MUSCLE (3.8) multiple sequence alignment

KLLA0D12408g       -----------------MEKYGLKDLVPVLRHDP--------------------------
ACL151C            MVPMPHVAPSKAVEQLNMDKYGLKGLLPVIKHEK--------------------------
Ecym_4726          -----------------MSKYGLKSLLPVIKHDK--------------------------
SAKL0F11308g       ---------------MAVEKYGLKALLPLIKQET--------------------------
KLTH0H01320g       -----------------MEKYGLSALLPLIRRED--------------------------
Kwal_56.24634      -----------------MEKYGLSALLPLIRRED--------------------------
TBLA0E00510        -----------------MDRFGLKALVPLIRLDELQGTNNTNNNDTTEKIKTNTDENIEK
CAGL0I03388g       -----------------MSKFGLQKLVPLIRADE--------------------------
NCAS0A14130        -----------------MDKFGLKALVPLLRQDD--------------------------
KNAG0C03760        -----------------MDKFGLKALVPLVRQGD--------------------------
KAFR0B00850        -----------------MDKFGLKALIPLIKQDP--------------------------
Suva_4.81          -----------------MDKFGLQALVPLLKQED--------------------------
YDL165W            -----------------MEKFGLKALVPLLKLED--------------------------
Skud_4.92          -----------------MEKFGLRALVPLLKLED--------------------------
Smik_4.73          -----------------MEKFGLQALVPLLKLED--------------------------
NDAI0A01920        -----------------MDKFGLEALVPLIKPDD--------------------------
ZYRO0F11638g       -----------------MDKFGLEALVPLVKQED--------------------------
TDEL0C02010        -----------------MEKFGLKALVPLIKQEE--------------------------
TPHA0F02940        -----------------MDKFGLEALLPLIKQDD--------------------------
Kpol_530.34        -----------------MDKFGLEALLPLIKQDD--------------------------
                                    :..:**  *:*::.                             

KLLA0D12408g       ------------------------------------------------------------
ACL151C            ------------------------------------------------------------
Ecym_4726          ------------------------------------------------------------
SAKL0F11308g       ------------------------------------------------------------
KLTH0H01320g       ------------------------------------------------------------
Kwal_56.24634      ------------------------------------------------------------
TBLA0E00510        DTENSGENNVEDQGKGDKDETKKDSDGQDASKDKQEEPESKEEDNSKKETTTSKDSSSTK
CAGL0I03388g       ------------------------------------------------------------
NCAS0A14130        ------------------------------------------------------------
KNAG0C03760        ------------------------------------------------------------
KAFR0B00850        ------------------------------------------------------------
Suva_4.81          ------------------------------------------------------------
YDL165W            ------------------------------------------------------------
Skud_4.92          ------------------------------------------------------------
Smik_4.73          ------------------------------------------------------------
NDAI0A01920        ------------------------------------------------------------
ZYRO0F11638g       ------------------------------------------------------------
TDEL0C02010        ------------------------------------------------------------
