPAA-------------STSVMYADLCAVFEAVEATSSRLSITKLCADFMYSVLKC
TPHA0D04570        PDQTK-----------------STVLYSEVCNLFQQIEETSSRLAIIKLCSEFFIRVIKN
KLLA0D12496g       PSKLK---------------FHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLER
Kpol_2001.71       QKPIVTPAK--VPSNTKPVKFFSTVPYADLCEVFQEVESTSSRLSIIKICSDFLIKVMKQ
KNAG0C03740        PTPVVSKKIKIQDENNDTKEFYSTVPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKL
KLTH0H01408g       AKRAVAATKGDPAKLGASAPKDSKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLK
Kwal_56.24616      AKLAVEKSHGDVAKIGISAPKDSNVMYSEMCSVFNEIEGTSSRLQIVKLCSDFLYSVLTK
KAFR0B00830        ETTVKQE-------------FVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFTKAMKQ
ZYRO0F11572g       PKKLKMESDSNSTSKNNQDDHFSTVPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKE
Smik_4.74          FQGLGPKVEDFEMNSNDSDHYSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQ
YDL164C            SQRLVGEVED-ALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMKQ
Suva_4.82          SRELTPKVEE-EQGPIDNDHYSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQ
Skud_4.93          SREFTPQVEK-EPSSNDNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQ
CAGL0I03410g       PRQVDSK-------------FFCKVPYSDLCNLFEEIEGTSSRLAIIKLCSDFFIKIMKE
SAKL0F10912g       STPVMAPV------------HHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQ
TDEL0C02040        DKPVSPDL------------YYSKVPYSDVCNVFQEIEGTSSRLSIIKICSEFFSRIMKD
NCAS0A14110        KEPTIENV-----TQDSTKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKE
NDAI0A01940        PTPIVADHTL-DPKTAVSKPFLCAIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQ
                                           : : ::*  *. :*  **** *  :*  *:   :  

TBLA0E02050        DPSLLVPVTYLCINKLGPDY-SGVELGLGEGLLLKAIGSACGVSQQQLKLQYRKLGDLGQ
ACL155W            DPGHLIPVTYLFINRLGPDYEPGLELGLGEGILIKTISDACGKSAAQVRSSYRECGDLGT
TPHA0D04570        NPSDIIIVAYLFINRLGPDYEPGLELGLGENLLIKTISEAYGKSIKQIKLELKETGDLGT
KLLA0D12496g       DPESLVPITYLFIHKLGPDYEPGLELGLGESLLIKTISEACGKSIQQIRNKYREIGDLGE
Kpol_2001.71       DPQNLVPITYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSMQQLKNQYREIGDLGQ
KNAG0C03740        DPRNLIPMTYLFINKLGPDYMPGLELGLGENLLIKTIAESCGRSLQQIKTKYHEIGDLGQ
KLTH0H01408g       ARKDIVPITYLLINKLGPDYQPGLELGLGEGLLMKTISESCGKSLQQIKARYRELGDLGR
Kwal_56.24616      TRKDLVPITYLLINKLGPDYQPGLELGLGEGLLMKTISESCGKSLQQVKARYRELGDLGR
KAFR0B00830        NTANLIPLTYLFINKLGPDYEMGLELGLGENLLMKTISESCGKSLQQVKLDYKDIGDLGT
ZYRO0F11572g       DSRNLVPTTYLFINKLGPDYEPGMELGLGEGLLMKTISESCGKSLAQVKNRYREMGDLGQ
Smik_4.74          SSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISESCGKSMSQIKLKYKEIGDLGE
YDL164C            SSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLGE
Suva_4.82          SSKNLIPTTYLFINRLGPDYEPGLELGLGENLLMKTISESCGKSMNQIKLKYKEIGDLGE
Skud_4.93          SSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISESCGKSMSQIKLKYKEMGDLGE
CAGL0I03410g       DPQNLIPVTYLFINKLGPDYEPGLELGLGENLLMKTISESCGKSMQQIKNQYREIGDLGQ
SAKL0F10912g       NPSNLVPITYLFINRLGPDYEPGLELGLGEGLLMKTIAESCGKSLQQVRAKYREIGDLGE
TDEL0C02040        NPQNLIPTTYLFINRLGPDYEPGLELGLGEGLLMKTISEACGKSLVQVKNRYREMGDLGQ
NCAS0A14110        NPQNLIPVTYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSLAQVRNKYRELGDLGQ
NDAI0A01940        DPQNLIPVTYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSLTQIRAQYRELGDLGQ
                       ::  :** *:.*****  *:******.:*:*:*..: * *  *:.   .. **** 

TBLA0E02050        LAMSTRVLQPTITMFKLEPLTITKVFDTLAKIAASQGKDSQNQKINMIKRLLTSCQ-GVE
ACL155W            VAQQARVVQP--TMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTACQ-GME
TPHA0D04570        IARDARNIQP--TMFKPKPLTISDVFNNLKKIASATGKDSQLRKIKLIKQMLSASK-GLE
KLLA0D12496g       IAMQARNVQP--TMFKPKPLTVGEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACK-GYE
Kpol_2001.71       IAQDARNVQP--TMFKPKPLTVGEVFQNLKDIAQSQGKDSQQRKMRLIKRMLTACK-GVE
KNAG0C03740        IALEARKVQP--TMFKPKPLTVGEVFQNLKSIASSQGKDSQTKKIKLIKRMLTSCQ-GVE
KLTH0H01408g       IAQEARAVQP--TMFKPKPLTTGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTACQ-GLE
Kwal_56.24616      IAQEARSVQP--TMFKPKPLTTGMVFANLQDIARAQGKDSQLRKVQLIKKMLTACE-GVE
KAFR0B00830        IAMNARNVQP--TMFKPKPLTVGYVFQNLKLIAKSSGKDSQLKKIRLIKKLLTACK-GIE
ZYRO0F11572g       IAMEARNVQP--TMFKPKPLTVGEVFVNLRNIANAQGKDSQNKKIKLIKRMLTACQ-GVE
