MUSCLE (3.8) multiple sequence alignment

KNAG0C03790        ------------------------------------------------------------
KAFR0B00880        ------------------------------------------------------------
Ecym_4723          ------------------------------------------------------------
CAGL0L01111g       ------------------------------------------------------------
ACL148C            ------------------------------------------------------------
Skud_4.89          ------------------------------------------------------------
Suva_4.78          ------------------------------------------------------------
Smik_4.70          ------------------------------------------------------------
YDL168W            ------------------------------------------------------------
ZYRO0F11704g       ------------------------------------------------------------
TPHA0F02970        ------------------------------------------------------------
TDEL0C01980        ------------------------------------------------------------
KLLA0D12342g       ------------------------------------------------------------
NDAI0A01890        MLPKTFNRKVFTTFSSVFQKRPPLCTSLRLITTTEGRGFLQSKSEKYKAKQFNTQLNQNK
Kpol_530.31        ------------------------------------------------------------
NCAS0A14160        -----------------MRLSLPRIIPALKNGAILFRGKPLTINKSLHNHSTVVLGGKPH
SAKL0F11374g       ------------------------------------------------------------
KLTH0H01254g       ------------------------------------------------------------
Kwal_56.24642      ------------------------------------------------------------
                                                                               

KNAG0C03790        -------------------------MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTG
KAFR0B00880        -------------------------MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKA
Ecym_4723          -------------------------MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKA
CAGL0L01111g       ---------------------------MTEGKPIECLAAVAYEAGKPQVVEQIVVDPPKA
ACL148C            -------------------------MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKA
Skud_4.89          ------------------------MLAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKA
Suva_4.78          ------------------------MSASTVGKPIQCIAAIAYDAKKPLSVEEITVDPPKA
Smik_4.70          ------------------------MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKA
YDL168W            ------------------------MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKA
ZYRO0F11704g       --------------------------MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKA
TPHA0F02970        --------------------------MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKA
TDEL0C01980        -----------------------MSGAATEGKSITCVAAVAYEAGKPLTVEEITVEAPRA
KLLA0D12342g       ------------------------MTSATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKA
NDAI0A01890        LTNISIGKLPISRSPLTQFIQTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKA
Kpol_530.31        --------------------------MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKA
NCAS0A14160        IFSKAHLYCSPTFTQVKGLHQNHYNMSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKA
SAKL0F11374g       -------------------------MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKA
KLTH0H01254g       ---------------------------MSEGKPITCTAAVAYEAGKPLTVEEIVVDPPKA
Kwal_56.24642      ---------------------------MSEGKPITCLAAVAYEAGKPLTIEEIVVDPPKA
                                               : *:.: . **:** * :.  :  : *:.* .

KNAG0C03790        --ARGAYQDHQHCYLPHGCVHSVWFGSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHV
KAFR0B00880        HEVRIKIMNTAICHTDAYTLSGVDPEGLFPCI---LGHEGSGIVESIGEGVTSVKVGDHV
Ecym_4723          HEVRIKITHTALCHTDAYTLSGVDPEGIFPSI---LGHEGSGIVESVGTGVTNVKVGDHV
CAGL0L01111g       HEVRIKIVNTAVCHTDAYTLSGADPEGLFPCV---LGHEGAGIVESVGDGVTNVKPGDHV
ACL148C            HEVRIKIVNSAICHTDAYTLSGSDPEGLFPCI---LGHEGSGIVESVGEGVTNVKPGDHV