TPHA0F02940        ------------------------------------------------------------
Kpol_530.34        ------------------------------------------------------------
                                                                               

KLLA0D12408g       ---------T------YDANMTLGIDLNSLLNSLDITKD-------TKSHHCLDAFESPW
ACL151C            ---------Q------YDAFMTLGVDVSSLLHSLQVSSKDGYNTALSNGHHALDTFPSPW
Ecym_4726          ---------Q------YDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTLDTFPSPW
SAKL0F11308g       ---------G---NAEYDPAMTMGMDLSSMLHSLGIDSNQ------EYKTRVLDTFPSPW
KLTH0H01320g       ---------Q---SPDYDSSMTLGIDLSPVLHSLGIPNNQ------PSRNRVLDTFQSPW
Kwal_56.24634      ---------Q---SPEYDSSMTLGIDLSPVLHSLGIASNQ------STRYRVLDTFQSPW
TBLA0E00510        KDDKLDTSITTTISSTIDHSLTIGADLSSMLHSLGLPRD-------NKRHRILDTFQSPW
CAGL0I03388g       ---------E-KDGKVYDHSMTIGTDLSSMLHSLGIPRD-------SKHHRVLDTFQSPW
NCAS0A14130        ---------K-ELSKPYDHSMTLGADLSSMIHSLGIPRD-------NTRHRVLDTFQSPW
KNAG0C03760        ---------P-EVASKYDHSMALGADLSSMLHSLGIPRD-------SKRQAVLATFQSPW
KAFR0B00850        ---------QGEKNGQYDHSMTLGADLSSMLYSLGIPRD-------KQHHRVLDTFQSPW
Suva_4.81          ---------K-ELSSTYDHSMTLGADLSSMLYSLGIPRD-------SQDHRVLDTFQSPW
YDL165W            ---------K-ELSSTYDHSMTLGADLSSMLYSLGIPRD-------SQDHRVLDTFQSPW
Skud_4.92          ---------K-ELSSTYDHSMTLGADLSSMLYSLGIPRD-------SQDHRVLDTFQSPW
Smik_4.73          ---------K-ELSSTYDHSMTLGADLSSMLYSLGIPRD-------SQDHRVLDTFQSPW
NDAI0A01920        ---------K-ELSKIYDHSMTLGADLTSMLHSLGIPRD-------SKRHRVLDTFQSPW
ZYRO0F11638g       ---------R-ELSGKYDHSMTLGADLSSMLHSLGIPRD-------SKRHKVLDTFQSPW
TDEL0C02010        ---------R-ETASLYDHSITLGADLSSMLHSLGIPRD-------SKRHRVLDTFQSPW
TPHA0F02940        ---------P-EFSKKYNHAMTIGADLTSIQHSLGIPNN-------NKRYRVLDTFQSPW
Kpol_530.34        ---------T-ELSKKYNHAMTIGTDLSSMLHSLGIPRD-------NQRYRILDTFQSPW
                                    :  :::* *: .:  ** :                * :* ***

KLLA0D12408g       VETSRSEVQPTFFIPESFKNIKGMLGTDQ--VE--FTSVNRDQPRISLLQDETLFYLFYK
ACL151C            VETSRSEVEPKFFIPESFCNIGGVLGQAS--TD--FTSVARDHPRISLLQDETLFYLFYK
Ecym_4726          VETSRSEVEPKFFIPESFKNIVGVLGQPS--TY--FTSVARDHPRISLLQDETLFYLFYK
SAKL0F11308g       VETSRSEVEPKFFTPESFVNIPNVLQSP---SPPSFNSVQQDHPKIALFQDETLFYLFYK
KLTH0H01320g       VETSRSEVEPKFFVPESFKNIPNVLQSGE--RPPAFNSVQQDHAKISLFQDETLFYLFYK
Kwal_56.24634      VETSRSEVEPKFFVPESFKNIPNVLQAGD--KPPAFNSVQQDHAKISLFQDETLFYLFYK
TBLA0E00510        AETSRSEVQPRFFIPSSFSNISNVLQCNT--TPPTFNNIELDQQRVALFQDETLFYLFYK
CAGL0I03388g       AETSRSEVEPKYYIPESFKNIPDVLQSKT--TPPTFDDVQTDQQRVALFQDETLFYLFYK
NCAS0A14130        AETSRSEVEPTFFIPDSFVGISGVLQSPV--TPPRFDSAQNDQQRVALFQDETLFYLFYK
KNAG0C03760        AETSRSEVEPTFYIPASFLGIDEVLQSES--TPPCFDSVQRDQQRVALFQDETLFYLFYK
KAFR0B00850        AETSRSEVEPKFSIPDSFNNISNVLQSNV--TPPCFDSIQNDQQRVALFQDETLFYLFYK
Suva_4.81          AETSRSEVEPRFFTPESFTNIPSVLQSNV--TPPCFNSIQNDQQRVALFQDETLFFLFYK
YDL165W            AETSRSEVEPRFFTPESFTNIPGVLQSTV--TPPCFNSIQNDQQRVALFQDETLFFLFYK
Skud_4.92          AETSRSEVEPRFFTPESFTNIPGVLQSNV--TPPCFNSIQNDQQRVALFQDETLFFLFYK
Smik_4.73          AETSRSEVEPRFFTPESFTNIPGVLQSNV--TPPCFNSIQNDQQRVALFQDETLFFLFYK
NDAI0A01920        AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK
ZYRO0F11638g       AETSRSEVEPRFFIPESFVNIPNVLHSQS--TPPCFNSVQQDQQRVALFQDETLFYLFYK
TDEL0C02010        AETSRSEVEPKFFIPDSFTNIPQVLQSQT--TPPCFNSVQHDQQRVALFQDETLFYLFYK
TPHA0F02940        AETSRSEVEPRYFTPKSFTNIPKVLQSID--TPSVFNSVETDQQRISLFQDETLFYLFYK
Kpol_530.34        AETSRSEVEPRFFTPESFKNIPNVLQSKV--TPPVFNSIENDQQRVTLFQDETLFYLFYK
                   .*******:* :  * **  *  :*          * .   *: .::*:******:****

KLLA0D12408g       HPGSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEK
ACL151C            HPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEK
Ecym_4726          HPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEK
SAKL0F11308g       HPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEK
KLTH0H01320g       HPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEK
Kwal_56.24634      HPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEK
TBLA0E00510        HPGTVIQELTYLELRKRNWRFHKILKTWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEK
CAGL0I03388g       HPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEK
NCAS0A14130        HPGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEK
KNAG0C03760        HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEK
KAFR0B00850        HPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEK
Suva_4.81          HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEK
YDL165W            HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEK
Skud_4.92          HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEK
Smik_4.73          HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEK
NDAI0A01920        HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK
ZYRO0F11638g       HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEK
TDEL0C02010        HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEK
TPHA0F02940        HPGTVIQELTYLELRKRNWRYHKILKAWLTKDPIVEPIVTADGQSERGSYIFFDPQRWEK
Kpol_530.34        HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEK
                   **.:*:**:******:****:*. *..****** :** *: .. **.***:*********

KLLA0D12408g       CQRDFVLHYNAIM
ACL151C            CQRDFILNYSAIM
Ecym_4726          CQRDFILNYNAIM
SAKL0F11308g       CQRDFVLFYNAIM
KLTH0H01320g       CQRDFVLFYNAIM
Kwal_56.24634      CQRDFVLFYNAIM
TBLA0E00510        CQREFILFYNAIM
CAGL0I03388g       CQRDFPLFYSAIM
NCAS0A14130        CQKDFLLFYNAIM
KNAG0C03760        CQRDFLLFYNAIM
KAFR0B00850        CQRDFLLFYNAIM
Suva_4.81          CQRDFLLFYNAIM
YDL165W            CQRDFLLFYNAIM
Skud_4.92          CQRDFLLFYNAIM
Smik_4.73          CQRDFLLFYNAIM
NDAI0A01920        CQREFLLFYNAIM
ZYRO0F11638g       CQRDFLLFYNAIM
TDEL0C02010        CQREFLLFYNAIM
TPHA0F02940        CQRDFVLFYNAIM
Kpol_530.34        CQREFVLFYNAIM
                   **.:* * *.***

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0D12408g
-----------------MEKYGLKDLVPVLRHDP--------------------------
------------------------------------------------------------
---------T------YDANMTLGIDLNSLLNSLDITKD-------TKSHHCLDAFESPW
VETSRSEVQPTFFIPESFKNIKGMLGTDQ--VE--FTSVNRDQPRISLLQDETLFYLFYK
HPGSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEK
CQRDFVLHYNAIM
>ACL151C
MVPMPHVAPSKAVEQLNMDKYGLKGLLPVIKHEK--------------------------
------------------------------------------------------------
---------Q------YDAFMTLGVDVSSLLHSLQVSSKDGYNTALSNGHHALDTFPSPW
VETSRSEVEPKFFIPESFCNIGGVLGQAS--TD--FTSVARDHPRISLLQDETLFYLFYK
HPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEK
CQRDFILNYSAIM
>Ecym_4726
-----------------MSKYGLKSLLPVIKHDK--------------------------
------------------------------------------------------------
---------Q------YDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTLDTFPSPW
VETSRSEVEPKFFIPESFKNIVGVLGQPS--TY--FTSVARDHPRISLLQDETLFYLFYK
HPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEK
CQRDFILNYNAIM
>SAKL0F11308g
---------------MAVEKYGLKALLPLIKQET--------------------------
------------------------------------------------------------
---------G---NAEYDPAMTMGMDLSSMLHSLGIDSNQ------EYKTRVLDTFPSPW
VETSRSEVEPKFFTPESFVNIPNVLQSP---SPPSFNSVQQDHPKIALFQDETLFYLFYK
HPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEK
CQRDFVLFYNAIM
>KLTH0H01320g
-----------------MEKYGLSALLPLIRRED--------------------------
------------------------------------------------------------
---------Q---SPDYDSSMTLGIDLSPVLHSLGIPNNQ------PSRNRVLDTFQSPW
VETSRSEVEPKFFVPESFKNIPNVLQSGE--RPPAFNSVQQDHAKISLFQDETLFYLFYK
HPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEK
CQRDFVLFYNAIM
>Kwal_56.24634
-----------------MEKYGLSALLPLIRRED--------------------------
------------------------------------------------------------
---------Q---SPEYDSSMTLGIDLSPVLHSLGIASNQ------STRYRVLDTFQSPW
VETSRSEVEPKFFVPESFKNIPNVLQAGD--KPPAFNSVQQDHAKISLFQDETLFYLFYK
HPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEK
CQRDFVLFYNAIM
>TBLA0E00510
-----------------MDRFGLKALVPLIRLDELQGTNNTNNNDTTEKIKTNTDENIEK
DTENSGENNVEDQGKGDKDETKKDSDGQDASKDKQEEPESKEEDNSKKETTTSKDSSSTK
KDDKLDTSITTTISSTIDHSLTIGADLSSMLHSLGLPRD-------NKRHRILDTFQSPW
AETSRSEVQPRFFIPSSFSNISNVLQCNT--TPPTFNNIELDQQRVALFQDETLFYLFYK
HPGTVIQELTYLELRKRNWRFHKILKTWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEK
CQREFILFYNAIM
>CAGL0I03388g
-----------------MSKFGLQKLVPLIRADE--------------------------
------------------------------------------------------------
---------E-KDGKVYDHSMTIGTDLSSMLHSLGIPRD-------SKHHRVLDTFQSPW
AETSRSEVEPKYYIPESFKNIPDVLQSKT--TPPTFDDVQTDQQRVALFQDETLFYLFYK
HPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEK
CQRDFPLFYSAIM
>NCAS0A14130
-----------------MDKFGLKALVPLLRQDD--------------------------
------------------------------------------------------------
---------K-ELSKPYDHSMTLGADLSSMIHSLGIPRD-------NTRHRVLDTFQSPW
AETSRSEVEPTFFIPDSFVGISGVLQSPV--TPPRFDSAQNDQQRVALFQDETLFYLFYK
HPGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEK
CQKDFLLFYNAIM
>KNAG0C03760
-----------------MDKFGLKALVPLVRQGD--------------------------
------------------------------------------------------------
---------P-EVASKYDHSMALGADLSSMLHSLGIPRD-------SKRQAVLATFQSPW
AETSRSEVEPTFYIPASFLGIDEVLQSES--TPPCFDSVQRDQQRVALFQDETLFYLFYK
HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEK
CQRDFLLFYNAIM
>KAFR0B00850
-----------------MDKFGLKALIPLIKQDP--------------------------
------------------------------------------------------------
---------QGEKNGQYDHSMTLGADLSSMLYSLGIPRD-------KQHHRVLDTFQSPW
AETSRSEVEPKFSIPDSFNNISNVLQSNV--TPPCFDSIQNDQQRVALFQDETLFYLFYK
HPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEK
CQRDFLLFYNAIM
>Suva_4.81
-----------------MDKFGLQALVPLLKQED--------------------------
------------------------------------------------------------
---------K-ELSSTYDHSMTLGADLSSMLYSLGIPRD-------SQDHRVLDTFQSPW
AETSRSEVEPRFFTPESFTNIPSVLQSNV--TPPCFNSIQNDQQRVALFQDETLFFLFYK
HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEK
CQRDFLLFYNAIM
>YDL165W
-----------------MEKFGLKALVPLLKLED--------------------------
------------------------------------------------------------
---------K-ELSSTYDHSMTLGADLSSMLYSLGIPRD-------SQDHRVLDTFQSPW
AETSRSEVEPRFFTPESFTNIPGVLQSTV--TPPCFNSIQNDQQRVALFQDETLFFLFYK
HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEK
CQRDFLLFYNAIM
>Skud_4.92
-----------------MEKFGLRALVPLLKLED--------------------------
------------------------------------------------------------
---------K-ELSSTYDHSMTLGADLSSMLYSLGIPRD-------SQDHRVLDTFQSPW
AETSRSEVEPRFFTPESFTNIPGVLQSNV--TPPCFNSIQNDQQRVALFQDETLFFLFYK
HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEK
CQRDFLLFYNAIM
>Smik_4.73
-----------------MEKFGLQALVPLLKLED--------------------------
------------------------------------------------------------
---------K-ELSSTYDHSMTLGADLSSMLYSLGIPRD-------SQDHRVLDTFQSPW
AETSRSEVEPRFFTPESFTNIPGVLQSNV--TPPCFNSIQNDQQRVALFQDETLFFLFYK
HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEK
CQRDFLLFYNAIM
>NDAI0A01920
-----------------MDKFGLEALVPLIKPDD--------------------------
------------------------------------------------------------
---------K-ELSKIYDHSMTLGADLTSMLHSLGIPRD-------SKRHRVLDTFQSPW
AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK
HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK
CQREFLLFYNAIM
>ZYRO0F11638g
-----------------MDKFGLEALVPLVKQED--------------------------
------------------------------------------------------------
---------R-ELSGKYDHSMTLGADLSSMLHSLGIPRD-------SKRHKVLDTFQSPW
AETSRSEVEPRFFIPESFVNIPNVLHSQS--TPPCFNSVQQDQQRVALFQDETLFYLFYK
HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEK
CQRDFLLFYNAIM
>TDEL0C02010
-----------------MEKFGLKALVPLIKQEE--------------------------
------------------------------------------------------------
---------R-ETASLYDHSITLGADLSSMLHSLGIPRD-------SKRHRVLDTFQSPW
AETSRSEVEPKFFIPDSFTNIPQVLQSQT--TPPCFNSVQHDQQRVALFQDETLFYLFYK
HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEK
CQREFLLFYNAIM
>TPHA0F02940
-----------------MDKFGLEALLPLIKQDD--------------------------
------------------------------------------------------------
---------P-EFSKKYNHAMTIGADLTSIQHSLGIPNN-------NKRYRVLDTFQSPW
AETSRSEVEPRYFTPKSFTNIPKVLQSID--TPSVFNSVETDQQRISLFQDETLFYLFYK
HPGTVIQELTYLELRKRNWRYHKILKAWLTKDPIVEPIVTADGQSERGSYIFFDPQRWEK
CQRDFVLFYNAIM
>Kpol_530.34
-----------------MDKFGLEALLPLIKQDD--------------------------
------------------------------------------------------------
---------T-ELSKKYNHAMTIGTDLSSMLHSLGIPRD-------NQRYRILDTFQSPW
AETSRSEVEPRFFTPESFKNIPNVLQSKV--TPPVFNSIENDQQRVTLFQDETLFYLFYK
HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEK
CQREFVLFYNAIM