Smik_4.74          IAMGARNVQP--TMFKPKPLTVGEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQ-GVE
YDL164C            IAMGARNVQP--TMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACK-GIE
Suva_4.82          IAMGARNVQP--TMFKPKPLTVGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQ-GVE
Skud_4.93          IAMGARNVQP--TMFKPKALTVGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQ-GVE
CAGL0I03410g       IALEARNVQP--TMFKPKPLVVGEVFENLKTIAKSQGKDSQTKKMKLIKRMLTACQ-GTE
SAKL0F10912g       VAQEARAVQP--TMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQ-GVE
TDEL0C02040        IALEARNVQP--TMFKPKPLTVGEVFENLRAIAHSQGKDSQTRKIKLIKRMLTACE-GVE
NCAS0A14110        IAMDARNVQP--TMFKPKPLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACE-GTE
NDAI0A01940        IALEARNVQP--TMFKPKPLTVGEVFNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVE
                   :*  :* :**  **** :.*.   ** .*  ** : ***** .*  :**.:*::.: * *

TBLA0E02050        AKFLIRSLESKLRIGLAEKTVLTSLARALVIHEK---GN-----DN--IQDDDYSNAEQI
ACL155W            AKYLIRSLESKLRIGLAEKTVLVALSKAILTHEH---DG-----KE--PSPEQVDAAEAL
TPHA0D04570        AKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQAEAK
KLLA0D12496g       AKFLIRSLESKLRIGLAEKTVLISVSKAILTHEH---NG-----QE--PSTEMVEQAESL
Kpol_2001.71       AKFLIRSLESKLRIGLAEKTVLISLSKALLLNEY---ETS----KD--PSMELIETAEEK
KNAG0C03740        AKFLIRSLESKLRIGLAEKTVLISLSKALLVYEY---GESD---KD--IDMETVENAEQK
KLTH0H01408g       AKFLIRSLESKLRIGLAEKSVLVALSKALLTYEH---NG-----KE--PSSELVDTAEQK
Kwal_56.24616      AKFLIRSLESKLRIGLAEKSVLVALSKAILTHEH---GG-----KE--PSSDLVDAAEQK
KAFR0B00830        AKYLIRSLESKLRIGLAEKSVLISLSKALLINEY---NNT----LD--PDMELIEKAEQK
ZYRO0F11572g       AKFLIRSLESKLRIGLAEKTVLISLSNALLRHEQ---GLD----VE--PSDEAVDKAEQS
Smik_4.74          AKFLIRSLESKLRIGLAEKTVLISLSKALLLHDE---NRENSADKD--IPMDVLESAQQK
YDL164C            AKFLIRSLESKLRIGLAEKTVLISLSKALLLHDE---NREDSPDKD--VPMDVLESAQQK
Suva_4.82          AKFLIRSLESKLRIGLAEKTVLISLSKALLLHGG---NGENSHVND--IPMDVLESAQQK
Skud_4.93          AKFLIRSLESKLRIGLAEKTVLISLSKALLLHDE---NKENSPDKE--IPMDVLESAQQR
CAGL0I03410g       AKFLIRSLESKLRIGLAEKTVLIALSKALLIHDE---KYSN---KE--PSMDVVEQAEQK
SAKL0F10912g       AKFLIRSLESKLRIGLAEKTVLISLSKALLSYEH---DG-----EE--PSSELVENAEQR
TDEL0C02040        AKFLIRSLESKLRIGLAEKTVLISLSKALLTNEG---ETG----KE--PSMELVEQAEAK
NCAS0A14110        AKFLIRSLESKLRIGLAEKTVLISLSKALLVHEC---KDN----KD--FDMELLETAEQK
NDAI0A01940        AKFLIRSLESKLRIGLAEKTVLISLSKALLVKEF---DAN----KD--FDMELLETAEGK
                   **:****************:** :::.*::               :     :  . *:  

TBLA0E02050        IKDSFCQIPNYEIIITTSLQYGVSQLASHIKLTPGIPLKPMLAKPTKSISEVLDTFQNIQ
ACL155W            VRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQR
TPHA0D04570        LREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAFQGKE
KLLA0D12496g       IRDAFCQVPNYEMIINVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTK
Kpol_2001.71       IRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEE
KNAG0C03740        IRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPAIPLKPMLAKPTKSISEIFDRFQDQK
KLTH0H01408g       IRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQR
Kwal_56.24616      IRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQR
KAFR0B00830        IRDAFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIH
ZYRO0F11572g       IRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKAITEVLDRFQGQL
Smik_4.74          IRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGET
YDL164C            IRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGET
Suva_4.82          IRDAFCQVPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGET
Skud_4.93          IRDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGET
CAGL0I03410g       IRDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPMLAKPTKAINEVLDRFQGQT
SAKL0F10912g       VRDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEK
TDEL0C02040        IRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQT
NCAS0A14110        IRDAFCQVPNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEI
NDAI0A01940        IRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGIPLKPMLAKPTKAINEILDRFQGET
                   :.::.**:***:::*  .*. *: ::     : *.***:******:*:* *::: *:.  

TBLA0E02050        FTSEYKYDGERAQVHLLPDGSMRIYSRNGEDMTQRYPELNIQDYL----V---------D
ACL155W            FTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFL----A---------N
TPHA0D04570        FISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPELDVKDFLCVVKAITNDQEGENA
KLLA0D12496g       FTCEYKYDGERAQVHLCRDGSMKIYSRNGEDMTERYPEIDVKHYV----K---------D
Kpol_2001.71       FTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDES---------N
KNAG0C03740        FTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIHIRDFV----T---------D
KLTH0H01408g       FTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEIRISDFI----A---------D
Kwal_56.24616      FTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISDFV----A---------H
KAFR0B00830        FTSEYKYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFI----K---------D
ZYRO0F11572g       FVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERYPEIDIRDFL----S---------D
Smik_4.74          FTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFI----Q---------D
YDL164C            FTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFI----Q---------D
Suva_4.82          FTSEYKYDGERAQVHLLDDGTMRIYSRNGENMTERYPEIKITDFI----Q---------D
Skud_4.93          FTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFI----Q---------D
CAGL0I03410g       FTSEYKYDGERAQVHLLKDGTMRIYSRNGENMTERYPEIQIKDFL----A---------D
SAKL0F10912g       FTCEYKYDGERAQVHLLPDGSMNIYSRNGENMTERYPELHIRDYL----A---------D
TDEL0C02040        FTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFV----A---------D
NCAS0A14110        FTSEYKYDGERAQVHLLSDGTMRIYSRNGENMTERYPEIHIRDFI----A---------D
NDAI0A01940        FTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIHIGDFV----K---------D
                   * .********.*:**  .* :.*****.*:**:****: .  ::               

TBLA0E02050        STTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKSVDLKDIKVRVCLFAFDILRHNNDS
ACL155W            PQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGES
TPHA0D04570        IQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLYLNNEG
KLLA0D12496g       LGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVKVRVCLYAFDILCLNDEP
Kpol_2001.71       TDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEG
KNAG0C03740        LSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCLFAFDILLHNDEK
KLTH0H01408g       PARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCLFAFDILCYNDEP
Kwal_56.24616      PDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDILCYNDEP
KAFR0B00830        LNLTKSLIIDCEAVAWDREEKKILPFQVLSTRKRKDVDIKDIKVRICLFAFDILCHNDEK
ZYRO0F11572g       P-STESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVKVRVCLFAFDLLCHNGEP
Smik_4.74          LDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVKVRVCLFAFDILCHNDER
YDL164C            LDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDER
Suva_4.82          LDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVKVRVCLFAFDVLCHNGER
Skud_4.93          LNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDVKVKVCLFAFDILCYNDER
CAGL0I03410g       PASTTSLILDCEAVAWDKEQNKILPFQVLTTRKRKDVNINEVKVRVCLFAFDILLHNDMR
SAKL0F10912g       PETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQS
TDEL0C02040        LEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGER
NCAS0A14110        PLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRKDVDLKDVKVKVCLFAFDILCHNDEK
NDAI0A01940        RNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKVRVCLFAFDILCHNSNK
                         :*:*.*.****     *****:*:*****.*   ::**.:**:***::  *.  