Skud_4.89          HEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCI---LGHEGAGIVESVGDDVMTVKPGDHV
Suva_4.78          HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCI---LGHEGAGIVESVGDDVTTVKPGDHV
Smik_4.70          HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCI---LGHEGAGIVESVGDGVVTVKPGDHV
YDL168W            HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCV---LGHEGAGIVESVGDDVITVKPGDHV
ZYRO0F11704g       HEVRIRVKKTAVCHTDAYTLSGADPEGAFPSI---LGHEGAGIVESVGEGVTSVKPGDHV
TPHA0F02970        HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCV---LGHEGSGIVESIGADVTNVKVGDHV
TDEL0C01980        HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSI---LGHEGAGIVESVGEGVTNVKPGDHV
KLLA0D12342g       HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSI---LGHEGAGIVESVGDGVTNVKVGDHV
NDAI0A01890        HEVRIKIDYTAVCHTDAYTLSGVDPEGAFPSI---LGHEGSGIVESVGEGVTNVKVGDHV
Kpol_530.31        HEVRIKIINTAVCHTDAYTLSGVDPEGLFPCV---LGHEGSGIVESVGDNVTTVKPGDHV
NCAS0A14160        HEVRIKIEYTAVCHTDAYTLSGIDPEGAFPSI---LGHEGSGIVESVGEGVTNVKVGDHV
SAKL0F11374g       HEVRIRITYTAVCHTDAYTLSGVDPEGAFPSI---LGHEGAGVVESVGKGVTNVKPGDHV
KLTH0H01254g       HEVRIKVEYTAVCHTDAYTLSGVDPEGAFPSI---LGHEGAGVVESVGEGVTNVKAGDHV
Kwal_56.24642      HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSI---LGHEGAGIVESIGEGVTNVKPGDHV
                     .*        *:     : .    . . .:   :*  *:*:***:* .* .** ****

KNAG0C03790        IALYTAECKECKMCKSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAE
KAFR0B00880        IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSE
Ecym_4723          IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSE
CAGL0L01111g       IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSE
ACL148C            VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSE
Skud_4.89          IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSE
Suva_4.78          IALYTAECGKCKFCTSGKTNLCSAVRATQGRGIMPDETTRFHNGKGEDIYHFMGCSTFSE
Smik_4.70          IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSE
YDL168W            IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSE
ZYRO0F11704g       VALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSE
TPHA0F02970        IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQ
TDEL0C01980        IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQ
KLLA0D12342g       VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQ
NDAI0A01890        IALYTAECGECKFCKSGXXXXX--------------------------------------
Kpol_530.31        VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSE
NCAS0A14160        IALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQ
SAKL0F11374g       VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQ
KLTH0H01254g       IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQ
Kwal_56.24642      IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQ
                   : ****** :**:* *.                                           

KNAG0C03790        YTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVV
KAFR0B00880        YTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVV
Ecym_4723          YTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVV
CAGL0L01111g       YTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVL
ACL148C            YTVVADVSVVAVDQQAPLETVCLLGCGVTTGYGAAVKTADVQEGDTVAVFGAGTVGLSVV
Skud_4.89          YTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVM
Suva_4.78          YTVVADVSVVAIDPKAPLDAASLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVI
Smik_4.70          YTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVI
YDL168W            YTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVI
ZYRO0F11704g       YTVVADVSVVAVDPKAPLESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVA
TPHA0F02970        YTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVV
TDEL0C01980        YTVVADVSVVAVDPSAPLESICLLGCGVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVI
KLLA0D12342g       YTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVV
NDAI0A01890        --------XXAVDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVV
Kpol_530.31        YTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVV
NCAS0A14160        YTVVADVSVVAVDPKAPLDSISLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVV
SAKL0F11374g       YTVVADVSVVAVDSQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVV
KLTH0H01254g       YTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIFGAGTVGLSVV
Kwal_56.24642      YTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVV
                             :.*  ..:.  .*********:*** *:*::*:*****:**.**:**** 

KNAG0C03790        QGAKAREASKIIVVDINDTKKKFAFDFGATDFVNPKTDLKDGQTIVEKLVEMTDGGLDFT
KAFR0B00880        QGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYT
Ecym_4723          QGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHT
CAGL0L01111g       QGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHT
ACL148C            QGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGETIVARLIEMTDGGLDHT
Skud_4.89          QGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFT
Suva_4.78          QGAKARGASKIIGIDINNKKKQYCFDFGATDFINPKEDLAKGQTIVEKLIETTDGGLDFT
Smik_4.70          QGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFT
YDL168W            QGAKLRGASKIIAIDINNKKKQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFT
ZYRO0F11704g       QGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDGGLDFT
TPHA0F02970        QGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKE-LKDSEDIVSKLIEMTDGGLDFT
TDEL0C01980        QGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDGGLDYT
KLLA0D12342g       QGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFT
NDAI0A01890        QGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLEYT
Kpol_530.31        QGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSE-LPEGQDIVSKLVEMTDGGLDFT
NCAS0A14160        QGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIVQKLIEMTDGGLEYT
SAKL0F11374g       QGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFT
KLTH0H01254g       QGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFT
Kwal_56.24642      QGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYT
                   ***. * .*.:* :* *: *..:  .****.*:**   * ..: **  *:. *****:.*

KNAG0C03790        FDGTGNVQVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGR
KAFR0B00880        FDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIKGR
Ecym_4723          FDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGR
CAGL0L01111g       FDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGVKGR
ACL148C            FDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGR
Skud_4.89          FDCTGNTNIMRDALEACHKGWGQSIIIGVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGR
Suva_4.78          FDCTGNTKIMRDALEACHKGWGQSIIIGVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGR
Smik_4.70          FDCTGNTKIMRDALEACHKGWGQSIIIGVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGR
YDL168W            FDCTGNTKIMRDALEACHKGWGQSIIIGVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGR
ZYRO0F11704g       FDCTGNVKVMRDALEACHKGWGVSVVIGVAASGQEISTRPFQLVTGRVWKGSAFGGIKGR
TPHA0F02970        FDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGR
TDEL0C01980        FDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVTGRVWKGSAFGGIKGR
KLLA0D12342g       FDCTGNVKVMRDALEACHKGWGQSIIIGVAAAGEEISTRPFQLITGRVWKGSAFGGIKGR
NDAI0A01890        FDCTGNTKVMRDALEACHKGWGESIIIGVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGR
Kpol_530.31        FDCTGNVNVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGR
NCAS0A14160        FDCTGNVKVMRDALEACHKGWGESIIIGVAGAGEEISTRPFQLVTGRVWKGSAFGGIKGR
SAKL0F11374g       FDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGR
KLTH0H01254g       FDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGR
Kwal_56.24642      FDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGR
                   ** ***. :**.********** *.:****.: :**:******:*****.*:***.:***

KNAG0C03790        SEMGSLIEDYNKGNLKIDEFITNKRPFKEINEGFEDLHHGDCLRTVLNY----
KAFR0B00880        TDMPQLLDDYEKGLLKIDEFITHRRQFDEINDGFEDLHMGTCLRTVLKF----
Ecym_4723          SEMGNLISDYFAGKLKVDEFVTHTRPFSEINDGLTDLHHGDCLRTVLNF----
CAGL0L01111g       SEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDDLHNGLCLRTVLSFSK--
ACL148C            SEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSGFEDLHHGDCLRTVLSL----
Skud_4.89          SEMGGLIKDYQSGALKVEEFITHRRPFKEINQAFEDLHNGDCLRTVLRFQEE-
Suva_4.78          SEMGGLIKDYQNGALKVEEFITHRRPFKEINQAFEDLHQGDCLRTVLKFDKK-
Smik_4.70          SEMGGLIKDYQSGVLKVEEFITHRRPFKEINHAFEDLHNGDCLRTVLKFDETK
YDL168W            SEMGGLIKDYQKGALKVEEFITHRRPFKEINQAFEDLHNGDCLRTVLKSDEIK
ZYRO0F11704g       SEMGGLIKDYQGGALKVDEFITNRRPFKQINEAFEDLHAGDSLRTVLNYTD--
TPHA0F02970        SEMGGLIKDYQSGTLKVDEFITGRRPFTEINAAFEDLHNGSCLRTVLDTST--
TDEL0C01980        SEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHAGDCLRTVLDLKK--
KLLA0D12342g       SEMGQLVTSYQKGDLKVDDFITHKRPFTEINNAFEDLHHGDCLRTVLDLAN--
NDAI0A01890        SEMGGLIKDYQNGNLKVDEFITHRRPFTEINNAFEDLHHGDCLRTVLDLSK--
Kpol_530.31        SEMGGLIKDYQNGSLKVDEFITNRRPFVEINDAFEELHHGNCLRTVLSFK---
NCAS0A14160        SEMGGLIEDYQNGKLKVDEFITHRRPFTEINDAFEDLHHGDCLRTVLDLAK--
SAKL0F11374g       SEMGGLVSDYMDGQLKVDEFITHRRPFTEINAAFDDLHHGDCLRTVLDLSK--
KLTH0H01254g       SEMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGDCLRTVLDLSK--
Kwal_56.24642      SEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGDCLRTVLDLLK--
                   ::*  *: .*  * **:::*:*  * * :** .: :** * .*****      

FASTA FORMAT for MUSCLE Version 3.6

>KNAG0C03790
------------------------------------------------------------
-------------------------MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTG
--ARGAYQDHQHCYLPHGCVHSVWFGSEVRCVSLCFGARGAGVVESVGPDVTSVKVGDHV
IALYTAECKECKMCKSGKTNLCSAVRATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAE
YTVVADVSVVAIDRDAPLEKVCLLGCGVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVV
QGAKAREASKIIVVDINDTKKKFAFDFGATDFVNPKTDLKDGQTIVEKLVEMTDGGLDFT
FDGTGNVQVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGR
SEMGSLIEDYNKGNLKIDEFITNKRPFKEINEGFEDLHHGDCLRTVLNY----
>KAFR0B00880
------------------------------------------------------------
-------------------------MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKA
HEVRIKIMNTAICHTDAYTLSGVDPEGLFPCI---LGHEGSGIVESIGEGVTSVKVGDHV
IPLYTAECQKCKFCKSGKTNLCGAVRETQGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSE
YTVVADVSVVAIDKKVSLEPASLLGCGVTTGFGAAVKAANVQKGDTVAVFGAGTVGLSVV
QGARMRGCSKVIVVDINDEKKQFSYDFGATDFVNPMTDLKDGETIVNKLISMTDGGLDYT
FDCTGNVHVMRNALEACHKGWGQSFIIGVAAAGQEISTRPFQLVTGRVWRGTAFGDIKGR
TDMPQLLDDYEKGLLKIDEFITHRRQFDEINDGFEDLHMGTCLRTVLKF----
>Ecym_4723
------------------------------------------------------------
-------------------------MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKA
HEVRIKITHTALCHTDAYTLSGVDPEGIFPSI---LGHEGSGIVESVGTGVTNVKVGDHV
IPLYTAECQECKFCISGKTNLCGSVRATQGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSE
YTVVADVSVVAIDEKAPLDKVCLLGCGVTTGYGAAVKTADVQKGDTVAVFGAGTVGLSVV
QGAQSRGASKIIVVDINDDKKKWSFDFGATDFINPTKDLNDGETIVSKLIDMTDGGLDHT
FDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGR
SEMGNLISDYFAGKLKVDEFVTHTRPFSEINDGLTDLHHGDCLRTVLNF----
>CAGL0L01111g
------------------------------------------------------------
---------------------------MTEGKPIECLAAVAYEAGKPQVVEQIVVDPPKA
HEVRIKIVNTAVCHTDAYTLSGADPEGLFPCV---LGHEGAGIVESVGDGVTNVKPGDHV
IALYTAECQKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSE
YTVVADVSVVAIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVL
QGAHQRGASRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHT
FDCTGNVNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGVKGR
SEMAGLIEQYKKGELKVDEFITHRRSFNEINEAFDDLHNGLCLRTVLSFSK--
>ACL148C
------------------------------------------------------------
-------------------------MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKA
HEVRIKIVNSAICHTDAYTLSGSDPEGLFPCI---LGHEGSGIVESVGEGVTNVKPGDHV
VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSE
YTVVADVSVVAVDQQAPLETVCLLGCGVTTGYGAAVKTADVQEGDTVAVFGAGTVGLSVV
QGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGETIVARLIEMTDGGLDHT
FDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGR
SEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSGFEDLHHGDCLRTVLSL----
>Skud_4.89
------------------------------------------------------------
------------------------MLAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKA
HEVRIKIEFTAVCHTDAYTLSGSDPEGLFPCI---LGHEGAGIVESVGDDVMTVKPGDHV
IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSE
YTVVADVSVVAIDPKAPLDAACLLGCGVTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVM
QGAKSRGASKIIAVDINNKKRQYSSNFGATDFINPKEDLAEDQTIVEKLIDMTDGGLDFT
FDCTGNTNIMRDALEACHKGWGQSIIIGVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGR
SEMGGLIKDYQSGALKVEEFITHRRPFKEINQAFEDLHNGDCLRTVLRFQEE-
>Suva_4.78
------------------------------------------------------------
------------------------MSASTVGKPIQCIAAIAYDAKKPLSVEEITVDPPKA
HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCI---LGHEGAGIVESVGDDVTTVKPGDHV
IALYTAECGKCKFCTSGKTNLCSAVRATQGRGIMPDETTRFHNGKGEDIYHFMGCSTFSE
YTVVADVSVVAIDPKAPLDAASLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVI
QGAKARGASKIIGIDINNKKKQYCFDFGATDFINPKEDLAKGQTIVEKLIETTDGGLDFT
FDCTGNTKIMRDALEACHKGWGQSIIIGVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGR
SEMGGLIKDYQNGALKVEEFITHRRPFKEINQAFEDLHQGDCLRTVLKFDKK-
>Smik_4.70
------------------------------------------------------------
------------------------MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKA
HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCI---LGHEGAGIVESVGDGVVTVKPGDHV
IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSE
YTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVI
QGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFT
FDCTGNTKIMRDALEACHKGWGQSIIIGVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGR
SEMGGLIKDYQSGVLKVEEFITHRRPFKEINHAFEDLHNGDCLRTVLKFDETK
>YDL168W
------------------------------------------------------------
------------------------MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKA
HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCV---LGHEGAGIVESVGDDVITVKPGDHV
IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSE
YTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVI
QGAKLRGASKIIAIDINNKKKQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFT
FDCTGNTKIMRDALEACHKGWGQSIIIGVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGR
SEMGGLIKDYQKGALKVEEFITHRRPFKEINQAFEDLHNGDCLRTVLKSDEIK
>ZYRO0F11704g
------------------------------------------------------------
--------------------------MSTEGKPVTSLAAVAYEAGKPLSVEEITVDPPKA
HEVRIRVKKTAVCHTDAYTLSGADPEGAFPSI---LGHEGAGIVESVGEGVTSVKPGDHV
VALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFKNKKGETLLHFMGCSTFSE
YTVVADVSVVAVDPKAPLESACLLGCGVTTGYGAAVKTANVQKGDTVAIFGAGTVGLSVA
QGAKARGASQIILVDINDAKKKYMHEFGATDFINPATDLQNGQTIVEKLIEMTDGGLDFT
FDCTGNVKVMRDALEACHKGWGVSVVIGVAASGQEISTRPFQLVTGRVWKGSAFGGIKGR
SEMGGLIKDYQGGALKVDEFITNRRPFKQINEAFEDLHAGDSLRTVLNYTD--
>TPHA0F02970
------------------------------------------------------------
--------------------------MSAVGKPITCTAAIAYEANKPLTVTEIVVDPPKA
HEVRIKIVKTAVCHTDAYSLSGVDPEGLFPCV---LGHEGSGIVESIGADVTNVKVGDHV
IALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQ
YTVVADVSLVAFDKSVSFEPTALLGCGVTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVV
QGAKSRGASKIIVVDLNNDKKDWSFEFGATDFVNPKE-LKDSEDIVSKLIEMTDGGLDFT
FDCTGNVNVMRNALEACHKGWGQSIIIGVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGR
SEMGGLIKDYQSGTLKVDEFITGRRPFTEINAAFEDLHNGSCLRTVLDTST--
>TDEL0C01980
------------------------------------------------------------
-----------------------MSGAATEGKSITCVAAVAYEAGKPLTVEEITVEAPRA
HEVRIKIEYTAVCHTDAYTLSGVDPEGAFPSI---LGHEGAGIVESVGEGVTNVKPGDHV
IALYTAECQKCKFCKSGKTNLCSSVRATQGKGVMPDGTSRFKNQKGEELKHFMGCSTFSQ
YTVVADVSVVAVDPSAPLESICLLGCGVTTGYGAATKTANVQKGDTVAVFGAGTVGLSVI
QGAKVRGASRIILVDINDQKRKYGNEFGATDFINPKSDLKDGQTIVEKLIEMTDGGLDYT
FDCTGNTKVMRDALEACHKGWGTSVIIGVAAAEEEISTRPFQLVTGRVWKGSAFGGIKGR
SEMGGLIEDYKKGTLKVDEFITNERPFTEINKAFEDLHAGDCLRTVLDLKK--
>KLLA0D12342g
------------------------------------------------------------
------------------------MTSATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKA
HEVRVQVTHTAVCHTDAYTLSGVDPEGAFPSI---LGHEGAGIVESVGDGVTNVKVGDHV
VLLYTAECGKCKFCKSNKTNLCGSVRATQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQ
YTVVADVSLVTIDPSAPLSSVCLLGCGVTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVV
QGAKSRGASKIIVVDVNDQKKQWSMDFGATGFVNPLKDLKEGETIVSKLIDMTDGGLDFT
FDCTGNVKVMRDALEACHKGWGQSIIIGVAAAGEEISTRPFQLITGRVWKGSAFGGIKGR
SEMGQLVTSYQKGDLKVDDFITHKRPFTEINNAFEDLHHGDCLRTVLDLAN--
>NDAI0A01890
MLPKTFNRKVFTTFSSVFQKRPPLCTSLRLITTTEGRGFLQSKSEKYKAKQFNTQLNQNK
LTNISIGKLPISRSPLTQFIQTRSIMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKA
HEVRIKIDYTAVCHTDAYTLSGVDPEGAFPSI---LGHEGSGIVESVGEGVTNVKVGDHV
IALYTAECGECKFCKSGXXXXX--------------------------------------
--------XXAVDKNAPMDSICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVV
QGAKARGASKIIVVDVNDQKKQWSMDFGATDFINPKTDLKEGETIVSKLIEMTDGGLEYT
FDCTGNTKVMRDALEACHKGWGESIIIGVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGR
SEMGGLIKDYQNGNLKVDEFITHRRPFTEINNAFEDLHHGDCLRTVLDLSK--
>Kpol_530.31
------------------------------------------------------------
--------------------------MSTVGKPITCQAAVAYEAAKPLVVEEIVVDPPKA
HEVRIKIINTAVCHTDAYTLSGVDPEGLFPCV---LGHEGSGIVESVGDNVTTVKPGDHV
VALYTAECGKCKFCLSGKTNLCGSVRATQGKGVMPDGTPRFHNKKGEPLYHFMGCSTFSE
YTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVV
QGAKSRGASKIIVVDINNDKKEWSAEFGATDFVNPSE-LPEGQDIVSKLVEMTDGGLDFT
FDCTGNVNVMRDALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGR
SEMGGLIKDYQNGSLKVDEFITNRRPFVEINDAFEELHHGNCLRTVLSFK---
>NCAS0A14160
-----------------MRLSLPRIIPALKNGAILFRGKPLTINKSLHNHSTVVLGGKPH
IFSKAHLYCSPTFTQVKGLHQNHYNMSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKA
HEVRIKIEYTAVCHTDAYTLSGIDPEGAFPSI---LGHEGSGIVESVGEGVTNVKVGDHV
IALYTAECGKCKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQ
YTVVADVSVVAVDPKAPLDSISLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVV
QGAKSRGASKIIVVDINNDKKQWSFDFGATDFVNPKEDLKEGETIVQKLIEMTDGGLEYT
FDCTGNVKVMRDALEACHKGWGESIIIGVAGAGEEISTRPFQLVTGRVWKGSAFGGIKGR
SEMGGLIEDYQNGKLKVDEFITHRRPFTEINDAFEDLHHGDCLRTVLDLAK--
>SAKL0F11374g
------------------------------------------------------------
-------------------------MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKA
HEVRIRITYTAVCHTDAYTLSGVDPEGAFPSI---LGHEGAGVVESVGKGVTNVKPGDHV
VALYTAECQKCKFCTSGKTNLCGSVRATQGKGVMPDGTSRFRTKNGESILHFMGCSTFSQ
YTVVADVSVVAVDSQAPLDRICLLGCGVTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVV
QGAKARGASRIIVVDINDQKKQWASDFGATDFVNPSKDLKEGETIVSKLIELTDGGLDFT
FDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGR
SEMGGLVSDYMDGQLKVDEFITHRRPFTEINAAFDDLHHGDCLRTVLDLSK--
>KLTH0H01254g
------------------------------------------------------------
---------------------------MSEGKPITCTAAVAYEAGKPLTVEEIVVDPPKA
HEVRIKVEYTAVCHTDAYTLSGVDPEGAFPSI---LGHEGAGVVESVGEGVTNVKAGDHV
IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQ
YTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIFGAGTVGLSVV
QGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFT
FDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGR
SEMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGDCLRTVLDLSK--
>Kwal_56.24642
------------------------------------------------------------
---------------------------MSEGKPITCLAAVAYEAGKPLTIEEIVVDPPKA
HEVRVKIAYTAVCHTDAYTLSGVDPEGAFPSI---LGHEGAGIVESIGEGVTNVKPGDHV
IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTTRFHNKKGEDILHFMGCSTFSQ
YTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTANVQKGDTVAVFGAGTVGLSVV
QGAKVRGASRIIVVDINDQKKQWANEFGATDFVNPSKDLKDGKTIVDMLVEMTDGGLDYT
FDCTGNTDVMRSALEACHKGWGESIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGR
SEMGGLISDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGDCLRTVLDLLK--