MUSCLE (3.8) multiple sequence alignment

TPHA0J00300        --------------------------------------------MIE---------SAKM
Kpol_1045.73       ---------------------------------------MSLSDGVK---------DKVE
KNAG0M01130        ----------------------------------MDTTGLGNDPGGEIGSASAM--EKDD
TBLA0A07230        -----------------------------------------MQKTHT---------SGEE
CAGL0B03641g       -----------------------------MVVTTEAVTSRSERDAEPVQEPLVEKLATEE
Kpol_1032.6        -------------------------------------MSLDPDKG-----------NGDE
TPHA0M00240        -------------------------------------MSADPQKIED---------DTDE
KAFR0L00370        --------------------------------------MSDPTVSSDKQP------QEEE
NDAI0D00870        MVEVPSSNISLSSINSTLSATSRQNNSRRIPQEQQKQSRRDPKEGEQ---------EEEE
NCAS0H00880        -----------------------MPAPPTRDREITNVPLTTTREPPE---------EDTE
Smik_5.26          ------------------------MPVENQNSSQERTSNNISKNGNS--QIGCHTVHNEE
YEL061C            ------------------------MPAENQNTGQDRSSNSISKNGNS--QVGCHTVPNEE
Suva_5.6           ------------------------MPAENQNTIQERSSNNISNNLNA--QIGCHGVPNEE
Skud_5.28          ------------------------MPAESQNTIQERSSNSISSNGNGNNQMGCHSVPNEE
KLLA0D01045g       ---------------------------------------MSATNGSP---------EGDE
ZYRO0C07898g       -------------------------------------MGSSPAGGGE---------DAEE
TDEL0G04530        -------------------------------------MVAMPQASGE---------DVEE
ACR010C            -------------------------------MPDHEVQTRKSRMLDD---------AQEE
Ecym_3020          -------------------------------MVYNGLTTKKRTMLDD---------GNEE
SAKL0E01078g       -----------------------------------MHPLSSRELSEE---------NGQE
KLTH0C11330g       ---------------------------------------------MS---------EEEE
Kwal_56.22403      ---------------------------------------------MS---------DDEE
                                                                               

TPHA0J00300        ENITVAVRCREP--IDEEKHSGSPTIISIGDNEDGTSNEVIVLDES------TGRKKIYT
Kpol_1045.73       CNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-----IKFKGKDDA--------VKREFG
KNAG0M01130        INITVAVRCRGR--NKREIEAKSPIVVTVPDVTTTPEVSINTSGGS--GIEAQLQAKTYT
TBLA0A07230        LNITVAVRCRGR--NEREVQAKSSVVVSVPDIMGSNEVSINTSDEV--GIAAHMNSKTYT
CAGL0B03641g       LNILVAVRCRGR--NEREIKAKSSVVVDVPDNGVTNEVSINTTDDV--GIAAKMNSKTYT
Kpol_1032.6        LNIIVAVRCRGR--NEREIKAKSSVVVSVPDVAGSSEIAINTTEDV--GIAGQMNSKTYT
TPHA0M00240        MNIMVAVRCRGR--NKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLTAQLNSKTYT
KAFR0L00370        LNITVAVRCRGR--NQREIDAKSSVVVTVPDIMGSKEVAINTSEDI--GFTAQMNSKTYT
NDAI0D00870        LNITVAVRCRGR--NEREIKLKSSVIVTVPDINGSNEVSINTTDDV--GITAQMNSKTYT
NCAS0H00880        LNITVAVRCRGR--NEREINSKSPVVVTVPDITGAQEISINTTGET--GITAQMNSKTYT
Smik_5.26          LNITVAVRCRGR--NEREISMKSSVVVNVPDITGSKEISINTTGDT--GITAQMNAKRYT
YEL061C            LNITVAVRCRGR--NEREISMKSSVVVNVPDITGSKEISINTTGDT--GITAQMNAKRYT
Suva_5.6           LNITVAVRCRGR--NEREIGMKSSVVVNVPDITGSEEVSINTTGDT--GITAQMNAKRYT
Skud_5.28          LNITVAVRCRGR--NEREIGMKSSVVVNVPDITGSKEVSINTTGDT--GITAQMNAKRYT
KLLA0D01045g       LNITVAVRCRGR--NEKEIKAKSSVVVNCPDVIGANEVSINTSGDI--GITARMNSKTYT
ZYRO0C07898g       LNITVAVRSRGR--NEREIRAKSSVVVSVPDVMGSHEVAINTTDDV--GITAQMNSKTYA
TDEL0G04530        LNITVAVRCRGR--NEREIKAKSSVVVSVPDVTGSNEVSINTTGDV--GITAQINSKTYT
ACR010C            LNITVAVRCRGR--NEREIKAKSSVVVTVPDVTGSNEVSINTTDEV--GIAAKMNSRTYT
Ecym_3020          LNITVAVRCRGR--NEREIKAKSAVVVTVPDVTGSNEVSINTTGDI--GIAGKMNSRTYT
SAKL0E01078g       LNITVSVRCRGR--NEREIKAKSSVVVTVPDVTGSNEVSINTTDEL--GITAQMNSKTYT
KLTH0C11330g       LNITVAVRCRGR--NEKEVKAKSSVVVAVPDVTGTNEVSINTTGDT--GITAQINSKTYT
Kwal_56.22403      LNITVAVRCRGR--NEKEVKARSSVVVAVPDVTGTNEVSINTTGDT--GITAQINSKTYT
                    ** * .* .     .      .  ::   .        .                . : 

TPHA0J00300        LDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANN
Kpol_1045.73       MDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLL-HSE
KNAG0M01130        VDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDV-EMGAEGD
TBLA0A07230        VDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDE-KLY-DGE
CAGL0B03641g       VDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDE-KLH-NGE
Kpol_1032.6        VDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDE-RLY-NGE
TPHA0M00240        VDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDE-KLY-KGD
KAFR0L00370        VDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDE-KLY-NEE
NDAI0D00870        VDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLY-NGE
NCAS0H00880        VDKVFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDE-KLYQNGT
Smik_5.26          VDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLY-NGE
YEL061C            VDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLY-NGE
Suva_5.6           VDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLY-NGE
Skud_5.28          VDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLY-NGE
KLLA0D01045g       VDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE-KLY-DGE
ZYRO0C07898g       VDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDE-KLY-NDE
TDEL0G04530        VDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLY-DGE
ACR010C            VDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDE-KLY-DGQ
Ecym_3020          VDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLY-DGE
SAKL0E01078g       VDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDE-RLY-DGE
KLTH0C11330g       VDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-RLY-DGE
Kwal_56.22403      VDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-RLY-DGE
                   :* ::.    *  ::     *:: .*. *** : : **   :**.**: *:   :     

TPHA0J00300        AESENLGVVPRVLSRLFKDLESNG--------NDHIIKCSFVEIYNDELRDLL----IDT
Kpol_1045.73       ASRLSVGVIPRVLEELFDHLSCNN--------IDHVVKCSYVEIYNEELKDLL----VD-
KNAG0M01130        -VNGQAGIAPRILVKLFECLQ-----------DDYVVKCSFVELYNEDLRDLLSEGQDDF
TBLA0A07230        -LSDSAGIIPRVLFKLFESPEILN--------DDYIIKCSFVELYNEDLKDLL----DD-
CAGL0B03641g       -LGDAAGIIPRVLFELFDTLEANK--------DDYLVKCSFVELYNEELKDLL----DS-
Kpol_1032.6        -LSDSAGIIPRVLFKLFDAMEFQN--------DDYIIKCSFIELYNEELKDLL----DE-
TPHA0M00240        -LSDSAGIIPRVLFKLFETIEFQS--------DNYVIKCSFIELYNEELKDLL----ID-
KAFR0L00370        -LSDSAGIIPRILFKLFETLEKLN--------EDHIVKCSFVELYNEELKDLL----HG-
NDAI0D00870        -LSESAGIIPRILFKLFDTLEMNQ--------EDYVVKCSFIELYNEDLKDLL----ND-
NCAS0H00880        MLSDAAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLL----NY-
Smik_5.26          -LSDSAGIIPRVLLKLFDTLELQQ--------NDYVVKCSFIELYNEELKDLL----DN-
YEL061C            -LSDAAGIIPRVLLKLFDTLELQQ--------NDYVVKCSFIELYNEELKDLL----DS-
Suva_5.6           -LSDAAGIIPRVLLKLFDTLELQQ--------NDYVVKCSFIELYNEELKDLL----DN-
Skud_5.28          -LNDAAGIIPRVLLKLFDTLELQQ--------SDYVVKCSFIELYNEELKDLL----DN-
KLLA0D01045g       -LSEAAGIIPRVLFKLFDTLEVQE--------SDYMVKCSFIELYNEELKDLL----DD-
ZYRO0C07898g       -LSDSAGIIPRILFKLFETLDLRD--------EDYVVKCSFVELYNEELKDLL----DD-
TDEL0G04530        -LSESAGIIPRILFKLFETLELQK--------EDYVVKCSFVELYNEELKDLL----GD-
ACR010C            -LSDSAGIIPRIMFKLFDALEATD--------SDFLVKCSYIELYNEELKDLL----DE-
Ecym_3020          -LSDSAGIIPRVLFRLFDTLEATE--------SDHLVKCSYIELYNEELKDLL----DD-
SAKL0E01078g       -LSDAAGIIPRILFKLFDTLETQD--------EDYLVKCSFIELYNEELKDLL----NE-
KLTH0C11330g       -LSEGAGIIPRVLFKLFDALDAHN--------DDYMIKCSFIELYNEELKDLL----DE-
Kwal_56.22403      -LSEGAGIIPRVLFKLFDALSAQG--------DDYMIKCSFIELYNEELKDLL----DE-
                         *: **::  **.  .            :.::***::*:**::*.***       