TBLA0E02050        LINNTLRERRDILHSITKPCPGQFQFATELTTSNLDELQTFLDKAIKDSCEGLMVKSLDG
ACL155W            LLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDG
TPHA0D04570        MINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDG
KLLA0D12496g       LINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEG
Kpol_2001.71       LITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDG
KNAG0C03740        LINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEG
KLTH0H01408g       LITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVKILEG
Kwal_56.24616      LINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVKVLDG
KAFR0B00830        LINKSLRERREILHSVTREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDG
ZYRO0F11572g       LINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDG
Smik_4.74          LINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDG
YDL164C            LINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEG
Suva_4.82          LINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEG
Skud_4.93          LINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDG
CAGL0I03410g       LINEPLSKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKMMDG
SAKL0F10912g       LINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEG
TDEL0C02040        QINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDG
NCAS0A14110        LINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDG
NDAI0A01940        LINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEGLMVKMLEG
                    :. .: .*.  *        *::  * .: : ...::* :*::::  .******* ::*

TBLA0E02050        TDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCVLGAYYGRGKRTGTYGGFLLACYNQDTE
ACL155W            EESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYYGRGKRTGTYGGFLLGCYNPDLE
TPHA0D04570        EESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQ
KLLA0D12496g       EESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLGAYYGRGKRTGTYGGFLLGCYNLDSE
Kpol_2001.71       EESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFLLGCYNQDSG
KNAG0C03740        EESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLGCYNQDTG
KLTH0H01408g       EESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSG
Kwal_56.24616      EESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTG
KAFR0B00830        EDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAFYGRGKRTGTYGGFLLGCYNQDTG
ZYRO0F11572g       PESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTG
Smik_4.74          SESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTG
YDL164C            PESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTG
Suva_4.82          PESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTG
Skud_4.93          PESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTG
CAGL0I03410g       VESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGCYNADSE
SAKL0F10912g       EESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTG
TDEL0C02040        PESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSG
NCAS0A14110        IESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRGKRTGMYGGFLLGCYNQDTG
NDAI0A01940        EESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNDNTG
                    :* ****************** *:****** *:**::*.***** ******.*** :  

TBLA0E02050        EFETCCKIGTGFSDEMLQTLYNGLKETAIESPRANFVFDSSAEPDVWFNPTMVFEVLTAD
ACL155W            EFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGDVSYDDSSPPDVWFEPAMLFEVLTAD
TPHA0D04570        EFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFEVLTAD
KLLA0D12496g       EFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTAD
Kpol_2001.71       EYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTAD
KNAG0C03740        EFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWFEPTLLFEVLTAD
KLTH0H01408g       EYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWFEPTLLFEVLTAD
Kwal_56.24616      EFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEVLTAD
KAFR0B00830        EFETACKIGTGFSDEVLQSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTAD
ZYRO0F11572g       EYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFEPTLLFEVLAAD
Smik_4.74          EFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSSAEPDVWFEPTTLFEVLTAD
YDL164C            EFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTAD
Suva_4.82          EFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTAD
Skud_4.93          EFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDASAEPDVWFEPTTLFEVLTAD
CAGL0I03410g       DFETCCKIGTGFSEEMLQTLYEKLSPTVIDGPKGTYVFDSSAEPDVWFEPTMLFEVLTAD
SAKL0F10912g       EFETCCKIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTAD
TDEL0C02040        EFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTAD
NCAS0A14110        EFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFVYDSSAEPDVWFEPTLLFEVLTAD
NDAI0A01940        EFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEPDVWFEPSLLFEVLTAD
                   ::**.********:* *  *.  :    :  *     .. :  .*:*::.  :****:**

TBLA0E02050        LSLSPIYKAGSTVYGKGISLRFPRFIRIRTDKSVNDATSSEQVIDFYENQSHLQS
ACL155W            LSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQANSSG
TPHA0D04570        LSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSHIQN
KLLA0D12496g       LSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQAHMK-
Kpol_2001.71       LSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHIQS
KNAG0C03740        LSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQANLQQ
KLTH0H01408g       LSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQSHVS-
Kwal_56.24616      LSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHIN-
KAFR0B00830        LSMSPIYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQSHVAK
ZYRO0F11572g       LSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQAHLS-
Smik_4.74          LSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHVQN
YDL164C            LSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN
Suva_4.82          LSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVELYENQSHVQN
Skud_4.93          LSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIIELYENQSHVQN
CAGL0I03410g       LSLSPIYKAGSSVYDKGISLRFPRFLRIRDDKSVEDATSSEQIIEMYQNQSHVAN
SAKL0F10912g       LSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVELYESQVNLQK
TDEL0C02040        LSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHVA-
NCAS0A14110        LSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATSSEQIIELYENQAHTQ-
NDAI0A01940        LSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQSHRSS
                   **:**:****   : **:*******:* * **   :.*:* :::::*: * :   

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0E02050
------------------------------------------------------------
---------------------------MSRYWLAARRPLSVTCRHYSCCRCRYYSFSPTL
PLPM--------------SKKQVTLARFFAKRE------PKDEEKQSSSPVKEQVQI---
-QGQPQQEQVKIQPQEQ------------KQIVVPQ----------------EVTTSTQT
PRPTK-----------KSKPATSSLPYADLCQLFETIESESSRLTITNLCTAFFSRTLQL
DPSLLVPVTYLCINKLGPDY-SGVELGLGEGLLLKAIGSACGVSQQQLKLQYRKLGDLGQ
LAMSTRVLQPTITMFKLEPLTITKVFDTLAKIAASQGKDSQNQKINMIKRLLTSCQ-GVE
AKFLIRSLESKLRIGLAEKTVLTSLARALVIHEK---GN-----DN--IQDDDYSNAEQI
IKDSFCQIPNYEIIITTSLQYGVSQLASHIKLTPGIPLKPMLAKPTKSISEVLDTFQNIQ
FTSEYKYDGERAQVHLLPDGSMRIYSRNGEDMTQRYPELNIQDYL----V---------D
STTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKSVDLKDIKVRVCLFAFDILRHNNDS
LINNTLRERRDILHSITKPCPGQFQFATELTTSNLDELQTFLDKAIKDSCEGLMVKSLDG
TDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCVLGAYYGRGKRTGTYGGFLLACYNQDTE
EFETCCKIGTGFSDEMLQTLYNGLKETAIESPRANFVFDSSAEPDVWFNPTMVFEVLTAD
LSLSPIYKAGSTVYGKGISLRFPRFIRIRTDKSVNDATSSEQVIDFYENQSHLQS
>ACL155W
------------------------------------------------------------
---------------------------------------------MSA------------
------------------PKKQATLGRFFTALK-------RPQDGATAAATVKKSKVEAA
ECLAAPAGHEQDAEVKNSLP---------ELADKPAPGGVLPQA--------ASAVPRAQ
SSPVKPAA-------------STSVMYADLCAVFEAVEATSSRLSITKLCADFMYSVLKC
DPGHLIPVTYLFINRLGPDYEPGLELGLGEGILIKTISDACGKSAAQVRSSYRECGDLGT
VAQQARVVQP--TMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTACQ-GME
AKYLIRSLESKLRIGLAEKTVLVALSKAILTHEH---DG-----KE--PSPEQVDAAEAL
VRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQR
FTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFL----A---------N
PQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGES
LLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDG
EESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYYGRGKRTGTYGGFLLGCYNPDLE
EFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGDVSYDDSSPPDVWFEPAMLFEVLTAD
LSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQANSSG
>TPHA0D04570
------------------------------------------------------------
---------------------------MAIGRLQTTIF-----RQLSYCRPFVSSLRFGT
ASLLYTRTMSNSLEP---SKKQATLARFFTSMG------KKTPPAVEVAT----------
-KQESPENHVDKKR---------------KVEVHPSQSVG------------ASEKAESP
PDQTK-----------------STVLYSEVCNLFQQIEETSSRLAIIKLCSEFFIRVIKN
NPSDIIIVAYLFINRLGPDYEPGLELGLGENLLIKTISEAYGKSIKQIKLELKETGDLGT
IARDARNIQP--TMFKPKPLTISDVFNNLKKIASATGKDSQLRKIKLIKQMLSASK-GLE
AKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQAEAK
LREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAFQGKE
FISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPELDVKDFLCVVKAITNDQEGENA
IQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLYLNNEG
MINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDG
EESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQ
EFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFEVLTAD
LSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSHIQN
>KLLA0D12496g
------------------------------------------------------------
----------------------------MFRLPII--------RNWIVQRPVTFKVPSQQ
MSTK--------------RSKQLTLDGFLRPNK------KQKVDEEG-------------
-DSAMPDETAAAPPVKSESS---------LSNITPPKS--------------RGETLTPV
PSKLK---------------FHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLER
DPESLVPITYLFIHKLGPDYEPGLELGLGESLLIKTISEACGKSIQQIRNKYREIGDLGE
IAMQARNVQP--TMFKPKPLTVGEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACK-GYE
AKFLIRSLESKLRIGLAEKTVLISVSKAILTHEH---NG-----QE--PSTEMVEQAESL
IRDAFCQVPNYEMIINVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTK
FTCEYKYDGERAQVHLCRDGSMKIYSRNGEDMTERYPEIDVKHYV----K---------D
LGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVKVRVCLYAFDILCLNDEP
LINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEG
EESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLGAYYGRGKRTGTYGGFLLGCYNLDSE
EFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTAD
LSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQAHMK-
>Kpol_2001.71
------------------------------------------------------------
----------------------------MLKSLYA--------THWRY---IIMSGSSAV
NGGG--------------AKKQATLARFFSSMP------KRKIDDDSSTDST--------
-TINKDDDSDTSKKIKL------------NSDETPTTSAGSVTSKD------EPSLTSSP
QKPIVTPAK--VPSNTKPVKFFSTVPYADLCEVFQEVESTSSRLSIIKICSDFLIKVMKQ
DPQNLVPITYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSMQQLKNQYREIGDLGQ
IAQDARNVQP--TMFKPKPLTVGEVFQNLKDIAQSQGKDSQQRKMRLIKRMLTACK-GVE
AKFLIRSLESKLRIGLAEKTVLISLSKALLLNEY---ETS----KD--PSMELIETAEEK
IRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEE
FTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDES---------N
TDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEG
LITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDG
EESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFLLGCYNQDSG
EYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTAD
LSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHIQS
>KNAG0C03740
------------------------------------------------------------
----------------------------MWKSVC---------KPLLTNRLTTIHPK---
------------------MKRQMTLNNFFTSVK------KSDTNTPASTTPKKME-----
-KDESPQIPATKTAEEKHENM--------DVDTDPVISSSEVSAKR------NSPLTSPS
PTPVVSKKIKIQDENNDTKEFYSTVPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKL
DPRNLIPMTYLFINKLGPDYMPGLELGLGENLLIKTIAESCGRSLQQIKTKYHEIGDLGQ
IALEARKVQP--TMFKPKPLTVGEVFQNLKSIASSQGKDSQTKKIKLIKRMLTSCQ-GVE
AKFLIRSLESKLRIGLAEKTVLISLSKALLVYEY---GESD---KD--IDMETVENAEQK
IRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPAIPLKPMLAKPTKSISEIFDRFQDQK
FTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIHIRDFV----T---------D
LSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCLFAFDILLHNDEK
LINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEG
EESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLGCYNQDTG
EFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWFEPTLLFEVLTAD
LSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQANLQQ
>KLTH0H01408g
------------------------------------------------------------
----------------------------MLRLVR---------AEMSS------------
------------------IKKQATLAKFFSSKK------RSVEEEKSHEPAKKLHSDP--
-IGAGSGSPSSSPPLATGSS---------DAGSVKVETSATSTGENTKAGTPTLPDSDEP
AKRAVAATKGDPAKLGASAPKDSKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLK
ARKDIVPITYLLINKLGPDYQPGLELGLGEGLLMKTISESCGKSLQQIKARYRELGDLGR
IAQEARAVQP--TMFKPKPLTTGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTACQ-GLE
AKFLIRSLESKLRIGLAEKSVLVALSKALLTYEH---NG-----KE--PSSELVDTAEQK
IRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQR
FTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEIRISDFI----A---------D
PARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCLFAFDILCYNDEP
LITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVKILEG
EESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSG
EYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWFEPTLLFEVLTAD
LSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQSHVS-
>Kwal_56.24616
------------------------------------------------------------
----------------------------MIRTVR---------LSMSS------------
------------------AKKQATLAKFFSSKK------RSNDEKEGPQESAKKSQLNA-
-IDAKPESSKGSQPNVDETNH--------ETLQKPQLSAAEP----------KTEFAMNP
AKLAVEKSHGDVAKIGISAPKDSNVMYSEMCSVFNEIEGTSSRLQIVKLCSDFLYSVLTK
TRKDLVPITYLLINKLGPDYQPGLELGLGEGLLMKTISESCGKSLQQVKARYRELGDLGR
IAQEARSVQP--TMFKPKPLTTGMVFANLQDIARAQGKDSQLRKVQLIKKMLTACE-GVE
AKFLIRSLESKLRIGLAEKSVLVALSKAILTHEH---GG-----KE--PSSDLVDAAEQK
IRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQR
FTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISDFV----A---------H
PDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDILCYNDEP
LINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVKVLDG
EESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTG
EFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEVLTAD
LSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHIN-
>KAFR0B00830
------------------------------------------------------------
----------------------------MLKLLCCNKYPAQRLTPLVYIYSGIMSSN---
------------------SKRQATLARFFTSIK------PSADDQ---------------
-NSKTSSSPVPPPSSSSSSTT--------ANGSSPLKKPKLSPI--------ESSKTDSS
ETTVKQE-------------FVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFTKAMKQ
NTANLIPLTYLFINKLGPDYEMGLELGLGENLLMKTISESCGKSLQQVKLDYKDIGDLGT
IAMNARNVQP--TMFKPKPLTVGYVFQNLKLIAKSSGKDSQLKKIRLIKKLLTACK-GIE
AKYLIRSLESKLRIGLAEKSVLISLSKALLINEY---NNT----LD--PDMELIEKAEQK
IRDAFCQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIH
FTSEYKYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFI----K---------D
LNLTKSLIIDCEAVAWDREEKKILPFQVLSTRKRKDVDIKDIKVRICLFAFDILCHNDEK
LINKSLRERREILHSVTREVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDG
EDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAFYGRGKRTGTYGGFLLGCYNQDTG
EFETACKIGTGFSDEVLQSLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTAD
LSMSPIYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQSHVAK
>ZYRO0F11572g
------------------------------------------------------------
----------------------------MLARV----------HQLSVIGVRRFGMATSS
SQPKK-------------QAKQATLAKFFSSVK------DRNSPTKKNATPAFPTT----
-TNVKRESPVRSNSNEKESSP--------MFDDSNGRSSACSSAG-------LEMESAPA
PKKLKMESDSNSTSKNNQDDHFSTVPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKE
DSRNLVPTTYLFINKLGPDYEPGMELGLGEGLLMKTISESCGKSLAQVKNRYREMGDLGQ
IAMEARNVQP--TMFKPKPLTVGEVFVNLRNIANAQGKDSQNKKIKLIKRMLTACQ-GVE
AKFLIRSLESKLRIGLAEKTVLISLSNALLRHEQ---GLD----VE--PSDEAVDKAEQS
IRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKAITEVLDRFQGQL
FVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERYPEIDIRDFL----S---------D
P-STESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVKVRVCLFAFDLLCHNGEP
LINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDG
PESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTG
EYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFEPTLLFEVLAAD
LSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQAHLS-
>Smik_4.74
MTLYKISNRISAATACFTCASALSSPSLILMYTFIEMTDGIFHLTRKRVKMKFKRNILSD
LHSSVLVHGKYNDFGDLYKSILQRCFINYMRRLLGGLLISST-HPLILRLPLSMSSSLPS
SAGK--------------KPKQATLARFFTSMK------NKPSGNTSPPDKSAKHMLQDS
VDDDSSVGVRNVKKSQQVAVA--------QAATVQPFMSSFPSSLPSSAPSSSGADLSQK
FQGLGPKVEDFEMNSNDSDHYSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQ
SSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISESCGKSMSQIKLKYKEIGDLGE
IAMGARNVQP--TMFKPKPLTVGEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQ-GVE
AKFLIRSLESKLRIGLAEKTVLISLSKALLLHDE---NRENSADKD--IPMDVLESAQQK
IRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGET
FTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFI----Q---------D
LDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVKVRVCLFAFDILCHNDER
LINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDG
SESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTG
EFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSSAEPDVWFEPTTLFEVLTAD
LSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHVQN
>YDL164C
------------------------------------------------------------
-----------------------------MRRLLTGCLLSSA-RPLKSRLPLLMSSSLPS
SAGK--------------KPKQATLARFFTSMK------NKPTEGTPSPKKSSKHMLEDR
MDNVSGEEEYATKKLKQTAVT--------HTVAAPSSMGSNFSSIPSSAPSSGVADSPQQ
SQRLVGEVED-ALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMKQ
SSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLGE
IAMGARNVQP--TMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACK-GIE
AKFLIRSLESKLRIGLAEKTVLISLSKALLLHDE---NREDSPDKD--VPMDVLESAQQK
IRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGET
FTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFI----Q---------D
LDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDER
LINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEG
PESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTG
EFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTAD
LSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN
>Suva_4.82
------------------------------------------------------------
----------------------------MHRSLAGLILTSV--RPSSSKLLLFMSSSLPS
SAGK--------------KPKQATLARFFTSMK------NKPSGGSSSPEKAVKHKIENG
TNEISSEGASAIKKLKHLSAV--------QTPVEQSDMSSSSSPLPSSAPSSSGVDASQK
SRELTPKVEE-EQGPIDNDHYSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQ
SSKNLIPTTYLFINRLGPDYEPGLELGLGENLLMKTISESCGKSMNQIKLKYKEIGDLGE
IAMGARNVQP--TMFKPKPLTVGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQ-GVE
AKFLIRSLESKLRIGLAEKTVLISLSKALLLHGG---NGENSHVND--IPMDVLESAQQK
IRDAFCQVPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGET
FTSEYKYDGERAQVHLLDDGTMRIYSRNGENMTERYPEIKITDFI----Q---------D
LDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVKVRVCLFAFDVLCHNGER
LINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEG
PESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTG
EFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTAD
LSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVELYENQSHVQN
>Skud_4.93
------------------------------------------------------------
-----------------------------MRRLLAGLLFSPA-RSLNPRLSLLMPPSLPS
SAGK--------------KPKQATLARFFSSMK------NEPSGSSSSPEKAPKHKLENN
IDNNSSEGADATKKLKQVSTV--------QTLVAPSTMGSSPFSLPSSAPSSSGVDVSQE
SREFTPQVEK-EPSSNDNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQ
SSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISESCGKSMSQIKLKYKEMGDLGE
IAMGARNVQP--TMFKPKALTVGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQ-GVE
AKFLIRSLESKLRIGLAEKTVLISLSKALLLHDE---NKENSPDKE--IPMDVLESAQQR
IRDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGET
FTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFI----Q---------D
LNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDVKVKVCLFAFDILCYNDER
LINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDG
PESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTG
EFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDASAEPDVWFEPTTLFEVLTAD
LSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIIELYENQSHVQN
>CAGL0I03410g
------------------------------------------------------------
----------------------------MFSRLA---------PPIRFISARIIKEPTRP
LIV---------------MKRQATLARFFSSVK------KDADGDKKGEQADVKTAAVDL
NSHEVDANKSPLKKMKLESTGS-------LTATKNGNQGKEEH---------EGTPIAST
PRQVDSK-------------FFCKVPYSDLCNLFEEIEGTSSRLAIIKLCSDFFIKIMKE
DPQNLIPVTYLFINKLGPDYEPGLELGLGENLLMKTISESCGKSMQQIKNQYREIGDLGQ
IALEARNVQP--TMFKPKPLVVGEVFENLKTIAKSQGKDSQTKKMKLIKRMLTACQ-GTE
AKFLIRSLESKLRIGLAEKTVLIALSKALLIHDE---KYSN---KE--PSMDVVEQAEQK
IRDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPMLAKPTKAINEVLDRFQGQT
FTSEYKYDGERAQVHLLKDGTMRIYSRNGENMTERYPEIQIKDFL----A---------D
PASTTSLILDCEAVAWDKEQNKILPFQVLTTRKRKDVNINEVKVRVCLFAFDILLHNDMR
LINEPLSKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKMMDG
VESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGCYNADSE
DFETCCKIGTGFSEEMLQTLYEKLSPTVIDGPKGTYVFDSSAEPDVWFEPTMLFEVLTAD
LSLSPIYKAGSSVYDKGISLRFPRFLRIRDDKSVEDATSSEQIIEMYQNQSHVAN
>SAKL0F10912g
------------------------------------------------------------
----------------------------MLK------------NPLRIMS----------
------------------TKKQVTLARFFSSAK------KGGNKEDKLEPQAKRAKV---
-DPANTSELITNEAVARSVSP--------PTPVVPV------------------APIIST
STPVMAPV------------HHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQ
NPSNLVPITYLFINRLGPDYEPGLELGLGEGLLMKTIAESCGKSLQQVRAKYREIGDLGE
VAQEARAVQP--TMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQ-GVE
AKFLIRSLESKLRIGLAEKTVLISLSKALLSYEH---DG-----EE--PSSELVENAEQR
VRDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEK
FTCEYKYDGERAQVHLLPDGSMNIYSRNGENMTERYPELHIRDYL----A---------D
PETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQS
LINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEG
EESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTG
EFETCCKIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTAD
LSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVELYESQVNLQK
>TDEL0C02040
------------------------------------------------------------
----------------------------MFRVVG---------RPLVE---LLINKGMSS
------------------GKKQATLARFFSAVQ------KDDTKEKVNGDVKIIE-----
-SRDNQDEPVTKK----------------FKSSSPVKLQTSSLSPV------KSAGVESG
DKPVSPDL------------YYSKVPYSDVCNVFQEIEGTSSRLSIIKICSEFFSRIMKD
NPQNLIPTTYLFINRLGPDYEPGLELGLGEGLLMKTISEACGKSLVQVKNRYREMGDLGQ
IALEARNVQP--TMFKPKPLTVGEVFENLRAIAHSQGKDSQTRKIKLIKRMLTACE-GVE
AKFLIRSLESKLRIGLAEKTVLISLSKALLTNEG---ETG----KE--PSMELVEQAEAK
IRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQT
FTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFV----A---------D
LEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGER
QINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDG
PESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSG
EFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTAD
LSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHVA-
>NCAS0A14110
------------------------------------------------------------
----------------------------MLRSILAGK------KPFIIPKSIMSSPAGFP
K-----------------KQKQATLAKFFSSMKNEKPADKKDPEDSTTTTTEKPSLSPYT
ANSKKTFEEILNRPASNLASSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPS
KEPTIENV-----TQDSTKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKE
NPQNLIPVTYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSLAQVRNKYRELGDLGQ
IAMDARNVQP--TMFKPKPLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACE-GTE
AKFLIRSLESKLRIGLAEKTVLISLSKALLVHEC---KDN----KD--FDMELLETAEQK
IRDAFCQVPNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEI
FTSEYKYDGERAQVHLLSDGTMRIYSRNGENMTERYPEIHIRDFI----A---------D
PLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRKDVDLKDVKVKVCLFAFDILCHNDEK
LINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDG
IESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRGKRTGMYGGFLLGCYNQDTG
EFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFVYDSSAEPDVWFEPTLLFEVLTAD
LSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATSSEQIIELYENQAHTQ-
>NDAI0A01940
------------------------------------------------------------
----------------------------MLRQLGTTRILLPNLRPIRY---ITMPPATPS
SSSSSSSSSARENNVSKGRKQQATLGRFFSSIN------HKKPTKDTALKNESKEETKE-
-ENKDDSDSIPRKKIRLSTSSSSPSIMAESKPKSPIKLNTERSSSP------ASASASTT
PTPIVADHTL-DPKTAVSKPFLCAIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQ
DPQNLIPVTYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSLTQIRAQYRELGDLGQ
IALEARNVQP--TMFKPKPLTVGEVFNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVE
AKFLIRSLESKLRIGLAEKTVLISLSKALLVKEF---DAN----KD--FDMELLETAEGK
IRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRPGIPLKPMLAKPTKAINEILDRFQGET
FTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIHIGDFV----K---------D
RNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKVRVCLFAFDILCHNSNK
LINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVNDSCEGLMVKMLEG
EESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNDNTG
EFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEPDVWFEPSLLFEVLTAD
LSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELYENQSHRSS