MUSCLE (3.8) multiple sequence alignment

NCAS0F00920       ---------------MLSQEKPDSTAKGNSSDPNTSM----------VLSLKTSASNDTV
Kpol_1018.35      MNNGNPFDDKYFTQHQGKNADIDSLRNTSIIPKNSTPFNVNYNNTNNLSRSPTHVSNISG
KAFR0A01840       ------------MTRIHNDENLKS--------EKGSL--------NYLVNGPTILN--DE
SAKL0A09438g      --------------MFHPEQDADTTHDGNSMEQKRDP--------VSPFLMPSFAI-SDG
Kwal_26.8011      ----------------MPEKRPET-PD---SSESREL--------NDFFPYTQFLQNSDI
KLTH0D06798g      -----------------MQRQPAS---------------------------PSWAG----
TBLA0B06410       ----------MWPHRLRSTQRPASVSN---VAATLTL--------LRLFSAPRYKGHPAT
                                         :                                    

NCAS0F00920       ALTNQSND---------------------------------------RIRHTRKRT----
Kpol_1018.35      GLPKSGDCMPSNIYPTNNTITNRTNYNHDSTSNNINNSKIFQLVNNDSIQLPNGIS---S
KAFR0A01840       SDPLTKSSIVKPVLEKTQLPAKSFSIYQDHKTEEFDN----------HIDLPRLVT----
SAKL0A09438g      NLHVQQKDFQRP----------------------GPH----------PLFLQQQEY----
Kwal_26.8011      G---------------------------------SAL----------SQALQRSQS----
KLTH0D06798g      ----------------------------------PEH----------ILGLPRHSS----
TBLA0B06410       SIRLGCDDSHHGMLRSTARSCCPTSCVWPCGMCAPPH----------YIYVPRRRSPPIL
                                                                      .       

NCAS0F00920       -------------------------------------------LPSFNEGFSNILPERET
Kpol_1018.35      TSNLPNPNSKVSNSHQMLYQNYNNSNMHYRNNSSCGEFSSNHSIDCNGPMKPHLIRRRKT
KAFR0A01840       ------NNRSFSESTVSEKLGLGRQSLPIAGKAYESIENQQAITLSNGLHKPTLLHPVNN
SAKL0A09438g      -------HHSQQNWPAYFPSGYNIQYDHLQQQQ----QKQQKQWQQQQQKQQQQQQQQQK
Kwal_26.8011      --------------------------------------------------ISSALPPTLT
KLTH0D06798g      ------------------------------------------------------------
TBLA0B06410       PDPFRSHHTSTLHPPAVHARPLYIRPLHAARRRHCPPTDARHSAAAAHAAHSTYIPPLLP
                                                                              

NCAS0F00920       NTNVSLQKMERQAITNYIHVNPAQYPNQSVPMQQIARSKINFRNTNQMNYSTNQFPPPSN
Kpol_1018.35      IDNSHRNNIIEPGFQTGINYDSGIMDKNHLSLEDIKFQNVGEVRPNIMKQKL-PIMFPSL
KAFR0A01840       PSE----------MQAAQHLAYGAASEKYYNANGFDQTRRGNMLSLDNTGLLDNKLIRRA
SAKL0A09438g      QWQQQQQQQQQQQQQKQQKQWQQQQQKQWQQQQQQQQKQWQQQQQQQQQQQQQQQQQQQY
Kwal_26.8011      SAS---------------------------------------------------------
KLTH0D06798g      ------------------------------------------------------------
TBLA0B06410       HVSASYTHVPYTAAHVTPPVYASPLAQPLFARTEAVPARKNSIATLLNTAAEQPLFLPSL
                                                                              

NCAS0F00920       QNQNILQTTSLPLVPCIFVPNVPYMPSKHSI----ATANYYPIPQFIHSNNEIKIPPPLP
Kpol_1018.35      SGSPVMNSPFILNDNQSIERNSNYGNLLANFSNLPNHSQSFGHHGLSSTKDMSSGSHMIP
KAFR0A01840       TSFSPFLIYPSPTVYQSIDQCHVVGSHLPA-----YIANNT--TGLLNEQNLSQSNAMVG
SAKL0A09438g      QYHNPHQHQTPLPIPHSVPTARNSSSSLHV-----NNMNSFPYTESVNVIPLSNYPMMMP
Kwal_26.8011      -------------------------------------------------------PSTPL
KLTH0D06798g      ------------------------------------------------------------
TBLA0B06410       HSSSSLHSSSALHSSSSLHSSSTLHSSSSA-----SSASTSPLQPRSSLHVAAHLPTLAT
                                                                              

NCAS0F00920       QLPSQFPNQQPTIITNDIPKAPINSPSLMELPLP---------PQNKPKPKNYYNDYYER
Kpol_1018.35      NLKPSREEERSMKIND--YVSKLDIVETGERMESMVNRHNDTDCNSKISSHGDGFRNDNI
KAFR0A01840       FIENSLQQTSNSSK----YGMNGDLDCDNVAFQN---------------NQLMAGPIFQQ
SAKL0A09438g      PYNQNVPQYQHSVK----PPTSSLPAPVTQHPQEISSSHQRKEPRDGVHEHTAHLNLSLA
Kwal_26.8011      FYD---PSNRFSTG----PREIQDPPPVTSACMS--------------HPDTGTDLASAA
KLTH0D06798g      -----------------------------------------------------------A
TBLA0B06410       MFD---SQARLSTQ----PPQKVILPSISSQFLP--------------ISNGPATSAIIT
                                                                              

NCAS0F00920       YLQHIKRRRVNRRDHPQ-----PQPQSKPDP-----------------------------
Kpol_1018.35      QSNSTNNGSSQKLNKNTIGDTSEEKSESDLKGLEETVESTLSNLMQSHDYSMVMDWLTHN
KAFR0A01840       SLNIPPHYRYSSNVQPVYLTPIQSCGYANSP-----------------------------
SAKL0A09438g      PLPPPPPHLIYSADSPTMTNSCQVLPNSAHLSTDGSYSYPTSSMNNDIDTQAIPDLQAFE
Kwal_26.8011      SVTTVKPM-------PTVTVDFQHAQPAVHP-----------------------------
KLTH0D06798g      PLTSAPQR-------PS-----AVPTPAEAP-----------------------------
TBLA0B06410       PISSPPQL-------PL-----QSPAAAAPP--------PPVEFSDSFQTINIPNLPAQA
                                                                              

NCAS0F00920       ----------SPDSTALPEVQNDEPTTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLR
Kpol_1018.35      FVRTYSLHQLQQSSSSTGSTGSSGDIDQKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLH
KAFR0A01840       --------------LSYQNGIFTSNNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLL
SAKL0A09438g      NNRRYS----SPSFNSPLTSHSSSSSSSRGAHEIQYNSFGVPKNQCLKCGKVFSRSSSLQ
Kwal_26.8011      ------------------------------------------KYQCQLCLKIFSRSSALQ
KLTH0D06798g      ---------------------------------------KLLRYQCSRCLKVFTRSSALQ
TBLA0B06410       ASPNSS----PSSPASLQSKPIIRKYKSKSNKKLPKRK--VARHQCKICGKLMTRSSSLQ
                                                              :*  * * .:*:::* 

NCAS0F00920       SHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQNQ------------------
Kpol_1018.35      SHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK-----------------
KAFR0A01840       PHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQREQSDGVETAETLSPLQ
SAKL0A09438g      AHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGAKR----------------
Kwal_26.8011      AHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTH-KQPEVRR--------SST-----
KLTH0D06798g      SHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH-KQLGLRR--------GST-----
TBLA0B06410       THMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAKTTDDGTGGNK--------
                  .*   **. .*: *    * .: .****: ** . * .                      

NCAS0F00920       ---
Kpol_1018.35      ---
KAFR0A01840       REQ
SAKL0A09438g      ---
Kwal_26.8011      ---
KLTH0D06798g      ---
TBLA0B06410       ---
                     

FASTA FORMAT for MUSCLE Version 3.6

>NCAS0F00920
---------------MLSQEKPDSTAKGNSSDPNTSM----------VLSLKTSASNDTV
ALTNQSND---------------------------------------RIRHTRKRT----
-------------------------------------------LPSFNEGFSNILPERET
NTNVSLQKMERQAITNYIHVNPAQYPNQSVPMQQIARSKINFRNTNQMNYSTNQFPPPSN
QNQNILQTTSLPLVPCIFVPNVPYMPSKHSI----ATANYYPIPQFIHSNNEIKIPPPLP
QLPSQFPNQQPTIITNDIPKAPINSPSLMELPLP---------PQNKPKPKNYYNDYYER
YLQHIKRRRVNRRDHPQ-----PQPQSKPDP-----------------------------
----------SPDSTALPEVQNDEPTTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLR
SHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQNQ------------------
---
>Kpol_1018.35
MNNGNPFDDKYFTQHQGKNADIDSLRNTSIIPKNSTPFNVNYNNTNNLSRSPTHVSNISG
GLPKSGDCMPSNIYPTNNTITNRTNYNHDSTSNNINNSKIFQLVNNDSIQLPNGIS---S
TSNLPNPNSKVSNSHQMLYQNYNNSNMHYRNNSSCGEFSSNHSIDCNGPMKPHLIRRRKT
IDNSHRNNIIEPGFQTGINYDSGIMDKNHLSLEDIKFQNVGEVRPNIMKQKL-PIMFPSL
SGSPVMNSPFILNDNQSIERNSNYGNLLANFSNLPNHSQSFGHHGLSSTKDMSSGSHMIP
NLKPSREEERSMKIND--YVSKLDIVETGERMESMVNRHNDTDCNSKISSHGDGFRNDNI
QSNSTNNGSSQKLNKNTIGDTSEEKSESDLKGLEETVESTLSNLMQSHDYSMVMDWLTHN
FVRTYSLHQLQQSSSSTGSTGSSGDIDQKNMFQYPNKEKKQVSYQCPVCGKSVSRASSLH
SHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQKK-----------------
---
>KAFR0A01840
------------MTRIHNDENLKS--------EKGSL--------NYLVNGPTILN--DE
SDPLTKSSIVKPVLEKTQLPAKSFSIYQDHKTEEFDN----------HIDLPRLVT----
------NNRSFSESTVSEKLGLGRQSLPIAGKAYESIENQQAITLSNGLHKPTLLHPVNN
PSE----------MQAAQHLAYGAASEKYYNANGFDQTRRGNMLSLDNTGLLDNKLIRRA
TSFSPFLIYPSPTVYQSIDQCHVVGSHLPA-----YIANNT--TGLLNEQNLSQSNAMVG
FIENSLQQTSNSSK----YGMNGDLDCDNVAFQN---------------NQLMAGPIFQQ
SLNIPPHYRYSSNVQPVYLTPIQSCGYANSP-----------------------------
--------------LSYQNGIFTSNNGLIPADNQVWTKKVKKKNQCPICGKTVTRSSSLL
PHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKEQREQSDGVETAETLSPLQ
REQ
>SAKL0A09438g
--------------MFHPEQDADTTHDGNSMEQKRDP--------VSPFLMPSFAI-SDG
NLHVQQKDFQRP----------------------GPH----------PLFLQQQEY----
-------HHSQQNWPAYFPSGYNIQYDHLQQQQ----QKQQKQWQQQQQKQQQQQQQQQK
QWQQQQQQQQQQQQQKQQKQWQQQQQKQWQQQQQQQQKQWQQQQQQQQQQQQQQQQQQQY
QYHNPHQHQTPLPIPHSVPTARNSSSSLHV-----NNMNSFPYTESVNVIPLSNYPMMMP
PYNQNVPQYQHSVK----PPTSSLPAPVTQHPQEISSSHQRKEPRDGVHEHTAHLNLSLA
PLPPPPPHLIYSADSPTMTNSCQVLPNSAHLSTDGSYSYPTSSMNNDIDTQAIPDLQAFE
NNRRYS----SPSFNSPLTSHSSSSSSSRGAHEIQYNSFGVPKNQCLKCGKVFSRSSSLQ
AHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRGGAKR----------------
---
>Kwal_26.8011
----------------MPEKRPET-PD---SSESREL--------NDFFPYTQFLQNSDI
G---------------------------------SAL----------SQALQRSQS----
--------------------------------------------------ISSALPPTLT
SAS---------------------------------------------------------
-------------------------------------------------------PSTPL
FYD---PSNRFSTG----PREIQDPPPVTSACMS--------------HPDTGTDLASAA
SVTTVKPM-------PTVTVDFQHAQPAVHP-----------------------------
------------------------------------------KYQCQLCLKIFSRSSALQ
AHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTH-KQPEVRR--------SST-----
---
>KLTH0D06798g
-----------------MQRQPAS---------------------------PSWAG----
----------------------------------PEH----------ILGLPRHSS----
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------A
PLTSAPQR-------PS-----AVPTPAEAP-----------------------------
---------------------------------------KLLRYQCSRCLKVFTRSSALQ
SHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH-KQLGLRR--------GST-----
---
>TBLA0B06410
----------MWPHRLRSTQRPASVSN---VAATLTL--------LRLFSAPRYKGHPAT
SIRLGCDDSHHGMLRSTARSCCPTSCVWPCGMCAPPH----------YIYVPRRRSPPIL
PDPFRSHHTSTLHPPAVHARPLYIRPLHAARRRHCPPTDARHSAAAAHAAHSTYIPPLLP
HVSASYTHVPYTAAHVTPPVYASPLAQPLFARTEAVPARKNSIATLLNTAAEQPLFLPSL
HSSSSLHSSSALHSSSSLHSSSTLHSSSSA-----SSASTSPLQPRSSLHVAAHLPTLAT
MFD---SQARLSTQ----PPQKVILPSISSQFLP--------------ISNGPATSAIIT
PISSPPQL-------PL-----QSPAAAAPP--------PPVEFSDSFQTINIPNLPAQA
ASPNSS----PSSPASLQSKPIIRKYKSKSNKKLPKRK--VARHQCKICGKLMTRSSSLQ
THMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAKTTDDGTGGNK--------
---