TPHA0J00300        GNNANGNNSNGATGSTGKKLRIVDS-----------ASNGLRSA---------GSSNSST
Kpol_1045.73       QH--NSLLSAS-----IKKLRIVDS-----------GSPNVKNG---------ANSNCNT
KNAG0M01130        SNGTENSSKQPESLNASKKLRIFDS----------------------------NNSRSNS
TBLA0A07230        SV--DNT---------YKKLRIFDSMSSYSNSTATSNNNTSNNTRNNSRNNSRSNSRNTS
CAGL0B03641g       TN--TATNSD------NKKLRIFDS----------NVNGTSASG---------SSSRSSS
Kpol_1032.6        CQAINST---------AKKLRIFDSNASQIRKVSEYNKTNTSTN---------TGTNNNN
TPHA0M00240        SN--NTK---------LKKLRIFDS------------------N---------LSKSSNN
KAFR0L00370        DC--NNDNGN------FKKLRIFDS-----------------LG---------RDSRSNS
NDAI0D00870        NN--NSINNSKSN---INKLRIFDS-------STASNVNVPGSN---------ASSRANS
NCAS0H00880        DS--NDE-QQQQQQLGSRKLRIFDS--------TNNNNNNSNSN---------ASSRASS
Smik_5.26          NS--NSSSNNGFDGQFMKKLRIFDS--------STANNTTSNSA---------SSSRSSS
YEL061C            NS--NGSSNTGFDGQFMKKLRIFDS--------STANNTTSNSA---------SSSRSNS
Suva_5.6           NS--NNSSNNGFEGPFMKKLRIFDS--------NTANNTTSNSA---------SSSRSNS
Skud_5.28          NS--NGSSNNGFDGQFMKKLRIFDS--------STANNTTSNSA---------SSSRSNS
KLLA0D01045g       GQ--DSGGNN------SRKLRIYDS----------LNSSNNVTN---------VNSRSSS
ZYRO0C07898g       SV--ENSS--------MRKLRIYDS------------GSGSNSN---------SGSRKNS
TDEL0G04530        SQ--EIAS--------SRKLRIFDS-------NTMSAATNSMST---------GNSTKNS
ACR010C            SH--DSS----------KRLRIFDS---------------SSMN---------HSSRASS
Ecym_3020          TP--DYS----------KRLRIFDS----------------NTI---------TNSRAGS
SAKL0E01078g       PQ--ESGV--------IKKLRIFDS---------------NTTS---------SNSRNNS
KLTH0C11330g       TP--DSSM--------PRKLRIFDS---------------VTNP---------NSSRSSS
Kwal_56.22403      TP--DSSM--------PKKLRIFDS--------------VSNVS---------SNSRASS
                                    ..*** **                             ..   .

TPHA0J00300        RDNSPLTNSKK----IPT-AMMRKRMGKRSLP----------------------------
Kpol_1045.73       RDNSPLTSSKS----IPT-AIIRKKMGRQSLT----------------------------
KNAG0M01130        PVTNTNNPTHK-----ARSDYLKKKLKSNRKK----------------------------
TBLA0A07230        RNNSPRPSSST----NLSTIALKRRTATRPSSLSSLNPTANSSIYSNNTNNKIRFKDQPA
CAGL0B03641g       RNNSPRSAPDN-----SRAQMLRRKLGRHNTT----------------------------
Kpol_1032.6        NNNNNNNNNNT----NGRSTSPSNSSKSRPQP--------------------------IL
TPHA0M00240        NNISRQNSHFI----------SGMDLRKNPIN----------------------------
KAFR0L00370        RNNSPKMSNNN-------TTFLKKKLRNEALL------------------------RSRN
NDAI0D00870        RNNSPRLNPSTSNVGTTNNNYLRRKLKSSRYS------------------------NPEN
NCAS0H00880        RNNSPRTSSIL-----PNANATNLAMRKKSIR----------------------------
Smik_5.26          RNSSPRSLNDL----TPKAALLRRRLRTKSLP----------------------------
YEL061C            RNSSPRSLNDL----TPKAALLRKRLRTKSLP----------------------------
Suva_5.6           RNSSPRSLNDL----TPKAALLRKRLRTKSLP----------------------------
Skud_5.28          RNSSPRSLNDL----TPKAALLRKRLRTKSLP----------------------------
KLLA0D01045g       RSNSPTVNLEA-----------KRRIRAGALY----------------------------
ZYRO0C07898g       RNNSPKLVTDP--------MINRRRMRTVPLS----------------------------
TDEL0G04530        RNNSPRSSSEL-----PTATFLRKRWKTAPSV----------------------------
ACR010C            QSNSPREPEVA------HNGFSRRRQRPPPVK----------------------------
Ecym_3020          QNNSPKEQDGT------SSSMAKRRYTHIPTK----------------------------
SAKL0E01078g       RNNSPNLVGTS---------GTFKRIFKTPVP----------------------------
KLTH0C11330g       RNSSPKPPEGS-------TSGTKRRIRPNTMY----------------------------
Kwal_56.22403      RNNSPKPNEGS-------SFGTRRKTRAPSIH----------------------------
                      .                                                        

TPHA0J00300        ---------------------PNNSISNNTANNNRLSLSRTNSFSDYSLQSSH--ERLNS
Kpol_1045.73       ---------------------------ALKQANTLSISRSNSFNEYSPQRHIQ--EKTGA
KNAG0M01130        -----------------------------------SLDDMSLNANAGGKTHVP--PTQTG
TBLA0A07230        NQLRLQSKLQAQQNIELQQIHSQNIQQQQSQSITSNLQSQENKEQLTNSEKAP--DNNNQ
CAGL0B03641g       ---GNSKISNNNHNKFSRFKQTSQESTRAHASNNHQNVHIPNNNSNNTNQQQSPIDQSAS
Kpol_1032.6        GNNRIRSRLSSSNNAFLKPSSSNLNTSNDTIASSSSSSSSSTSSAYTSSTVSP--DKQTG
TPHA0M00240        -----------------------------------------PINNSNDNTAIQ--NGNAS
KAFR0L00370        IASSKRSSMQTIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQS--DQTAG
NDAI0D00870        SNIFTSNASSSVKNMTKNSFLSNSKNQTSNLNTNSNTRTNPPKLPTSSLETPPQDDNNNG
NCAS0H00880        -----------------------YNYNSNNKAKSSNNTRPNTNDEPSSIAGPD--ENTNG
Smik_5.26          ----NTIKQQQQHQQQQTMNSRNNSSSNSGSATNNISSDTNNNNGQRNSLAPN--DQSNG
YEL061C            ------NTIKQQYQQQQAVNSRNNSSSNSGSTTNNASSNTNTNNGQRSSMAPN--DQTNG
Suva_5.6           -------NTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPN--DQSNG
Skud_5.28          -------NTIKQQQQQQAMNSRNNSSSNSGSAANNSSSN---TNGQRSPMTQN--DQSNG
KLLA0D01045g       ----------------KPKPKLPTQSQSNGQQQQQQQQQQQQQQQQQTQGQVN--EQSSA
ZYRO0C07898g       ---------SSLAKQQHQWQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQ--DSPSG
TDEL0G04530        ---------------------------------------------TQSHQNSQ--DQNAG
ACR010C            -----------------------------------------ANRMSATKQQLS--ESGSG
Ecym_3020          -----------------------------------------PKRPSLNKQLLY--EQSSA
SAKL0E01078g       -----------------------YKQQQQHQQHLQQQQQQQPRLINNKQQSLS--EQSSA
KLTH0C11330g       ---------------------------------------KPSRSPTVKPTLSS--ELNSA
Kwal_56.22403      ---------------------------------------RPTKSPVSKPVSPC--EPSSA
                                                                               

TPHA0J00300        IYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEV
Kpol_1045.73       PYIQNLEEFHITNAKEGIQLLHRGLKNRQIASS----KNQKYSSRASTIFTIVLYKEEE-
KNAG0M01130        IYIQNLKDFHISTAKEGLQLLQRGLQRRQVATT----KLNDVSSRSHTIFTITLYKKFK-
TBLA0A07230        IYIQNLQEFYINNATDGIKLLQKGLRHRKVAST----KMNDVSSRSHTIFTITLYKEHN-
CAGL0B03641g       IYIQNLEEFHITSAMEGLQLLQKGLKQRQVAST----KMNDFSSRSHSIFTITLYKEQN-
Kpol_1032.6        IYIQNLKEFHITSAKEGIELLQRGLQYRQVAST----KMNDFSSRSHTIFTINLYKEHD-
TPHA0M00240        IYIQNLEEFHIKNAREGIQLLQKGLKYRQVAST----KMNDVSSRSHTIFTINLYKEHK-
KAFR0L00370        IYIQNLQEFHITTAKEGIKLLQKGLKYRQVAST----KMNDFSSRSHTIFTITLFKEVK-
NDAI0D00870        IYIQNLQEFHISNAKEGLALLQKGLKYRQVAST----KMNDFSSRSHTIFTITLYKEHQ-
NCAS0H00880        IYIQNLQEFHITNAKEGLSLLQKGLKHRQVAST----KMNDFSSRSHTIFTITLYKEHK-
Smik_5.26          IYIQNLQEFHITNAMEGLKLLQKGLKHRQVAST----KMNDFSSRSHTIFTITLYKKHQ-
YEL061C            IYIQNLQEFHITNAMEGLNLLQKGLKHRQVAST----KMNDFSSRSHTIFTITLYKKHQ-
Suva_5.6           IYIQNLQEFHITNAMEGLNLLQRGLKHRQVAST----KMNDFSSRSHTIFTITLYKKHQ-
Skud_5.28          IYIQNLQEFHITNALEGLNLLQRGLKHRQVAST----KMNDFSSRSHTIFTITLYKKHQ-
KLLA0D01045g       IYIQHLQEFHITDAKEGLRLLQKGLSHRQVAST----KMNDVSSRSHTIFTLTLYKNFN-
ZYRO0C07898g       VYIQNLQDFHITSARDGLQLLQKGLRNRQVATT----KMNDFSSRSHTIFTITLYREHQ-
TDEL0G04530        IYIQNLQDFHITNAKEGIKLLQKGLKHRQVATT----KMNDFSSRSHTIFTITLYKEYN-
ACR010C            IYVQNVQEFHIINAREGINVLQKGLKHRQVAST----KMNDFSSRSHTIFTIMLYKNCD-
Ecym_3020          IYIQNLQEFHITNAREGISVLQKGLKHRQVAST----KMNDFSSRSHTIFTIMLYKSYE-
SAKL0E01078g       IYIQNLQEFHITNAKDGINLLQRGLKHRQVAST----KMNDFSSRSHTIFTIMLYKNHN-
KLTH0C11330g       IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVAST----KMNDVSSRSHTIFTIMLYRKCN-
Kwal_56.22403      IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVAST----KMNDVSSRSHTIFTIMLYKKCN-
                    ::*::::: *    :*: :::.**  *.:*::    . :. *.*: :**.: *:.. . 

TPHA0J00300        NEVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASFL
Kpol_1045.73       GEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNLNKIVNSLHEKESVIPFK
KNAG0M01130        DDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPFR
TBLA0A07230        GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR
CAGL0B03641g       GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR
Kpol_1032.6        GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR
TPHA0M00240        GEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFR
KAFR0L00370        GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFR
NDAI0D00870        GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFR
NCAS0H00880        DNLFRLSKMNLVDLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHVPFR
Smik_5.26          DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR
YEL061C            DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR
Suva_5.6           DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFR
Skud_5.28          DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR
KLLA0D01045g       GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR
ZYRO0C07898g       GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR
TDEL0G04530        GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFR
ACR010C            GELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR
Ecym_3020          GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR
SAKL0E01078g       GEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR
KLTH0C11330g       GESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR
Kwal_56.22403      GESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFR
                   .  :.:** .:*::**:*   .  . :      . :*..: .:..::*.: :..   .* 

TPHA0J00300        DSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKE
Kpol_1045.73       DSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKE
KNAG0M01130        ESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKD
TBLA0A07230        ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD
CAGL0B03641g       ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD
Kpol_1032.6        ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD
TPHA0M00240        ESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKD
KAFR0L00370        ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD
NDAI0D00870        ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKD
NCAS0H00880        ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVILKD
Smik_5.26          ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD
YEL061C            ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKD
Suva_5.6           ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD
Skud_5.28          ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD
KLLA0D01045g       ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKD
ZYRO0C07898g       ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD
TDEL0G04530        ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKD
ACR010C            ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKD
Ecym_3020          ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKD
SAKL0E01078g       ESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMKD
KLTH0C11330g       ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKD
Kwal_56.22403      ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKD
                   :**** *:::.: * :.: :* .:   *   :   ..*  . * ..:*  *   . : *:

TPHA0J00300        SLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTK
Kpol_1045.73       TLIKSISNELAKVKSDLLSTKSKE-GVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNE
KNAG0M01130        ILLKDVSQELIKMRADLWCTKSKE-GIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQ
TBLA0A07230        VLLKNITTELNKIKSDLMSTRLKD-GVYMSQQHYKELNNDLESYKTEVQESKRANERLIS
CAGL0B03641g       ILVRSITSELAKIKSDLLSTKSKE-GVYMSHEHYKDLHYDIECYKTELEESKRAIESLTA
Kpol_1032.6        ILVKNIASELAKVKADLLSTKSRD-GVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTT
TPHA0M00240        VRLKDLNNELAKIKRDLTSTKQKD-GVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLEL
KAFR0L00370        ILLKNITTELTKIKSDLLSTKSKD-GIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTS
NDAI0D00870        ILLKNITTELSQVKSDLLSTKSKE-GIYMSQEHYQKLMNELDNHKTEADESKRIIERLSS
NCAS0H00880        ILLKNITSELAKVKSDLMSTKSKD-GIYMSHEHYQELIMELESSKTEVQESKRMIEKLSS
Smik_5.26          ILVKNITMELAKIKSDLLSTKSKE-GIYMNQDHYKNLNSDLESYKNEVQECKREIESLTS
YEL061C            ILVKNITMELAKIKSDLLSTKSKE-GIYMSQDHYKNLNSDLESYKNEVQECKREIESLTS
Suva_5.6           ILVKNITMELAKIKSDLLSTKSKE-GIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSS
Skud_5.28          ILVKNITMELAKIKSDLLSTKSKE-GIYMSQDHYKNLNSDLESHKNEVQECKREIESLAS
KLLA0D01045g       ILVKNISHELAKLKSDFLSTKSKE-GIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSS
ZYRO0C07898g       ILVKNITAELAKVKSDLLSTKLRE-GVYMSQDNYKEITNDLESYKTEIQESKRIIERLSS
TDEL0G04530        ILVKNITGELAKIKADLLSTKSKE-GIYMSQDNYKELTNDLESYKTEVKECKRAIETLTS
ACR010C            ILVKNISSELAKIKSDFLSTKSKD-GIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTS
Ecym_3020          ILVKSISSELSKLKSDFLSTKAKE-GIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSS
SAKL0E01078g       ILVKNITRELAKIKSDFLSTKSKD-GIYMTQDHYKELTSDLENYKTEVQECKREIEKMNS
KLTH0C11330g       VLVKNVTAELVKIRSDLLATKSKD-GIYMSQENYKELTNELENYKTEVQECKRAIERLST
Kwal_56.22403      VLLKSVTAELVKIKSDLLSTKSKD-GIYMSQENYKELTNELENYKTEVEECKRAMEKVSA
                     :. :  ** : . *: . . .: *:*:   :*. :   ::  : :  :  .  . .  

TPHA0J00300        KGNEIRIEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGN
Kpol_1045.73       QSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNN
KNAG0M01130        ENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTE
TBLA0A07230        QNGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVGTS
CAGL0B03641g       QNAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEE
Kpol_1032.6        QNGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIE
TPHA0M00240        QNALLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLK
KAFR0L00370        QNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSK
NDAI0D00870        QNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDT
NCAS0H00880        QNSMLLKDKRSANEVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSREK
Smik_5.26          KNSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEV
YEL061C            KNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEV
Suva_5.6           KNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEI
Skud_5.28          KNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEV
KLLA0D01045g       QNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRN
ZYRO0C07898g       QNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSL
TDEL0G04530        QNTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGT
ACR010C            QNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHT
Ecym_3020          QNSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHT
SAKL0E01078g       QNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYT
KLTH0C11330g       QNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRT
Kwal_56.22403      QNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHT
                   :.  :  :.    :       ::      :  :          :  :             

TPHA0J00300        MQKSVEKYSDKEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPD---------DND-
Kpol_1045.73       MNVTIARYTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQFEKNELI---------DNL-
KNAG0M01130        LKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVNSG----------NY-
TBLA0A07230        MQSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIISNNSSI
CAGL0B03641g       MKKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDL---------KDT-
Kpol_1032.6        MQATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVI---------NNT-
TPHA0M00240        MKTVIKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLI---------VQT-
KAFR0L00370        LTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGIN---------QNF-
NDAI0D00870        FKKMIENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSG---------TDF-
NCAS0H00880        LNSLVKNYQTKQSQLKTQISNILNENLFELKKILNSHKDAIRQSE-----------GNF-
Smik_5.26          MQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNIL---------QET-
YEL061C            MQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESIL---------QET-
Suva_5.6           MQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNIS---------QET-
Skud_5.28          MQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIF---------QET-
KLLA0D01045g       MQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALE---------QSF-
ZYRO0C07898g       TQSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSG---------NDIL
TDEL0G04530        MQSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDW---------ENI-
ACR010C            MQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLD---------KNL-
Ecym_3020          MKGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLD---------KNL-
SAKL0E01078g       VQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSS---------RHL-
KLTH0C11330g       MQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTEED----------GF-
Kwal_56.22403      MQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVDE---------NGD-
                       :                     .      :      .                   

TPHA0J00300        ------NMNTNIDNIKAEILKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLE
Kpol_1045.73       ------EIENNLNKAHEEIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLE
KNAG0M01130        ------QIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIR
TBLA0A07230        EAIDSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSID
CAGL0B03641g       ------EISGNLMRLEKEVVKVIKAAEEEASKSYGECVKMMLKETPRLFESVSGRLDNIS
Kpol_1032.6        ------DLGMNIEKIKDEVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQ
TPHA0M00240        ------NVKDNIKLIKDDVISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQ
KAFR0L00370        ------TVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLK
NDAI0D00870        ------DIGSNLDMIQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDIN
NCAS0H00880        ------DVEMNLKVIKDEITSMLEKTQHKTEMMYKEFIEEFLEQTPINLQKIFEHVTQVE
Smik_5.26          ------DIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIG
YEL061C            ------NIQPNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIR
Suva_5.6           ------NIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIR
Skud_5.28          ------DIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIR
KLLA0D01045g       ------TIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMF
ZYRO0C07898g       HEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVE
TDEL0G04530        ------GVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVE
ACR010C            ------SIKENINNITTIFDDTLKSVEANGSDMCDTLVKLIKETPSMYLKEFNETVSSLK
Ecym_3020          ------SINHNMDEIRTIFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLD
SAKL0E01078g       ------GIDGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDIS
KLTH0C11330g       ------DVDANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESIT
Kwal_56.22403      ------DVEVNVDAVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESIT
                          .   :                            .    .         :    

TPHA0J00300        ESVEINHNKYSELLSDISEEFNNLNNYINDNFL---KSSHEELIDTYINRTYHEVQGISV
Kpol_1045.73       NSTSENYNNLAELLSDVSEEFNNLKQYINEKFF---KNNHEELLKTYVNKTYHQVQKSSD
KNAG0M01130        GMTEEHYTEMARNFSDLSEEFNTFKQYLDGQFF---QNNHIEMIQTHQDIVASNMQKMSD
TBLA0A07230        FQYNDQFNKITENLSDLSEEYNNFKEYLNNSFL---QNNYELILKNHLESGQSQIESFSN
CAGL0B03641g       KLAEENHSKIAETLSDVSEEYNNLKQYLTNNFF---KNNHEELLSHHVQNTYAQLEENSA
Kpol_1032.6        KISDLYNEQLSISISELNIEHNDLKQYLNGSFF---KSDHEEILNEHIEKTYDNIRRAST
TPHA0M00240        ELNETYFANLFENLESIKQQYSKLNEYFSNDFF---KSNHVTIVNDHVNTTKAIIEKSVS
KAFR0L00370        ALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSN
NDAI0D00870        IKIQNHHAAVAQNLSDISEEYNNLKQYLNENLF---QNNHEDLINAHINSTSQTLTNSAD
NCAS0H00880        FMVTGYYNEITENLSDISEEYNNLKQYLDNDFF---QNNHEDLLNIHINATSDILAQSSA
Smik_5.26          VDFERFYKNIAENLSDISEENNNLKQYFTNHFF---RNNHQELLSHHVDSTYEKIEKKTN
YEL061C            VDFQKFYKNIAENLSDISEENNNMKQYLKNHFF---KNNHQELLNRHVDSTYENIEKRTN
Suva_5.6           VDFQRFYNNIAENLSDISEENNNLKQYLKNHFF---KNNHQELLNHHIDSTYEDIEKKTS
Skud_5.28          IEFQNFYKNIAENLSDISEENNNLKQYLKNHFF---KNNHQELLNHHIDSTYENIEKKTN
KLLA0D01045g       SKVDEHTDRLKEGLSQITAENNNLKAYLDTHFF---RNNHQEILNVHADKTYHQLNLSSK
ZYRO0C07898g       VTVNTYHQRLTENLSDISEGYNNLKQYFNDHFF---KNNHEEVLNSHIDKTYQQLQFSAD
TDEL0G04530        KLIATCHRDLTENLSDVSEEFNNLRQYLNDHFF---KNNHEEILVSHIDRTYHHIQTSAD
ACR010C            SELSSYSNALTNKLTEISEENNHLREYLDQHLF---KNSTQEVLDLRMESVYQKVKNDSD
Ecym_3020          TKVQTYSVTLTNKLTEMTEENNNMKEYLDEHFL---KNNNQEMLDLRMEKAYHKSKTASD
SAKL0E01078g       TVVDSYSNELVKNLGDISEEYNNFREYLNEHLF---KNNHEETLSIHVDKTYHMLKKSAG
KLTH0C11330g       HVVGSYSSDLMMHLSSISEEYNHLKDYLNEHFF---KNNFQDALDVHVDRTYHQLKVSAN
Kwal_56.22403      SVVSSYSSNLMIHLSSISEEYNNLKDYLNEHFF---KNNFQEALDVHVDRTYHQLKVSAN
                                : .:.   . :. ::   :    ..     :    :           

TPHA0J00300        EFTENFKKLLDIYVEKNTKSLSKSITSLTSEIVENELTQFNPEKKKWELASNEIIENFNE
Kpol_1045.73       DFLLKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWE-KSIELIEKSKH
KNAG0M01130        DLLQSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWE-ESIDLINQSDS
TBLA0A07230        NLLLNINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWV-KSIEIINSTDK
CAGL0B03641g       QLMQNFTMMLDKHIQENKRHMLENILGVTDEVINNELQMFGEQRAKWE-KSSALINQCDS
Kpol_1032.6        GIVEQLKTGLELYLEESRNIIIDSLKNTTSDIVKSEMELFAPKKKKWE-DSFEMINKCDS
TPHA0M00240        DIFKQFQQNMEAFAEQNEKLILENLKTVSSDLIQNEMNSFKEHKSEWD-ISFKKINHCDY
KAFR0L00370        DVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWE-ESAELINRSDA
NDAI0D00870        VLFNTFKDMMNKHLESNRNLMLNSFKAATDEVINKEMELFIPRKKKWE-ESIDLINQCDS
NCAS0H00880        ELFNKFKIMMDAHLMENKKLMIDNFRTATNDVITKEMELFKPKRNKWE-ESIELINRCDS
Smik_5.26          QFVENFKKALNDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWE-HSFDLINECDS
YEL061C            EFVENFKKVLNDHLDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWE-NSFDLINDCDS
Suva_5.6           EFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWE-NSFDLINKCDS
Skud_5.28          QFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWE-NSFDLINKCDS
KLLA0D01045g       HLMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWE-QSFNHINVCDS
ZYRO0C07898g       GLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWE-ESFDLINNCDS
TDEL0G04530        DLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQKKKWE-DSFKYINKCDS
ACR010C            QLLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWI-ASCDNINQCDA
Ecym_3020          ALISSVVSMMESHMEESRNLMLSSMKDAVSEMIDKELEMFQPVKERWV-LSFENINECDA
SAKL0E01078g       ELFSKFKEMMDSHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWE-SSLENINKCDS
KLTH0C11330g       SIFLKLREMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWE-SSLENINECDK
Kwal_56.22403      SIFLKLREMLNEELDTNKEFMMQSLRHAASEVVAKEMCLLDPVKQAWE-NSLENINECDK
                    .   .   :      .     ..:       : .*   :      *   *   *:  . 

TPHA0J00300        SITKNKNKNSEILAKLLSESTSTSELFINNMSSIK-KNVEIVE------EFSEIFNSNDL
Kpol_1045.73       SSNEFKTKNRVIVGKLQDTLKGTSESLFDTLSEMK-SKINELQ------KAANIIENNEV
KNAG0M01130        LSNKFRNNMTKSVDDIASVIRNSNESMDRSISTIKKHIIENDI------NSQEQINSNEL
TBLA0A07230        INNTFHNDMNNRILQINNLILQSHNDINNSINDIKVNEIRENE------AVNEILSSNTE
CAGL0B03641g       VNHSFHQALGSNLVEIRDVVSSSRDNIGATISSIQ-SRTRNRQ------SIEEMIQGNDV
Kpol_1032.6        LNNKYFGDISALLSNMKTSVTSTSDLVDDHVSQMR-KYTDNTS------RSTKLTENSKR
TPHA0M00240        LNNSYHDQMHTYLRNMKGKLQSSDEIIKKHMNQIK-SNVDSLN------STPKLLNTDRA
KAFR0L00370        LNNEFNDNVESSMTTMTDKIKQTNDSINNNIKKIN-EHFKTNDIAH---SNNLMIDDNNI
NDAI0D00870        LNNGFQKEVTDGLSYTRSKITASINQMYDNSTRLK-TEMSADNGGYNSINTKNVVEDNQI
NCAS0H00880        INNGFHHNMTGQVSKIKTNLASSSSSIHNAIASIKSQVLEQLSNDDS--DVKTALENDPM
Smik_5.26          MNNEFYNSMATTLSQIKSTVDTSSNSMNKSISVMK-GQVEESE------NAISLLKNNIK
YEL061C            MNNEFYNSMAATLSQIKSTVDTSSNSMNESISVMK-GQVEESE------NAISLLKNNTK
Suva_5.6           MNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMK-GQVEESE------NAVSLLKNNKK
Skud_5.28          MNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMK-GQVEESE------NAISLLKNNTK
KLLA0D01045g       LSNKFKDDTTESLNSLKSHMESTVRESSLIADKIK-DNLCHFQ------DRNDIANMTTN
ZYRO0C07898g       ISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVK-DEVKGYE------DASTILDGNEV
TDEL0G04530        INFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVK-EQMDEHE------SPASMLSNSRV
ACR010C            SHQNFEAKSTSGLDKLKELSDASLKSSEDAVNKAK-HRTDSFH------DFVQKLCCDQS
Ecym_3020          AHQQFENKSTKLLTNLKELADNSVVAADDVAKQVQ-ENVTNFE------GIVRQASAKES
SAKL0E01078g       LNNTFDSTVKDALRRLEGNIEGSLEFSKNTAGDVK-DSLKKFD------GISEVLKNNTK
KLTH0C11330g       LNSGFEKDIGSVVRDVFEKINEGLQFSESAVGDAN-LDLSRFQ------DASRALRTDDV
Kwal_56.22403      LNNVFENKIGVTVNEIFKTIDQGQKTSQVTTEDAK-SELTRVR------AAFSSLQNNGI
                               :                     .                         

TPHA0J00300        IKSEFLEIINK-NKKLKDLITDNFNSSENSIDSFDNLKEAMQNVFKNEMKESY--S----
Kpol_1045.73       VTEEFISIMKK-NGILKDTLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNI--T----
KNAG0M01130        LTNSFKAIQEKSNNILHLVTGDLTVTAQESMDGIQNLDRSIRTLIH--------------
TBLA0A07230        YVNNINELKIK-NMDYQEKLKCIGKSSENSINYLDSTKQVIESGLKTRQIAKHYKAFIDH
CAGL0B03641g       IRQQITRIKQK-NKSLSLFKEHSTETATTSIGSVNKVEGNLKVIMDKVLNDPQLSR----
Kpol_1032.6        IGQQFTEMMEK-NSKLESHLNESITMNESSINAFDKLSESIHSAFEKYNTANT--I----
TPHA0M00240        IGDNYNQIISK-RDKLHDHLQISLNSTQNSLLVFDEICKSIQFAFANYSKTNL--Q----
KAFR0L00370        IKNNFKSIEEK-NSRLHEFVKEGYLVTNESMKKLNELDTSIRTVLKDIDYE---------
NDAI0D00870        IRTQFNELARK-NSIFQDNVENSLKCAVASVNNLNHLEDSIKMAVRDTRIKGG--P----
NCAS0H00880        FNKHFNEIIEK-NMILQKNRKNAINYTDKSLLNIDELSETVKIALNNI-------V----
Smik_5.26          FNDQFKQLINK-HTILKDNIESSITSTNSHITNIDDIYNTIEKIMNNYGNKEN--A----
YEL061C            FNDQFEQLINK-HNMLKDNIKNSITSTHSHITNVDDIYNTIENIMKNYGNKEN--A----
Suva_5.6           FNDQFKQLVNK-HTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKEN--A----
Skud_5.28          FNDQFKQLISK-HIILKDNIESSITSTHSHITNVDDIYNTIEDIMTNHGNKEN--A----
KLLA0D01045g       INGTVDDIKNK-HSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMPE----G----
ZYRO0C07898g       VKRQIADIINK-DSSLRNGLYKSIKSSQGHISAFDELKERIRNTIAS-------------
TDEL0G04530        FSEQFSGILNK-QSLLHESLKKSVIITSDHADAVDKLKEAIDHVVSERGSSME--G----
ACR010C            LKKQMHDISDK-HRMLEDHFDDNVKYFKESSKGFEDMDCSIKKIIHEMSPE----V----
Ecym_3020          IVKQMNDINDK-HKMLEDHFENNIKYFKESSKGFEEMDCSIKKIIREMSPE----V----
SAKL0E01078g       VVNNINEVKEK-HTFLRDQVERTSSYIEAANEKFEGIDQFIRQIIDKKLPTHL--V----
KLTH0C11330g       IPGSIEEIKKK-HNMLKLKVQDSASYMEAATQKFGEIDDSIQGLLNSQAVSQ---P----
Kwal_56.22403      ILQNVDSIKKK-HNLLKSQVQDSANYMQAATQKFGEIDNSIQDLLNAQTIPQ---P----
                          :  *                      .      :   .               

TPHA0J00300        -------------NDTLNLKEIFEQMEQQKL-----GVNSSSKKKAYKQNLSPSKISPIK
Kpol_1045.73       -------------GYQSILKEIFDQLDQQRL-----TPNMRNRKSPVRQSVSPS-----R
KNAG0M01130        -------------GDQYIHSTKGVHIPPQNR-----GPELHSTLIPLKPS----------
TBLA0A07230        QDNVDEDTFLSTKSHTLQFNSLMKQIESSVL----FPTLNRKIITPSNNNKYPLMDLANH
CAGL0B03641g       -------------GKAEVPDEELHRLEKIPL-----GITNKENVVDLQ------------
Kpol_1032.6        -------------SRLDESTNLMKQNKDGDI------SLDRVEMLPLSPIFF--------
TPHA0M00240        -------------ESALLKGRLFADIDPLND-----TNLNKQESLTFDKGDAKL------
KAFR0L00370        -----------------------KDIKETNS--------------PLKPSH---------
NDAI0D00870        -------------TEGEVGVPFKKENGKEGPTKPGLQPLQPTNEIFLNSQQDQQHTTNGH
NCAS0H00880        -------------DDVAITDGDDNSPGTKTK----------SKLRPLRSASQLLINSNQN
Smik_5.26          -------------TKDEMIENLLNEIPNLSK------------RMPLR------------
YEL061C            -------------TKDEMIENILKEIPNLSK------------KMPLR------------
Suva_5.6           -------------VKNEMIDNILKEIPSLSK------------RVPLR------------
Skud_5.28          -------------TKDEMIDNILKEIPNLSK------------RLPLR------------
KLLA0D01045g       -------------KTETLADDLIKHIDSSSV-----APVASSGKTPLRPLLKSE------
ZYRO0C07898g       -------------ENSTLHQNKIATTPPLGQ---------NSERSPLKPTVLQ-------
TDEL0G04530        -------------ERVEHVDGILRRMDEQNL--------LYLDRSPLRPANFKMNKSERN
ACR010C            -------------GDIKSVETLMERINARTF-----SPVRPTGKTPSRQVLKNA------
Ecym_3020          -------------GDIKQIEALLERVNSRSF-----GPIASTGKTPMRPELKNP------
SAKL0E01078g       -------------GNGELVNVMLEQLGKTHL-----KPIGSASRTP--------------
KLTH0C11330g       -------------HSENRIEGLLEQLNGKPL-----KPLGPSGKTPMRITQGCIASSDQL
Kwal_56.22403      -------------QSENPIDGLLEQLNDKSL-----KPLGPSGKTPMRTVQRSVTNTDQL
                                                                               

TPHA0J00300        SSTKLNSPLKVEI------------QSLSE--IDMKRPIKRKLNLNLDLSENLN---SSK
Kpol_1045.73       TSPQIQSLMNSDL------------LQFNEARSFAVKHSLDKAHDEDKIDEGSS---KKR
KNAG0M01130        -------------------------SSNLNRLSDSTKSSPRKRSQGSED--ETH---ASK
TBLA0A07230        GKENKENDISPPFFSKYNIPNKSLSLSPTQLTKGIVNQNKRSLTIQDRDDYNHPFDTSKK
CAGL0B03641g       ----HRYPALQEK------------RKPEDEVLLQAKLQRR----------NPD------
Kpol_1032.6        -SENKNNHVLSPS------------KVVVNSSAKKIQASKYQKRLNSTEDMDPI---ATK
TPHA0M00240        TKENNEDMSSKDE------------NKLNNQNVTLIGLKRSHMDLNDSD--SPL---KSR
KAFR0L00370        -------------------------KHDYNHTIPLDNDKKRSFLNNANDNEMQN---QSK
NDAI0D00870        GNYINKDNDNINH------------KSNNSGNVTIIKHSKKRQLEKIDE--KNV---SNK
NCAS0H00880        KENGVRGIDVTES------------KLGNSNSQILKIRSKRKQLDENDG--NLA---SKK
Smik_5.26          -ISNTNSNSMQNI------------ISPKKHAIEDENSSN-----GNPD--SES---SRK
YEL061C            -LSNINSNSVQSV------------ISPKKHAIEDENKSS-----ENVD--NEG---SRK
Suva_5.6           -LSNTNGNSAQNI------------LSPKKHAIDDENPSN-----EITD--GEE---SRK
Skud_5.28          -ISNINGCSVQDI------------ISPKKHTIEDENPSS-----ENAD--SEG---SRK
KLLA0D01045g       TKQRSLSKSVSPA------------KSSHATIIN--SPLKRKS-SDSRI--FPG---NSK
ZYRO0C07898g       -PNQLPENWRYGL------------RSPPKDQLSKSNGELKRHQDNETL--EEN---VNK
TDEL0G04530        SPNRSSPCKSVS-------------HSPCKQPVCHPRINYKRSLTDLNDGQEEG---LNK
ACR010C            ITSKASSRSMSPI------------KTLDTN-VRIISPVKRGT-IEFGA--EGP---PTK
Ecym_3020          -IPKTRSRSMSPI------------KSLDTNVVHVVPLIKRGT-MDIEV--DGP---AMK
SAKL0E01078g       -----SSRSVSPM------------KTLDNNIFNGISPSKRKV-DETEN--DRS---KSQ
KLTH0C11330g       SLPRKRSYSISPI------------REIDGN-RKASSPFKRKITIDHEN--VPF---SSQ
Kwal_56.22403      LPPQKSSYTISPI------------KEIDGN-RRLTSPHKRGVVSDHER--PAF---KSQ
                                                                               

TPHA0J00300        MIHKE----
Kpol_1045.73       VHRA-----
KNAG0M01130        IPKLTQ---
TBLA0A07230        RPRIE----
CAGL0B03641g       ---------
Kpol_1032.6        VQKIK----
TPHA0M00240        --RIE----
KAFR0L00370        IPRLE----
NDAI0D00870        --KITSNKG
NCAS0H00880        ISRLNR---
Smik_5.26          ILKTE----
YEL061C            MLKIE----
Suva_5.6           IQKTE----
Skud_5.28          IPKTE----
KLLA0D01045g       --KQR----
ZYRO0C07898g       ISRLE----
TDEL0G04530        LSRHRCG--
ACR010C            --KVR----
Ecym_3020          --KIK----
SAKL0E01078g       --RIK----
KLTH0C11330g       --KIE----
Kwal_56.22403      --RIE----
                            

FASTA FORMAT for MUSCLE Version 3.6

>TPHA0J00300
--------------------------------------------MIE---------SAKM
ENITVAVRCREP--IDEEKHSGSPTIISIGDNEDGTSNEVIVLDES------TGRKKIYT
LDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANN
AESENLGVVPRVLSRLFKDLESNG--------NDHIIKCSFVEIYNDELRDLL----IDT
GNNANGNNSNGATGSTGKKLRIVDS-----------ASNGLRSA---------GSSNSST
RDNSPLTNSKK----IPT-AMMRKRMGKRSLP----------------------------
---------------------PNNSISNNTANNNRLSLSRTNSFSDYSLQSSH--ERLNS
IYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEV
NEVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASFL
DSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKE
SLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTK
KGNEIRIEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGN
MQKSVEKYSDKEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPD---------DND-
------NMNTNIDNIKAEILKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLE
ESVEINHNKYSELLSDISEEFNNLNNYINDNFL---KSSHEELIDTYINRTYHEVQGISV
EFTENFKKLLDIYVEKNTKSLSKSITSLTSEIVENELTQFNPEKKKWELASNEIIENFNE
SITKNKNKNSEILAKLLSESTSTSELFINNMSSIK-KNVEIVE------EFSEIFNSNDL
IKSEFLEIINK-NKKLKDLITDNFNSSENSIDSFDNLKEAMQNVFKNEMKESY--S----
-------------NDTLNLKEIFEQMEQQKL-----GVNSSSKKKAYKQNLSPSKISPIK
SSTKLNSPLKVEI------------QSLSE--IDMKRPIKRKLNLNLDLSENLN---SSK
MIHKE----
>Kpol_1045.73
---------------------------------------MSLSDGVK---------DKVE
CNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-----IKFKGKDDA--------VKREFG
MDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLL-HSE
ASRLSVGVIPRVLEELFDHLSCNN--------IDHVVKCSYVEIYNEELKDLL----VD-
QH--NSLLSAS-----IKKLRIVDS-----------GSPNVKNG---------ANSNCNT
RDNSPLTSSKS----IPT-AIIRKKMGRQSLT----------------------------
---------------------------ALKQANTLSISRSNSFNEYSPQRHIQ--EKTGA
PYIQNLEEFHITNAKEGIQLLHRGLKNRQIASS----KNQKYSSRASTIFTIVLYKEEE-
GEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNLNKIVNSLHEKESVIPFK
DSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKE
TLIKSISNELAKVKSDLLSTKSKE-GVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNE
QSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNN
MNVTIARYTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQFEKNELI---------DNL-
------EIENNLNKAHEEIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSRLE
NSTSENYNNLAELLSDVSEEFNNLKQYINEKFF---KNNHEELLKTYVNKTYHQVQKSSD
DFLLKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWE-KSIELIEKSKH
SSNEFKTKNRVIVGKLQDTLKGTSESLFDTLSEMK-SKINELQ------KAANIIENNEV
VTEEFISIMKK-NGILKDTLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNI--T----
-------------GYQSILKEIFDQLDQQRL-----TPNMRNRKSPVRQSVSPS-----R
TSPQIQSLMNSDL------------LQFNEARSFAVKHSLDKAHDEDKIDEGSS---KKR
VHRA-----
>KNAG0M01130
----------------------------------MDTTGLGNDPGGEIGSASAM--EKDD
INITVAVRCRGR--NKREIEAKSPIVVTVPDVTTTPEVSINTSGGS--GIEAQLQAKTYT
VDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDV-EMGAEGD
-VNGQAGIAPRILVKLFECLQ-----------DDYVVKCSFVELYNEDLRDLLSEGQDDF
SNGTENSSKQPESLNASKKLRIFDS----------------------------NNSRSNS
PVTNTNNPTHK-----ARSDYLKKKLKSNRKK----------------------------
-----------------------------------SLDDMSLNANAGGKTHVP--PTQTG
IYIQNLKDFHISTAKEGLQLLQRGLQRRQVATT----KLNDVSSRSHTIFTITLYKKFK-
DDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPFR
ESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKD
ILLKDVSQELIKMRADLWCTKSKE-GIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQ
ENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTE
LKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVNSG----------NY-
------QIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIR
GMTEEHYTEMARNFSDLSEEFNTFKQYLDGQFF---QNNHIEMIQTHQDIVASNMQKMSD
DLLQSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWE-ESIDLINQSDS
LSNKFRNNMTKSVDDIASVIRNSNESMDRSISTIKKHIIENDI------NSQEQINSNEL
LTNSFKAIQEKSNNILHLVTGDLTVTAQESMDGIQNLDRSIRTLIH--------------
-------------GDQYIHSTKGVHIPPQNR-----GPELHSTLIPLKPS----------
-------------------------SSNLNRLSDSTKSSPRKRSQGSED--ETH---ASK
IPKLTQ---
>TBLA0A07230
-----------------------------------------MQKTHT---------SGEE
LNITVAVRCRGR--NEREVQAKSSVVVSVPDIMGSNEVSINTSDEV--GIAAHMNSKTYT
VDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDE-KLY-DGE
-LSDSAGIIPRVLFKLFESPEILN--------DDYIIKCSFVELYNEDLKDLL----DD-
SV--DNT---------YKKLRIFDSMSSYSNSTATSNNNTSNNTRNNSRNNSRSNSRNTS
RNNSPRPSSST----NLSTIALKRRTATRPSSLSSLNPTANSSIYSNNTNNKIRFKDQPA
NQLRLQSKLQAQQNIELQQIHSQNIQQQQSQSITSNLQSQENKEQLTNSEKAP--DNNNQ
IYIQNLQEFYINNATDGIKLLQKGLRHRKVAST----KMNDVSSRSHTIFTITLYKEHN-
GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR
ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD
VLLKNITTELNKIKSDLMSTRLKD-GVYMSQQHYKELNNDLESYKTEVQESKRANERLIS
QNGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVGTS
MQSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIISNNSSI
EAIDSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSID
FQYNDQFNKITENLSDLSEEYNNFKEYLNNSFL---QNNYELILKNHLESGQSQIESFSN
NLLLNINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWV-KSIEIINSTDK
INNTFHNDMNNRILQINNLILQSHNDINNSINDIKVNEIRENE------AVNEILSSNTE
YVNNINELKIK-NMDYQEKLKCIGKSSENSINYLDSTKQVIESGLKTRQIAKHYKAFIDH
QDNVDEDTFLSTKSHTLQFNSLMKQIESSVL----FPTLNRKIITPSNNNKYPLMDLANH
GKENKENDISPPFFSKYNIPNKSLSLSPTQLTKGIVNQNKRSLTIQDRDDYNHPFDTSKK
RPRIE----
>CAGL0B03641g
-----------------------------MVVTTEAVTSRSERDAEPVQEPLVEKLATEE
LNILVAVRCRGR--NEREIKAKSSVVVDVPDNGVTNEVSINTTDDV--GIAAKMNSKTYT
VDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDE-KLH-NGE
-LGDAAGIIPRVLFELFDTLEANK--------DDYLVKCSFVELYNEELKDLL----DS-
TN--TATNSD------NKKLRIFDS----------NVNGTSASG---------SSSRSSS
RNNSPRSAPDN-----SRAQMLRRKLGRHNTT----------------------------
---GNSKISNNNHNKFSRFKQTSQESTRAHASNNHQNVHIPNNNSNNTNQQQSPIDQSAS
IYIQNLEEFHITSAMEGLQLLQKGLKQRQVAST----KMNDFSSRSHSIFTITLYKEQN-
GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR
ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD
ILVRSITSELAKIKSDLLSTKSKE-GVYMSHEHYKDLHYDIECYKTELEESKRAIESLTA
QNAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEE
MKKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDL---------KDT-
------EISGNLMRLEKEVVKVIKAAEEEASKSYGECVKMMLKETPRLFESVSGRLDNIS
KLAEENHSKIAETLSDVSEEYNNLKQYLTNNFF---KNNHEELLSHHVQNTYAQLEENSA
QLMQNFTMMLDKHIQENKRHMLENILGVTDEVINNELQMFGEQRAKWE-KSSALINQCDS
VNHSFHQALGSNLVEIRDVVSSSRDNIGATISSIQ-SRTRNRQ------SIEEMIQGNDV
IRQQITRIKQK-NKSLSLFKEHSTETATTSIGSVNKVEGNLKVIMDKVLNDPQLSR----
-------------GKAEVPDEELHRLEKIPL-----GITNKENVVDLQ------------
----HRYPALQEK------------RKPEDEVLLQAKLQRR----------NPD------
---------
>Kpol_1032.6
-------------------------------------MSLDPDKG-----------NGDE
LNIIVAVRCRGR--NEREIKAKSSVVVSVPDVAGSSEIAINTTEDV--GIAGQMNSKTYT
VDKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDE-RLY-NGE
-LSDSAGIIPRVLFKLFDAMEFQN--------DDYIIKCSFIELYNEELKDLL----DE-
CQAINST---------AKKLRIFDSNASQIRKVSEYNKTNTSTN---------TGTNNNN
NNNNNNNNNNT----NGRSTSPSNSSKSRPQP--------------------------IL
GNNRIRSRLSSSNNAFLKPSSSNLNTSNDTIASSSSSSSSSTSSAYTSSTVSP--DKQTG
IYIQNLKEFHITSAKEGIELLQRGLQYRQVAST----KMNDFSSRSHTIFTINLYKEHD-
GKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFR
ESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKD
ILVKNIASELAKVKADLLSTKSRD-GVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTT
QNGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIE
MQATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVI---------NNT-
------DLGMNIEKIKDEVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQ
KISDLYNEQLSISISELNIEHNDLKQYLNGSFF---KSDHEEILNEHIEKTYDNIRRAST
GIVEQLKTGLELYLEESRNIIIDSLKNTTSDIVKSEMELFAPKKKKWE-DSFEMINKCDS
LNNKYFGDISALLSNMKTSVTSTSDLVDDHVSQMR-KYTDNTS------RSTKLTENSKR
IGQQFTEMMEK-NSKLESHLNESITMNESSINAFDKLSESIHSAFEKYNTANT--I----
-------------SRLDESTNLMKQNKDGDI------SLDRVEMLPLSPIFF--------
-SENKNNHVLSPS------------KVVVNSSAKKIQASKYQKRLNSTEDMDPI---ATK
VQKIK----
>TPHA0M00240
-------------------------------------MSADPQKIED---------DTDE
MNIMVAVRCRGR--NKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLTAQLNSKTYT
VDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDE-KLY-KGD
-LSDSAGIIPRVLFKLFETIEFQS--------DNYVIKCSFIELYNEELKDLL----ID-
SN--NTK---------LKKLRIFDS------------------N---------LSKSSNN
NNISRQNSHFI----------SGMDLRKNPIN----------------------------
-----------------------------------------PINNSNDNTAIQ--NGNAS
IYIQNLEEFHIKNAREGIQLLQKGLKYRQVAST----KMNDVSSRSHTIFTINLYKEHK-
GEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFR
ESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKD
VRLKDLNNELAKIKRDLTSTKQKD-GVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLEL
QNALLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLK
MKTVIKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLI---------VQT-
------NVKDNIKLIKDDVISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQ
ELNETYFANLFENLESIKQQYSKLNEYFSNDFF---KSNHVTIVNDHVNTTKAIIEKSVS
DIFKQFQQNMEAFAEQNEKLILENLKTVSSDLIQNEMNSFKEHKSEWD-ISFKKINHCDY
LNNSYHDQMHTYLRNMKGKLQSSDEIIKKHMNQIK-SNVDSLN------STPKLLNTDRA
IGDNYNQIISK-RDKLHDHLQISLNSTQNSLLVFDEICKSIQFAFANYSKTNL--Q----
-------------ESALLKGRLFADIDPLND-----TNLNKQESLTFDKGDAKL------
TKENNEDMSSKDE------------NKLNNQNVTLIGLKRSHMDLNDSD--SPL---KSR
--RIE----
>KAFR0L00370
--------------------------------------MSDPTVSSDKQP------QEEE
LNITVAVRCRGR--NQREIDAKSSVVVTVPDIMGSKEVAINTSEDI--GFTAQMNSKTYT
VDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDE-KLY-NEE
-LSDSAGIIPRILFKLFETLEKLN--------EDHIVKCSFVELYNEELKDLL----HG-
DC--NNDNGN------FKKLRIFDS-----------------LG---------RDSRSNS
RNNSPKMSNNN-------TTFLKKKLRNEALL------------------------RSRN
IASSKRSSMQTIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQS--DQTAG
IYIQNLQEFHITTAKEGIKLLQKGLKYRQVAST----KMNDFSSRSHTIFTITLFKEVK-
GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFR
ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD
ILLKNITTELTKIKSDLLSTKSKD-GIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTS
QNALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSK
LTKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGIN---------QNF-
------TVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLK
ALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSN
DVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWE-ESAELINRSDA
LNNEFNDNVESSMTTMTDKIKQTNDSINNNIKKIN-EHFKTNDIAH---SNNLMIDDNNI
IKNNFKSIEEK-NSRLHEFVKEGYLVTNESMKKLNELDTSIRTVLKDIDYE---------
-----------------------KDIKETNS--------------PLKPSH---------
-------------------------KHDYNHTIPLDNDKKRSFLNNANDNEMQN---QSK
IPRLE----
>NDAI0D00870
MVEVPSSNISLSSINSTLSATSRQNNSRRIPQEQQKQSRRDPKEGEQ---------EEEE
LNITVAVRCRGR--NEREIKLKSSVIVTVPDINGSNEVSINTTDDV--GITAQMNSKTYT
VDKVFGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLY-NGE
-LSESAGIIPRILFKLFDTLEMNQ--------EDYVVKCSFIELYNEDLKDLL----ND-
NN--NSINNSKSN---INKLRIFDS-------STASNVNVPGSN---------ASSRANS
RNNSPRLNPSTSNVGTTNNNYLRRKLKSSRYS------------------------NPEN
SNIFTSNASSSVKNMTKNSFLSNSKNQTSNLNTNSNTRTNPPKLPTSSLETPPQDDNNNG
IYIQNLQEFHISNAKEGLALLQKGLKYRQVAST----KMNDFSSRSHTIFTITLYKEHQ-
GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFR
ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKD
ILLKNITTELSQVKSDLLSTKSKE-GIYMSQEHYQKLMNELDNHKTEADESKRIIERLSS
QNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDT
FKKMIENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSG---------TDF-
------DIGSNLDMIQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDIN
IKIQNHHAAVAQNLSDISEEYNNLKQYLNENLF---QNNHEDLINAHINSTSQTLTNSAD
VLFNTFKDMMNKHLESNRNLMLNSFKAATDEVINKEMELFIPRKKKWE-ESIDLINQCDS
LNNGFQKEVTDGLSYTRSKITASINQMYDNSTRLK-TEMSADNGGYNSINTKNVVEDNQI
IRTQFNELARK-NSIFQDNVENSLKCAVASVNNLNHLEDSIKMAVRDTRIKGG--P----
-------------TEGEVGVPFKKENGKEGPTKPGLQPLQPTNEIFLNSQQDQQHTTNGH
GNYINKDNDNINH------------KSNNSGNVTIIKHSKKRQLEKIDE--KNV---SNK
--KITSNKG
>NCAS0H00880
-----------------------MPAPPTRDREITNVPLTTTREPPE---------EDTE
LNITVAVRCRGR--NEREINSKSPVVVTVPDITGAQEISINTTGET--GITAQMNSKTYT
VDKVFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDE-KLYQNGT
MLSDAAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLL----NY-
DS--NDE-QQQQQQLGSRKLRIFDS--------TNNNNNNSNSN---------ASSRASS
RNNSPRTSSIL-----PNANATNLAMRKKSIR----------------------------
-----------------------YNYNSNNKAKSSNNTRPNTNDEPSSIAGPD--ENTNG
IYIQNLQEFHITNAKEGLSLLQKGLKHRQVAST----KMNDFSSRSHTIFTITLYKEHK-
DNLFRLSKMNLVDLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHVPFR
ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVILKD
ILLKNITSELAKVKSDLMSTKSKD-GIYMSHEHYQELIMELESSKTEVQESKRMIEKLSS
QNSMLLKDKRSANEVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSREK
LNSLVKNYQTKQSQLKTQISNILNENLFELKKILNSHKDAIRQSE-----------GNF-
------DVEMNLKVIKDEITSMLEKTQHKTEMMYKEFIEEFLEQTPINLQKIFEHVTQVE
FMVTGYYNEITENLSDISEEYNNLKQYLDNDFF---QNNHEDLLNIHINATSDILAQSSA
ELFNKFKIMMDAHLMENKKLMIDNFRTATNDVITKEMELFKPKRNKWE-ESIELINRCDS
INNGFHHNMTGQVSKIKTNLASSSSSIHNAIASIKSQVLEQLSNDDS--DVKTALENDPM
FNKHFNEIIEK-NMILQKNRKNAINYTDKSLLNIDELSETVKIALNNI-------V----
-------------DDVAITDGDDNSPGTKTK----------SKLRPLRSASQLLINSNQN
KENGVRGIDVTES------------KLGNSNSQILKIRSKRKQLDENDG--NLA---SKK
ISRLNR---
>Smik_5.26
------------------------MPVENQNSSQERTSNNISKNGNS--QIGCHTVHNEE
LNITVAVRCRGR--NEREISMKSSVVVNVPDITGSKEISINTTGDT--GITAQMNAKRYT
VDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLY-NGE
-LSDSAGIIPRVLLKLFDTLELQQ--------NDYVVKCSFIELYNEELKDLL----DN-
NS--NSSSNNGFDGQFMKKLRIFDS--------STANNTTSNSA---------SSSRSSS
RNSSPRSLNDL----TPKAALLRRRLRTKSLP----------------------------
----NTIKQQQQHQQQQTMNSRNNSSSNSGSATNNISSDTNNNNGQRNSLAPN--DQSNG
IYIQNLQEFHITNAMEGLKLLQKGLKHRQVAST----KMNDFSSRSHTIFTITLYKKHQ-
DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR
ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD
ILVKNITMELAKIKSDLLSTKSKE-GIYMNQDHYKNLNSDLESYKNEVQECKREIESLTS
KNSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEV
MQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNIL---------QET-
------DIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIG
VDFERFYKNIAENLSDISEENNNLKQYFTNHFF---RNNHQELLSHHVDSTYEKIEKKTN
QFVENFKKALNDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWE-HSFDLINECDS
MNNEFYNSMATTLSQIKSTVDTSSNSMNKSISVMK-GQVEESE------NAISLLKNNIK
FNDQFKQLINK-HTILKDNIESSITSTNSHITNIDDIYNTIEKIMNNYGNKEN--A----
-------------TKDEMIENLLNEIPNLSK------------RMPLR------------
-ISNTNSNSMQNI------------ISPKKHAIEDENSSN-----GNPD--SES---SRK
ILKTE----
>YEL061C
------------------------MPAENQNTGQDRSSNSISKNGNS--QVGCHTVPNEE
LNITVAVRCRGR--NEREISMKSSVVVNVPDITGSKEISINTTGDT--GITAQMNAKRYT
VDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLY-NGE
-LSDAAGIIPRVLLKLFDTLELQQ--------NDYVVKCSFIELYNEELKDLL----DS-
NS--NGSSNTGFDGQFMKKLRIFDS--------STANNTTSNSA---------SSSRSNS
RNSSPRSLNDL----TPKAALLRKRLRTKSLP----------------------------
------NTIKQQYQQQQAVNSRNNSSSNSGSTTNNASSNTNTNNGQRSSMAPN--DQTNG
IYIQNLQEFHITNAMEGLNLLQKGLKHRQVAST----KMNDFSSRSHTIFTITLYKKHQ-
DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR
ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKD
ILVKNITMELAKIKSDLLSTKSKE-GIYMSQDHYKNLNSDLESYKNEVQECKREIESLTS
KNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEV
MQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESIL---------QET-
------NIQPNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIR
VDFQKFYKNIAENLSDISEENNNMKQYLKNHFF---KNNHQELLNRHVDSTYENIEKRTN
EFVENFKKVLNDHLDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWE-NSFDLINDCDS
MNNEFYNSMAATLSQIKSTVDTSSNSMNESISVMK-GQVEESE------NAISLLKNNTK
FNDQFEQLINK-HNMLKDNIKNSITSTHSHITNVDDIYNTIENIMKNYGNKEN--A----
-------------TKDEMIENILKEIPNLSK------------KMPLR------------
-LSNINSNSVQSV------------ISPKKHAIEDENKSS-----ENVD--NEG---SRK
MLKIE----
>Suva_5.6
------------------------MPAENQNTIQERSSNNISNNLNA--QIGCHGVPNEE
LNITVAVRCRGR--NEREIGMKSSVVVNVPDITGSEEVSINTTGDT--GITAQMNAKRYT
VDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLY-NGE
-LSDAAGIIPRVLLKLFDTLELQQ--------NDYVVKCSFIELYNEELKDLL----DN-
NS--NNSSNNGFEGPFMKKLRIFDS--------NTANNTTSNSA---------SSSRSNS
RNSSPRSLNDL----TPKAALLRKRLRTKSLP----------------------------
-------NTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNNSQRSSMAPN--DQSNG
IYIQNLQEFHITNAMEGLNLLQRGLKHRQVAST----KMNDFSSRSHTIFTITLYKKHQ-
DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFR
ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKD
ILVKNITMELAKIKSDLLSTKSKE-GIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSS
KNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEI
MQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNIS---------QET-
------NIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIR
VDFQRFYNNIAENLSDISEENNNLKQYLKNHFF---KNNHQELLNHHIDSTYEDIEKKTS
EFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWE-NSFDLINKCDS
MNNEFYNNMATTLSQIKNTVDTSSNSMNKSISVMK-GQVEESE------NAVSLLKNNKK
FNDQFKQLVNK-HTILKDNIENSITSTHSHITNIDDIYDTIENIMKNYGNKEN--A----
-------------VKNEMIDNILKEIPSLSK------------RVPLR------------
-LSNTNGNSAQNI------------LSPKKHAIDDENPSN-----EITD--GEE---SRK
IQKTE----
>Skud_5.28
------------------------MPAESQNTIQERSSNSISSNGNGNNQMGCHSVPNEE
LNITVAVRCRGR--NEREIGMKSSVVVNVPDITGSKEVSINTTGDT--GITAQMNAKRYT
VDKVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLY-NGE
-LNDAAGIIPRVLLKLFDTLELQQ--------SDYVVKCSFIELYNEELKDLL----DN-
NS--NGSSNNGFDGQFMKKLRIFDS--------STANNTTSNSA---------SSSRSNS
RNSSPRSLNDL----TPKAALLRKRLRTKSLP----------------------------
-------NTIKQQQQQQAMNSRNNSSSNSGSAANNSSSN---TNGQRSPMTQN--DQSNG
IYIQNLQEFHITNALEGLNLLQRGLKHRQVAST----KMNDFSSRSHTIFTITLYKKHQ-
DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR
ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD
ILVKNITMELAKIKSDLLSTKSKE-GIYMSQDHYKNLNSDLESHKNEVQECKREIESLAS
KNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEV
MQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIF---------QET-
------DIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIR
IEFQNFYKNIAENLSDISEENNNLKQYLKNHFF---KNNHQELLNHHIDSTYENIEKKTN
QFVENFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWE-NSFDLINKCDS
MNNEFYNNMAATLSQIKKTVDTSSNSMNESISVMK-GQVEESE------NAISLLKNNTK
FNDQFKQLISK-HIILKDNIESSITSTHSHITNVDDIYNTIEDIMTNHGNKEN--A----
-------------TKDEMIDNILKEIPNLSK------------RLPLR------------
-ISNINGCSVQDI------------ISPKKHTIEDENPSS-----ENAD--SEG---SRK
IPKTE----
>KLLA0D01045g
---------------------------------------MSATNGSP---------EGDE
LNITVAVRCRGR--NEKEIKAKSSVVVNCPDVIGANEVSINTSGDI--GITARMNSKTYT
VDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDE-KLY-DGE
-LSEAAGIIPRVLFKLFDTLEVQE--------SDYMVKCSFIELYNEELKDLL----DD-
GQ--DSGGNN------SRKLRIYDS----------LNSSNNVTN---------VNSRSSS
RSNSPTVNLEA-----------KRRIRAGALY----------------------------
----------------KPKPKLPTQSQSNGQQQQQQQQQQQQQQQQQTQGQVN--EQSSA
IYIQHLQEFHITDAKEGLRLLQKGLSHRQVAST----KMNDVSSRSHTIFTLTLYKNFN-
GETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR
ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKD
ILVKNISHELAKLKSDFLSTKSKE-GIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSS
QNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRN
MQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALE---------QSF-
------TIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMF
SKVDEHTDRLKEGLSQITAENNNLKAYLDTHFF---RNNHQEILNVHADKTYHQLNLSSK
HLMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWE-QSFNHINVCDS
LSNKFKDDTTESLNSLKSHMESTVRESSLIADKIK-DNLCHFQ------DRNDIANMTTN
INGTVDDIKNK-HSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMPE----G----
-------------KTETLADDLIKHIDSSSV-----APVASSGKTPLRPLLKSE------
TKQRSLSKSVSPA------------KSSHATIIN--SPLKRKS-SDSRI--FPG---NSK
--KQR----
>ZYRO0C07898g
-------------------------------------MGSSPAGGGE---------DAEE
LNITVAVRSRGR--NEREIRAKSSVVVSVPDVMGSHEVAINTTDDV--GITAQMNSKTYA
VDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDE-KLY-NDE
-LSDSAGIIPRILFKLFETLDLRD--------EDYVVKCSFVELYNEELKDLL----DD-
SV--ENSS--------MRKLRIYDS------------GSGSNSN---------SGSRKNS
RNNSPKLVTDP--------MINRRRMRTVPLS----------------------------
---------SSLAKQQHQWQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQ--DSPSG
VYIQNLQDFHITSARDGLQLLQKGLRNRQVATT----KMNDFSSRSHTIFTITLYREHQ-
GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR
ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD
ILVKNITAELAKVKSDLLSTKLRE-GVYMSQDNYKEITNDLESYKTEIQESKRIIERLSS
QNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSL
TQSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSG---------NDIL
HEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVE
VTVNTYHQRLTENLSDISEGYNNLKQYFNDHFF---KNNHEEVLNSHIDKTYQQLQFSAD
GLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWE-ESFDLINNCDS
ISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVK-DEVKGYE------DASTILDGNEV
VKRQIADIINK-DSSLRNGLYKSIKSSQGHISAFDELKERIRNTIAS-------------
-------------ENSTLHQNKIATTPPLGQ---------NSERSPLKPTVLQ-------
-PNQLPENWRYGL------------RSPPKDQLSKSNGELKRHQDNETL--EEN---VNK
ISRLE----
>TDEL0G04530
-------------------------------------MVAMPQASGE---------DVEE
LNITVAVRCRGR--NEREIKAKSSVVVSVPDVTGSNEVSINTTGDV--GITAQINSKTYT
VDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLY-DGE
-LSESAGIIPRILFKLFETLELQK--------EDYVVKCSFVELYNEELKDLL----GD-
SQ--EIAS--------SRKLRIFDS-------NTMSAATNSMST---------GNSTKNS
RNNSPRSSSEL-----PTATFLRKRWKTAPSV----------------------------
---------------------------------------------TQSHQNSQ--DQNAG
IYIQNLQDFHITNAKEGIKLLQKGLKHRQVATT----KMNDFSSRSHTIFTITLYKEYN-
GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFR
ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKD
ILVKNITGELAKIKADLLSTKSKE-GIYMSQDNYKELTNDLESYKTEVKECKRAIETLTS
QNTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGT
MQSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDW---------ENI-
------GVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVE
KLIATCHRDLTENLSDVSEEFNNLRQYLNDHFF---KNNHEEILVSHIDRTYHHIQTSAD
DLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQKKKWE-DSFKYINKCDS
INFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVK-EQMDEHE------SPASMLSNSRV
FSEQFSGILNK-QSLLHESLKKSVIITSDHADAVDKLKEAIDHVVSERGSSME--G----
-------------ERVEHVDGILRRMDEQNL--------LYLDRSPLRPANFKMNKSERN
SPNRSSPCKSVS-------------HSPCKQPVCHPRINYKRSLTDLNDGQEEG---LNK
LSRHRCG--
>ACR010C
-------------------------------MPDHEVQTRKSRMLDD---------AQEE
LNITVAVRCRGR--NEREIKAKSSVVVTVPDVTGSNEVSINTTDEV--GIAAKMNSRTYT
VDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDE-KLY-DGQ
-LSDSAGIIPRIMFKLFDALEATD--------SDFLVKCSYIELYNEELKDLL----DE-
SH--DSS----------KRLRIFDS---------------SSMN---------HSSRASS
QSNSPREPEVA------HNGFSRRRQRPPPVK----------------------------
-----------------------------------------ANRMSATKQQLS--ESGSG
IYVQNVQEFHIINAREGINVLQKGLKHRQVAST----KMNDFSSRSHTIFTIMLYKNCD-
GELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR
ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKD
ILVKNISSELAKIKSDFLSTKSKD-GIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTS
QNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHT
MQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLD---------KNL-
------SIKENINNITTIFDDTLKSVEANGSDMCDTLVKLIKETPSMYLKEFNETVSSLK
SELSSYSNALTNKLTEISEENNHLREYLDQHLF---KNSTQEVLDLRMESVYQKVKNDSD
QLLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWI-ASCDNINQCDA
SHQNFEAKSTSGLDKLKELSDASLKSSEDAVNKAK-HRTDSFH------DFVQKLCCDQS
LKKQMHDISDK-HRMLEDHFDDNVKYFKESSKGFEDMDCSIKKIIHEMSPE----V----
-------------GDIKSVETLMERINARTF-----SPVRPTGKTPSRQVLKNA------
ITSKASSRSMSPI------------KTLDTN-VRIISPVKRGT-IEFGA--EGP---PTK
--KVR----
>Ecym_3020
-------------------------------MVYNGLTTKKRTMLDD---------GNEE
LNITVAVRCRGR--NEREIKAKSAVVVTVPDVTGSNEVSINTTGDI--GIAGKMNSRTYT
VDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLY-DGE
-LSDSAGIIPRVLFRLFDTLEATE--------SDHLVKCSYIELYNEELKDLL----DD-
TP--DYS----------KRLRIFDS----------------NTI---------TNSRAGS
QNNSPKEQDGT------SSSMAKRRYTHIPTK----------------------------
-----------------------------------------PKRPSLNKQLLY--EQSSA
IYIQNLQEFHITNAREGISVLQKGLKHRQVAST----KMNDFSSRSHTIFTIMLYKSYE-
GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR
ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKD
ILVKSISSELSKLKSDFLSTKAKE-GIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSS
QNSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHT
MKGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLD---------KNL-
------SINHNMDEIRTIFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLD
TKVQTYSVTLTNKLTEMTEENNNMKEYLDEHFL---KNNNQEMLDLRMEKAYHKSKTASD
ALISSVVSMMESHMEESRNLMLSSMKDAVSEMIDKELEMFQPVKERWV-LSFENINECDA
AHQQFENKSTKLLTNLKELADNSVVAADDVAKQVQ-ENVTNFE------GIVRQASAKES
IVKQMNDINDK-HKMLEDHFENNIKYFKESSKGFEEMDCSIKKIIREMSPE----V----
-------------GDIKQIEALLERVNSRSF-----GPIASTGKTPMRPELKNP------
-IPKTRSRSMSPI------------KSLDTNVVHVVPLIKRGT-MDIEV--DGP---AMK
--KIK----
>SAKL0E01078g
-----------------------------------MHPLSSRELSEE---------NGQE
LNITVSVRCRGR--NEREIKAKSSVVVTVPDVTGSNEVSINTTDEL--GITAQMNSKTYT
VDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDE-RLY-DGE
-LSDAAGIIPRILFKLFDTLETQD--------EDYLVKCSFIELYNEELKDLL----NE-
PQ--ESGV--------IKKLRIFDS---------------NTTS---------SNSRNNS
RNNSPNLVGTS---------GTFKRIFKTPVP----------------------------
-----------------------YKQQQQHQQHLQQQQQQQPRLINNKQQSLS--EQSSA
IYIQNLQEFHITNAKDGINLLQRGLKHRQVAST----KMNDFSSRSHTIFTIMLYKNHN-
GEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR
ESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMKD
ILVKNITRELAKIKSDFLSTKSKD-GIYMTQDHYKELTSDLENYKTEVQECKREIEKMNS
QNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYT
VQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSS---------RHL-
------GIDGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDIS
TVVDSYSNELVKNLGDISEEYNNFREYLNEHLF---KNNHEETLSIHVDKTYHMLKKSAG
ELFSKFKEMMDSHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWE-SSLENINKCDS
LNNTFDSTVKDALRRLEGNIEGSLEFSKNTAGDVK-DSLKKFD------GISEVLKNNTK
VVNNINEVKEK-HTFLRDQVERTSSYIEAANEKFEGIDQFIRQIIDKKLPTHL--V----
-------------GNGELVNVMLEQLGKTHL-----KPIGSASRTP--------------
-----SSRSVSPM------------KTLDNNIFNGISPSKRKV-DETEN--DRS---KSQ
--RIK----
>KLTH0C11330g
---------------------------------------------MS---------EEEE
LNITVAVRCRGR--NEKEVKAKSSVVVAVPDVTGTNEVSINTTGDT--GITAQINSKTYT
VDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-RLY-DGE
-LSEGAGIIPRVLFKLFDALDAHN--------DDYMIKCSFIELYNEELKDLL----DE-
TP--DSSM--------PRKLRIFDS---------------VTNP---------NSSRSSS
RNSSPKPPEGS-------TSGTKRRIRPNTMY----------------------------
---------------------------------------KPSRSPTVKPTLSS--ELNSA
IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVAST----KMNDVSSRSHTIFTIMLYRKCN-
GESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFR
ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKD
VLVKNVTAELVKIRSDLLATKSKD-GIYMSQENYKELTNELENYKTEVQECKRAIERLST
QNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRT
MQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTEED----------GF-
------DVDANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESIT
HVVGSYSSDLMMHLSSISEEYNHLKDYLNEHFF---KNNFQDALDVHVDRTYHQLKVSAN
SIFLKLREMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWE-SSLENINECDK
LNSGFEKDIGSVVRDVFEKINEGLQFSESAVGDAN-LDLSRFQ------DASRALRTDDV
IPGSIEEIKKK-HNMLKLKVQDSASYMEAATQKFGEIDDSIQGLLNSQAVSQ---P----
-------------HSENRIEGLLEQLNGKPL-----KPLGPSGKTPMRITQGCIASSDQL
SLPRKRSYSISPI------------REIDGN-RKASSPFKRKITIDHEN--VPF---SSQ
--KIE----
>Kwal_56.22403
---------------------------------------------MS---------DDEE
LNITVAVRCRGR--NEKEVKARSSVVVAVPDVTGTNEVSINTTGDT--GITAQINSKTYT
VDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-RLY-DGE
-LSEGAGIIPRVLFKLFDALSAQG--------DDYMIKCSFIELYNEELKDLL----DE-
TP--DSSM--------PKKLRIFDS--------------VSNVS---------SNSRASS
RNNSPKPNEGS-------SFGTRRKTRAPSIH----------------------------
---------------------------------------RPTKSPVSKPVSPC--EPSSA
IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVAST----KMNDVSSRSHTIFTIMLYKKCN-
GESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFR
ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKD
VLLKSVTAELVKIKSDLLSTKSKD-GIYMSQENYKELTNELENYKTEVEECKRAMEKVSA
QNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHT
MQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVDE---------NGD-
------DVEVNVDAVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESIT
SVVSSYSSNLMIHLSSISEEYNNLKDYLNEHFF---KNNFQEALDVHVDRTYHQLKVSAN
SIFLKLREMLNEELDTNKEFMMQSLRHAASEVVAKEMCLLDPVKQAWE-NSLENINECDK
LNNVFENKIGVTVNEIFKTIDQGQKTSQVTTEDAK-SELTRVR------AAFSSLQNNGI
ILQNVDSIKKK-HNLLKSQVQDSANYMQAATQKFGEIDNSIQDLLNAQTIPQ---P----
-------------QSENPIDGLLEQLNDKSL-----KPLGPSGKTPMRTVQRSVTNTDQL
LPPQKSSYTISPI------------KEIDGN-RRLTSPHKRGVVSDHER--PAF---KSQ
--RIE----