MUSCLE (3.8) multiple sequence alignment

ACL150W            --------------MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREH
KNAG0C03770        -------------MGESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKN
KLTH0H01298g       --------------MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQH
Kwal_56.24635      --------------MASTRTSPNILVTGTPGCGKTSTCELLQRRLEGSKYYNISDFAKEY
Ecym_4725          MESSNMVATFFGNEMDSTRLRPNIIVTGTPGCGKTTTCELLQRRLDDCRYYNISDFAKEH
KAFR0B00860        ---------MVTETKESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKH
CAGL0I03366g       --------------MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEH
TBLA0E00520        --------------MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEF
KLLA0D12386g       --------------MEPVRFKPNIIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEH
Skud_4.91          --------------MELRRFGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDN
Suva_4.80          --------------MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDN
Smik_4.72          --------------MESRRYGPNIIVTGTPGCGKSSMCELLKNKLKDYKYYNISDFAKDH
YDL166C            --------------MEARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDN
ZYRO0F11660g       --------------MESRRYHPNVLITGTPGSGKSTTSELLQRRLSDFQYYNISDFAQEN
NDAI0A01910        -----------MTTDNSRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKEN
SAKL0F11330g       --------------METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREH
NCAS0A14140        -------------MSKSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEH
TPHA0F02950        ---------------MSRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEH
TDEL0C02000        --------------MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEH
Kpol_530.33        --------------MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEH
                                     *  **::::**** **:: .*:*   *    * ***:** . 

ACL150W            NCYDGYDEARKSHIVDEDRLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRCDNAI
KNAG0C03770        KCYDGYDEARKSHIVDEDKLLDELEPLLHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSV
KLTH0H01298g       ECYDGYDEARKSHIVDEDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTV
Kwal_56.24635      KCYDGYDEARKSHIVDEDKLLDELEPLLRAGGAIVDWHVNDVFPERLIDLVVVLRTDNSA
Ecym_4725          DCYEGYDEGRKSHIVDEDKLLDELEPLLRKGGAIIDWHVNDVFPERLIDLVVVLRCDNST
KAFR0B00860        KCYDGYDESRKSHIVDDDKLLDELEPLLRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSI
CAGL0I03366g       KCYDGYDEGRKSHIVDEDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRSENGK
TBLA0E00520        NCYDGFDKGRKSHIVDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSV
KLLA0D12386g       DCYDGYDDARKSNIVDDDKLLDELEPLLRKGGCIIDWHVNDVFPERLVDLVVVLRCDNGI
Skud_4.91          DCFEAYDEARKSHIVDEDKLLDKLEPLLRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSN
Suva_4.80          DCFEGYDEGRKSHIVDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSK
Smik_4.72          DCFEGYDEGRKSHIVDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSY
YDL166C            DCFEGYDEGRKSHIVDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSN
ZYRO0F11660g       DCFDGYDEGRKSHIVDEDKLLDLLEPLLRKGGNIIDWHVNDVFPERLIDLVVVLRCENSI
NDAI0A01910        DCYEGYDKGRKSHIVDEDKLLDELEPLLRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSI
SAKL0F11330g       KCYDGYDEVRKSHIVDEDKLLDELEPLLRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSI
NCAS0A14140        DCYDGYDKGRKSHIVDEDKLLDELEPLLRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSV
TPHA0F02950        NCYDGFDEGRKSHIVDEDKLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSV
TDEL0C02000        DCHDGYDEARKSYIVDEDKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRCDNTI
Kpol_530.33        DCYEGYDEDRKSHIVDEDKLLDELEPLLREGGSIVDWHVNDVFPERLIDLVVVLRCDNSI
                   .*.:.:*. *** ***:*.*** ***::  *  *:******:*****:***.:** :.  

ACL150W            LHDRLQKRGYHSSKIEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAA
KNAG0C03770        LFDRLNKREYHSSKIDENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVT
KLTH0H01298g       LYDRLKSRGYHEAKIQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIAS
Kwal_56.24635      LFDRLSKRGYHEAKIQENIDAEIMGVVMHDARDSYAQEIVVELQSDTTEQMDENVDRIVT
Ecym_4725          LYDRLHKRGYHDAKIEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVA
KAFR0B00860        LFDRLHGRGYHESKIQENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVA
CAGL0I03366g       LYDRLKARGYHDSKIEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINT
TBLA0E00520        LYDRLQNRKYHDAKVQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVS
KLLA0D12386g       LYDRLNKRGYHNAKIEENMDAEIMGVVLQDAHDSYAQEIVVELQSDTTEEMDKNVDRIIA
Skud_4.91          LYSRLHARGYHDSKIEENLDAEIMGVVKQDAVDSYEPHIVVELQGDTKEDMVSNVARIVA
Suva_4.80          LYSRLHARGYHDSKIEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIA
Smik_4.72          LYSRLHARGYHDSKIEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIIT
YDL166C            LYSRLHARGYHDSKIEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVA
ZYRO0F11660g       LFKRLKKRGYHQTKIDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVS
NDAI0A01910        LYDRLNKRGYHDSKIQENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVE
SAKL0F11330g       LYDRLHKRGYHDSKIEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVE
NCAS0A14140        LYDRLHGRKYHDTKIEENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVD
TPHA0F02950        LYDRLKSRGYHDSKIDENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVD
TDEL0C02000        LYDRLKSRDYHDAKIQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVS
Kpol_530.33        LYDRLHARKYHDSKIQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVD
                   *..**  * **.:*::**:******** :** :**   **:** .:  : :  ** .:  

ACL150W            WEANWVSEHPDGVSNALQQHAGSDASSSEADSDGVSDAGDSDGDGDGDSTQDN-------
KNAG0C03770        WTTMWKEQHPEGVTNELSAHQAKKERNDESEEGDFEEQGSDASSESESDSESEGSK----
KLTH0H01298g       WSAAWLEQNPKGVTNELVE----------RGSDEEDGTDEEGGSYGNSASSGEDGEDA--
Kwal_56.24635      WRDAWREQHPEGVTNELNGADHSDDEGTEGSSEEEHEEPESEEEKGDSSYQEASDASEDQ
Ecym_4725          WESSWVSQHPTGVTNELQQDYQSNDESDLDQYDLAKDEGDPNEDKESSNSDTDA------
KAFR0B00860        WQEMWLTQHKNGVTNEYQGELPKDSNSDEEQQEESSASSDESSSDESETAEEDAGSN---
CAGL0I03366g       WVDNWVEEHKDGVSSELKD-----------GKKYASYSSEEEEETSDGEDEEASASD---
TBLA0E00520        WVELWKKQHADGVTNELGE-----------IKKDQSESEDESESEGESQSDNEE------
KLLA0D12386g       WQEIWLKQHKKGVTNELDD----------GVADEAVEEDEEDEEDDHDEPSTSEE-----
Skud_4.91          WEKMWLEQHSDGVTNEYQG----------------PHGDDEESE----------------
Suva_4.80          WEKMWLEQHPEGVTNEYQG----------------GRSDDEDDEDNEDNEDDEDDE----
Smik_4.72          WEKMWLEQHPEGVTNEYQG----------------SRSDDEEDEDSE-------------
YDL166C            WEKMWLEQHPDGVTNEYQG----------------PRSDDEDDEDSE-------------
ZYRO0F11660g       WVELWQDQHHSGVTNELHE----------------QESDSESESESDE------------
NDAI0A01910        WHKMWMDQHKNGVTNELQG-----------KNKNAQNSGESSSEQEEEEEEDSDTN----
SAKL0F11330g       WQEMWLNQHPNGVTNELEP-----------ESDNASDSDDTHGSADTSDSEQE-------
NCAS0A14140        WQKMWLEQHEDGVTNELEDKQRNSDESGSESNDNEDDPEDANSPDDEFSESESESQE---
TPHA0F02950        WVELWIKQHKNGVTNELSKKAA------SSANESASESEQKEEEEEEEEEEGSDDGN---
TDEL0C02000        WEKLWLKQHKDGQTNELLE-------RTKGDSEEDNESEQSSEEKSPSDEEDTQ------
Kpol_530.33        WVELWLKQHKKGVTNELEE----------------GVSSDDNESD---------------
                   *   *  ::  * :.                        .                    

FASTA FORMAT for MUSCLE Version 3.6

>ACL150W
--------------MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREH
NCYDGYDEARKSHIVDEDRLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRCDNAI
LHDRLQKRGYHSSKIEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAA
WEANWVSEHPDGVSNALQQHAGSDASSSEADSDGVSDAGDSDGDGDGDSTQDN-------
>KNAG0C03770
-------------MGESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKN
KCYDGYDEARKSHIVDEDKLLDELEPLLHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSV
LFDRLNKREYHSSKIDENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVT
WTTMWKEQHPEGVTNELSAHQAKKERNDESEEGDFEEQGSDASSESESDSESEGSK----
>KLTH0H01298g
--------------MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQH
ECYDGYDEARKSHIVDEDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTV
LYDRLKSRGYHEAKIQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIAS
WSAAWLEQNPKGVTNELVE----------RGSDEEDGTDEEGGSYGNSASSGEDGEDA--
>Kwal_56.24635
--------------MASTRTSPNILVTGTPGCGKTSTCELLQRRLEGSKYYNISDFAKEY
KCYDGYDEARKSHIVDEDKLLDELEPLLRAGGAIVDWHVNDVFPERLIDLVVVLRTDNSA
LFDRLSKRGYHEAKIQENIDAEIMGVVMHDARDSYAQEIVVELQSDTTEQMDENVDRIVT
WRDAWREQHPEGVTNELNGADHSDDEGTEGSSEEEHEEPESEEEKGDSSYQEASDASEDQ
>Ecym_4725
MESSNMVATFFGNEMDSTRLRPNIIVTGTPGCGKTTTCELLQRRLDDCRYYNISDFAKEH
DCYEGYDEGRKSHIVDEDKLLDELEPLLRKGGAIIDWHVNDVFPERLIDLVVVLRCDNST
LYDRLHKRGYHDAKIEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVA
WESSWVSQHPTGVTNELQQDYQSNDESDLDQYDLAKDEGDPNEDKESSNSDTDA------
>KAFR0B00860
---------MVTETKESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKH
KCYDGYDESRKSHIVDDDKLLDELEPLLRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSI
LFDRLHGRGYHESKIQENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVA
WQEMWLTQHKNGVTNEYQGELPKDSNSDEEQQEESSASSDESSSDESETAEEDAGSN---
>CAGL0I03366g
--------------MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEH
KCYDGYDEGRKSHIVDEDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRSENGK
LYDRLKARGYHDSKIEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINT
WVDNWVEEHKDGVSSELKD-----------GKKYASYSSEEEEETSDGEDEEASASD---
>TBLA0E00520
--------------MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEF
NCYDGFDKGRKSHIVDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSV
LYDRLQNRKYHDAKVQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVS
WVELWKKQHADGVTNELGE-----------IKKDQSESEDESESEGESQSDNEE------
>KLLA0D12386g
--------------MEPVRFKPNIIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEH
DCYDGYDDARKSNIVDDDKLLDELEPLLRKGGCIIDWHVNDVFPERLVDLVVVLRCDNGI
LYDRLNKRGYHNAKIEENMDAEIMGVVLQDAHDSYAQEIVVELQSDTTEEMDKNVDRIIA
WQEIWLKQHKKGVTNELDD----------GVADEAVEEDEEDEEDDHDEPSTSEE-----
>Skud_4.91
--------------MELRRFGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDN
DCFEAYDEARKSHIVDEDKLLDKLEPLLRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSN
LYSRLHARGYHDSKIEENLDAEIMGVVKQDAVDSYEPHIVVELQGDTKEDMVSNVARIVA
WEKMWLEQHSDGVTNEYQG----------------PHGDDEESE----------------
>Suva_4.80
--------------MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDN
DCFEGYDEGRKSHIVDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSK
LYSRLHARGYHDSKIEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIA
WEKMWLEQHPEGVTNEYQG----------------GRSDDEDDEDNEDNEDDEDDE----
>Smik_4.72
--------------MESRRYGPNIIVTGTPGCGKSSMCELLKNKLKDYKYYNISDFAKDH
DCFEGYDEGRKSHIVDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSY
LYSRLHARGYHDSKIEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIIT
WEKMWLEQHPEGVTNEYQG----------------SRSDDEEDEDSE-------------
>YDL166C
--------------MEARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDN
DCFEGYDEGRKSHIVDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSN
LYSRLHARGYHDSKIEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVA
WEKMWLEQHPDGVTNEYQG----------------PRSDDEDDEDSE-------------
>ZYRO0F11660g
--------------MESRRYHPNVLITGTPGSGKSTTSELLQRRLSDFQYYNISDFAQEN
DCFDGYDEGRKSHIVDEDKLLDLLEPLLRKGGNIIDWHVNDVFPERLIDLVVVLRCENSI
LFKRLKKRGYHQTKIDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVS
WVELWQDQHHSGVTNELHE----------------QESDSESESESDE------------
>NDAI0A01910
-----------MTTDNSRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKEN
DCYEGYDKGRKSHIVDEDKLLDELEPLLRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSI
LYDRLNKRGYHDSKIQENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVE
WHKMWMDQHKNGVTNELQG-----------KNKNAQNSGESSSEQEEEEEEDSDTN----
>SAKL0F11330g
--------------METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREH
KCYDGYDEVRKSHIVDEDKLLDELEPLLRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSI
LYDRLHKRGYHDSKIEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVE
WQEMWLNQHPNGVTNELEP-----------ESDNASDSDDTHGSADTSDSEQE-------
>NCAS0A14140
-------------MSKSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEH
DCYDGYDKGRKSHIVDEDKLLDELEPLLRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSV
LYDRLHGRKYHDTKIEENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVD
WQKMWLEQHEDGVTNELEDKQRNSDESGSESNDNEDDPEDANSPDDEFSESESESQE---
>TPHA0F02950
---------------MSRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEH
NCYDGFDEGRKSHIVDEDKLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSV
LYDRLKSRGYHDSKIDENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVD
WVELWIKQHKNGVTNELSKKAA------SSANESASESEQKEEEEEEEEEEGSDDGN---
>TDEL0C02000
--------------MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEH
DCHDGYDEARKSYIVDEDKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRCDNTI
LYDRLKSRDYHDAKIQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVS
WEKLWLKQHKDGQTNELLE-------RTKGDSEEDNESEQSSEEKSPSDEEDTQ------
>Kpol_530.33
--------------MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEH
DCYEGYDEDRKSHIVDEDKLLDELEPLLREGGSIVDWHVNDVFPERLIDLVVVLRCDNSI
LYDRLHARKYHDSKIQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVD
WVELWLKQHKKGVTNELEE----------------GVSSDDNESD---------------