MUSCLE (3.8) multiple sequence alignment

TPHA0D04550        ---------------------MKIKWTCNCCKERNHYNGNDAQQYGIDFSRLNLCRKCHK
NCAS0A14070        -------------------------MNCPCSRDPQ-------------VPHVTNCKVCHN
KLLA0C16687g       --------------------MAQFRYRSGCGLESN-------------FLDLNLCTKCHL
KLTH0H01474g       ---------------------MIAQWLCSCSTEPN------------SIYKLNICAKCHR
Kwal_56.24604      ---------------------MRVKWLCNCSTDPI------------SLYDLNLCRKCHR
SAKL0F10978g       ---------------------MRVLVLCDCSSKCK------------SLSQLNLCQACYR
ACL159W            ---------------------MEVRYQCVCQQLVK-------------WSDLNSCKECHS
Ecym_4519          MKYSNKSRYFSLSIHNMDDPDMEVRYQCICKNLVK-------------WSDLNICRECYS
                                              . *                     :. *  *: 

TPHA0D04550        ISCDSCQLFQDYEKFCPYCCRNNKVPDCADGSRLSFEERYCQEICYDEYCTNGCFQCPKC
NCAS0A14070        TTCPDCELFQPLQRECPQC---QTITMHMDE---------------DTRCKNDCFQCPNC
KLLA0C16687g       ISCQQCQDFEVVGKYCSQC---GKDASKNDA----------------VYCHKNCFQCPCC
KLTH0H01474g       VSCNWCQKPELLIKYCPGC---FRVAESEGQ----------------LRCVHNCLECPRC
Kwal_56.24604      VSCRWCQKPELLIKFCPGC---SKGAETKNQ----------------MSCNKNCFECPRC
SAKL0F10978g       VSCTQCQLFEPVLKYCPLC---MEVPSRADQ----------------THCTKNCFQCPRC
ACL159W            ISCFRCQEFEPVLKYCPKC---LEEPGKIDQ----------------IFCNRNCFQCPRC
Ecym_4519          LSCFRCQGFEPVVKYCPKC---LEEPGKMDQ----------------IFCNRNCFQCPRC
                    :*  *:  :   . *. *      .   .                   * ..*::** *

TPHA0D04550        NNSLALSLCKNERLKDPNGKTISFQCYCCSWSWSTELPG--NVKLLSKHIFSLHLNLDPK
NCAS0A14070        ETALTVLLAKSSR---K--KRYKFTCKHCDYDYVTPSMSVTDERSISQIVDHLNETLNVE
KLLA0C16687g       AMSLQIISNKDENNTDH--RSYSFKCQGCNWSYCTPVVP--KIKSLTKYIIELEYSTDTH
KLTH0H01474g       ELILSVSMEKLAS--GH--KRFEMVCNGCSWRYKTPEVS--TLKTLTGCVEELRKKEDPY
Kwal_56.24604      QLAVSVSMRKQGD--GA--RCFELVCNGCLWKYTTPAMT--KARPLTQFVKELQEKEDPH
SAKL0F10978g       KLGLVISSGSCDD--GN--KKYVFKCMGCHWDYKTPSVG--KIRSLTKYIKSLKANECLL
ACL159W            NISLVISSEKVTE--DS--KSYVFTCTGCKWSFTTPPTG--KIKSLTKYVLELYNSKN--
Ecym_4519          DISLVISSEKMDS--DK--KCYLFNCTGCKWTFTTPPTG--KIKSLTKYILELYSSKN--
                      : :   .         .   : *  * : : *        . ::  :  *  .    

TPHA0D04550        FQRFKQLSNIYLNDS----SDCSNNDPSYSVKDIYLKQGDLQSARGLLDIINNKKETSFN
NCAS0A14070        YLRFQELKKN---------IELG-------------------------------------
KLLA0C16687g       -RRFESLRQFYHTRNTLNSLSLKPESLKFDALDPS-------NLNSWWKRLANGEPLW--
KLTH0H01474g       TQRFNSLREFYGFKRELQYMEEG------GEVSESI------ASKELFDRLNE-TKLY--
Kwal_56.24604      EQRFISLRKLYRDKIQFQNLETT------DVIDPSF------ATKEVAERLNN-MKLF--
SAKL0F10978g       SRRFEVLERHYHSKRQL--LDWG---LTKTPLKIPLDGSLVADRRNVLQRLSQGDKLF--
ACL159W            -SRAYELMTHLHNKKQL--LQWEGRAFKFDEIVNALEGN---APRSFVQRLAAGEKLH--
Ecym_4519          -ARAYELITHLHNKKQL--LQWEGKAFKFDEIVSALEGN---APRSIVQRLAVGEKLH--
                     *   *             .                                       

TPHA0D04550        TSSTVLLNDQF--PHQNLYDDTNTSLPELSKLVMKFEYKCPHCEETILKPSSELYSSDNT
NCAS0A14070        ----GGIDNVVVLPL----CGDDVILPRRTKLVCQFQSICPHCYHVVD------------
KLLA0C16687g       ----KLINEENAIPFDELKQENKHWLPSLCKLRPKYNYFCPYCKRCMTRMDPTPDTVKWV
KLTH0H01474g       ----KMINEECPIEFKDTKDSGDIALPLPLRLRAKFDYRCPSCGEWLTKSHPDPRSSRFL
Kwal_56.24604      ----ELVNEEFPLPIHKGTFTSWNSFPRARALRGKFNYRCPACGEYLTKCHPDPKSSRFM
SAKL0F10978g       ----ELLDEPCPMPLND--TSDALELPLQMHLRCKYKYSCPYCLNTLLKPETQPKSLKFY
ACL159W            ----HLINEELAQPLQQ--DMEHVLYPKRTHLKCRYRYMCPKCHHTLSMPDQTPASSKLH
Ecym_4519          ----QLISEQIPLPLKD--DSNEVLYPKRLHLKCKYRYTCPQCNHTLSVPDDSPSSSRLH
                         :.:                 *    *  .:   ** *   :             

TPHA0D04550        YESFAFTQLPTIEVSA-------IKDLKQDLVLIMKNIEDNLND-FVQAEIITSDNIQLS
NCAS0A14070        ------------------------------------------------------------
KLLA0C16687g       KTPPIYSGIPRISVISSYQCTQLYKEFDHDNNLMLLIENTRQDS-NATLKINAEESLLVP
KLTH0H01474g       LESFAAHMLPSLEIVH--RSK-VEPSVSDENAMALVFTASDQSDTPVEITILGSATIHIP
Kwal_56.24604      LESFAMHQLPDLQVVS--RSL-IDPKIDDENSMALVFKASSSAHVATDITIVSCATAHIP
SAKL0F10978g       TTSFAVKYLPALSLAP--RSQ-IDNKVYDDTRFALVINNPTSSE-EMHITMSGSDGLFIP
ACL159W            KESFAMNVLPHIRIET--EARALGVDTQDPTALAIIVMNPIPMR-AVDFVLSASDTLFLP
Ecym_4519          KESFAMNILPRIRIEK--LAVALGMDHQDPSAFAIVVINPNPSR-SIECTLTASDTLFMP
                                                                               

TPHA0D04550        QNKFIFMKSTG-----DKLQDKSKYYAELMSYLEGLPSFDLNLCDNVNNKFVRIEKQRRL
NCAS0A14070        ------------------------------------------------------------
KLLA0C16687g       NHELSIFAAI------KTNQKRKDNLEQLQDVLHSLPTHMLN-TSPDSDKLLRVENTRRL
KLTH0H01474g       VRQFTLAY--------DGPVKCESTMETIKRLVTRVPTYQLN----SNTNILATEKSRRL
Kwal_56.24604      VRQFTLTR--------DIPSRNELTQEAIKRLASEVPTFQLN----TNTKILAAEKSRRN
SAKL0F10978g       ITEVRIRAVTP-----VTPSHQDHGLKTIEQFILSVPTYKLT----ADTKLSRVERTKRL
ACL159W            VRKFTIPSVAPDDSQLDRSQGKDVNLQILEHYVKFIPTCMLG----NDHKLNRAERTRRL
Ecym_4519          IRKFNIPAVSVNDYKIIKNSGKDINLQILEQYAKFTPTYMLG----NDHKINRAERTRRL
                                                                               

TPHA0D04550        AK----------NNNIAVMNNANSPM-NYKEESDRYIVSPIKILTETALNKLLVKYKFKT
NCAS0A14070        ------------------------------------------------------------
KLLA0C16687g       GL---------------LNKRLSSDNLRIIDEGTGWIVIPLMIINRKPRYEIDIFVHFED
KLTH0H01474g       TR----------------PETAPHKN-NMIDQGSGWCILPMYILEPAKTHRIQLTIPIKG
Kwal_56.24604      SK----------------VERT-HKN-EIIDQGNGWCIIPMYILEPTPTHKLQLTIPIEG
SAKL0F10978g       GKKNLNVYSTANNSSTSLLEDL-EDY-KLLDQGSGWCIVPVNVLNNASVHSLFITVATQK
ACL159W            GNRFQFQGSASPTPPNPVDYDIEEEA-RPLDQGDAWCILPLKLLRDG-LHLLNVLVTIGD
Ecym_4519          GSRFPFQNSTT-NSINLLDYDIDEDA-KAIDKGDGWCILPLKLLNKG-NHLLNLLVNIEG
                                                                               

TPHA0D04550        YEVSLECILK-------
NCAS0A14070        -----------------
KLLA0C16687g       WDLSMSAFIDL------
KLTH0H01474g       VYVTLQAVLH-------
Kwal_56.24604      VYVTFQVVLST------
SAKL0F10978g       FKVTMNCVIKK------
ACL159W            WQVNLNLHFKQHIATIT
Ecym_4519          FEVRLNLHFIAKPSNS-
                                    

FASTA FORMAT for MUSCLE Version 3.6

>TPHA0D04550
---------------------MKIKWTCNCCKERNHYNGNDAQQYGIDFSRLNLCRKCHK
ISCDSCQLFQDYEKFCPYCCRNNKVPDCADGSRLSFEERYCQEICYDEYCTNGCFQCPKC
NNSLALSLCKNERLKDPNGKTISFQCYCCSWSWSTELPG--NVKLLSKHIFSLHLNLDPK
FQRFKQLSNIYLNDS----SDCSNNDPSYSVKDIYLKQGDLQSARGLLDIINNKKETSFN
TSSTVLLNDQF--PHQNLYDDTNTSLPELSKLVMKFEYKCPHCEETILKPSSELYSSDNT
YESFAFTQLPTIEVSA-------IKDLKQDLVLIMKNIEDNLND-FVQAEIITSDNIQLS
QNKFIFMKSTG-----DKLQDKSKYYAELMSYLEGLPSFDLNLCDNVNNKFVRIEKQRRL
AK----------NNNIAVMNNANSPM-NYKEESDRYIVSPIKILTETALNKLLVKYKFKT
YEVSLECILK-------
>NCAS0A14070
-------------------------MNCPCSRDPQ-------------VPHVTNCKVCHN
TTCPDCELFQPLQRECPQC---QTITMHMDE---------------DTRCKNDCFQCPNC
ETALTVLLAKSSR---K--KRYKFTCKHCDYDYVTPSMSVTDERSISQIVDHLNETLNVE
YLRFQELKKN---------IELG-------------------------------------
----GGIDNVVVLPL----CGDDVILPRRTKLVCQFQSICPHCYHVVD------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------
>KLLA0C16687g
--------------------MAQFRYRSGCGLESN-------------FLDLNLCTKCHL
ISCQQCQDFEVVGKYCSQC---GKDASKNDA----------------VYCHKNCFQCPCC
AMSLQIISNKDENNTDH--RSYSFKCQGCNWSYCTPVVP--KIKSLTKYIIELEYSTDTH
-RRFESLRQFYHTRNTLNSLSLKPESLKFDALDPS-------NLNSWWKRLANGEPLW--
----KLINEENAIPFDELKQENKHWLPSLCKLRPKYNYFCPYCKRCMTRMDPTPDTVKWV
KTPPIYSGIPRISVISSYQCTQLYKEFDHDNNLMLLIENTRQDS-NATLKINAEESLLVP
NHELSIFAAI------KTNQKRKDNLEQLQDVLHSLPTHMLN-TSPDSDKLLRVENTRRL
GL---------------LNKRLSSDNLRIIDEGTGWIVIPLMIINRKPRYEIDIFVHFED
WDLSMSAFIDL------
>KLTH0H01474g
---------------------MIAQWLCSCSTEPN------------SIYKLNICAKCHR
VSCNWCQKPELLIKYCPGC---FRVAESEGQ----------------LRCVHNCLECPRC
ELILSVSMEKLAS--GH--KRFEMVCNGCSWRYKTPEVS--TLKTLTGCVEELRKKEDPY
TQRFNSLREFYGFKRELQYMEEG------GEVSESI------ASKELFDRLNE-TKLY--
----KMINEECPIEFKDTKDSGDIALPLPLRLRAKFDYRCPSCGEWLTKSHPDPRSSRFL
LESFAAHMLPSLEIVH--RSK-VEPSVSDENAMALVFTASDQSDTPVEITILGSATIHIP
VRQFTLAY--------DGPVKCESTMETIKRLVTRVPTYQLN----SNTNILATEKSRRL
TR----------------PETAPHKN-NMIDQGSGWCILPMYILEPAKTHRIQLTIPIKG
VYVTLQAVLH-------
>Kwal_56.24604
---------------------MRVKWLCNCSTDPI------------SLYDLNLCRKCHR
VSCRWCQKPELLIKFCPGC---SKGAETKNQ----------------MSCNKNCFECPRC
QLAVSVSMRKQGD--GA--RCFELVCNGCLWKYTTPAMT--KARPLTQFVKELQEKEDPH
EQRFISLRKLYRDKIQFQNLETT------DVIDPSF------ATKEVAERLNN-MKLF--
----ELVNEEFPLPIHKGTFTSWNSFPRARALRGKFNYRCPACGEYLTKCHPDPKSSRFM
LESFAMHQLPDLQVVS--RSL-IDPKIDDENSMALVFKASSSAHVATDITIVSCATAHIP
VRQFTLTR--------DIPSRNELTQEAIKRLASEVPTFQLN----TNTKILAAEKSRRN
SK----------------VERT-HKN-EIIDQGNGWCIIPMYILEPTPTHKLQLTIPIEG
VYVTFQVVLST------
>SAKL0F10978g
---------------------MRVLVLCDCSSKCK------------SLSQLNLCQACYR
VSCTQCQLFEPVLKYCPLC---MEVPSRADQ----------------THCTKNCFQCPRC
KLGLVISSGSCDD--GN--KKYVFKCMGCHWDYKTPSVG--KIRSLTKYIKSLKANECLL
SRRFEVLERHYHSKRQL--LDWG---LTKTPLKIPLDGSLVADRRNVLQRLSQGDKLF--
----ELLDEPCPMPLND--TSDALELPLQMHLRCKYKYSCPYCLNTLLKPETQPKSLKFY
TTSFAVKYLPALSLAP--RSQ-IDNKVYDDTRFALVINNPTSSE-EMHITMSGSDGLFIP
ITEVRIRAVTP-----VTPSHQDHGLKTIEQFILSVPTYKLT----ADTKLSRVERTKRL
GKKNLNVYSTANNSSTSLLEDL-EDY-KLLDQGSGWCIVPVNVLNNASVHSLFITVATQK
FKVTMNCVIKK------
>ACL159W
---------------------MEVRYQCVCQQLVK-------------WSDLNSCKECHS
ISCFRCQEFEPVLKYCPKC---LEEPGKIDQ----------------IFCNRNCFQCPRC
NISLVISSEKVTE--DS--KSYVFTCTGCKWSFTTPPTG--KIKSLTKYVLELYNSKN--
-SRAYELMTHLHNKKQL--LQWEGRAFKFDEIVNALEGN---APRSFVQRLAAGEKLH--
----HLINEELAQPLQQ--DMEHVLYPKRTHLKCRYRYMCPKCHHTLSMPDQTPASSKLH
KESFAMNVLPHIRIET--EARALGVDTQDPTALAIIVMNPIPMR-AVDFVLSASDTLFLP
VRKFTIPSVAPDDSQLDRSQGKDVNLQILEHYVKFIPTCMLG----NDHKLNRAERTRRL
GNRFQFQGSASPTPPNPVDYDIEEEA-RPLDQGDAWCILPLKLLRDG-LHLLNVLVTIGD
WQVNLNLHFKQHIATIT
>Ecym_4519
MKYSNKSRYFSLSIHNMDDPDMEVRYQCICKNLVK-------------WSDLNICRECYS
LSCFRCQGFEPVVKYCPKC---LEEPGKMDQ----------------IFCNRNCFQCPRC
DISLVISSEKMDS--DK--KCYLFNCTGCKWTFTTPPTG--KIKSLTKYILELYSSKN--
-ARAYELITHLHNKKQL--LQWEGKAFKFDEIVSALEGN---APRSIVQRLAVGEKLH--
----QLISEQIPLPLKD--DSNEVLYPKRLHLKCKYRYTCPQCNHTLSVPDDSPSSSRLH
KESFAMNILPRIRIEK--LAVALGMDHQDPSAFAIVVINPNPSR-SIECTLTASDTLFMP
IRKFNIPAVSVNDYKIIKNSGKDINLQILEQYAKFTPTYMLG----NDHKINRAERTRRL
GSRFPFQNSTT-NSINLLDYDIDEDA-KAIDKGDGWCILPLKLLNKG-NHLLNLLVNIEG
FEVRLNLHFIAKPSNS-