MUSCLE (3.8) multiple sequence alignment

KLLA0E09901g       MPSITKKSAPFKAHSGPIPVTILSGFLGSGKTTLLERILTSNHGMKVAVIINDMSELNVD
SAKL0H26246g       ------MTVAKKARKTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIINDMSELNID
KLTH0C10450g       ------MTSDKKVSKA-IPITLLSGFLGSGKTTLLEKILTTNHGFKIAVIINDMSELNID
Kwal_56.22530      ------MTSDQNTKKA-IPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNID
                          :   :. .  **:*:**************.***:*** *:***********:*

KLLA0E09901g       AALIKDHKVANKEEKLIQLQNGCICCTLRGDLLEELINLHQNNEFDYILIESTGIAEPMQ
SAKL0H26246g       ATLVQNHSVTKKEEKLIQLQNGCICCTLRGDLLEELFGLAENGEFQYIVIESTGIAEPMQ
KLTH0C10450g       SSLVQAHNVCQKEEKLIELQNGCICCTLRGDLLEELVGIGERGEFDYIVIESTGIAEPMQ
Kwal_56.22530      SSLIQNHNVCQKEEKLIELQNGCICCTLRGDLLEELVGIAEKGHFDYIVIESTGIAEPMQ
                   ::*:: *.* :******:******************..: :.. *:**:***********

KLLA0E09901g       VAETFSSEFSQTLLDTPDSVTSDERVLLQKVLDLGGLEKLTKIDTTVTVIDAMNFLANIE
SAKL0H26246g       VAETFSMEFSEMLLETPGGIPEDEEKLLKKVLEMGGLHKITKIDTCVTVIDALNFLSNIE
KLTH0C10450g       VAETFSVEFSDILLETPGGIPENEEKLLRKVSDMGGLQAIAKLDTCVTVIDALNFLSNIQ
Kwal_56.22530      VAETFSVEFSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANIN
                   ****** ***: **:**..:..:*  **.** ::***  ::*:** ***:**:**::**:

KLLA0E09901g       TTDFLANRWGDSGQGEADRTVTDLMIDQIEFADVIIINKTDRIKKKRLTKIQKIIKSLNL
SAKL0H26246g       TTQFLADRWGDNGQGEADRTITDLMVDQIEFADVVIINKVSLIKKRKLRKIEKIIKGLNP
KLTH0C10450g       TTEFLADRWGENGQGEAERTITDLMVDQIEFSDVIIVNKKSMVSKKKLKEIKKMVKILNP
Kwal_56.22530      TTQFLADRWGENGQGESERTITDLMVDQIEFADVVIINKKNTVSKKKMQKIRKMIKALNP
                   **:***:***:.****::**:****:*****:**:*:** . :.*..: :* *::* ** 

KLLA0E09901g       VAKIIKTSYCKVPMSEILNTGLYNFEKAASSAGWLKSINEMTLKEGYGDKTKSVLSPTPE
SAKL0H26246g       VAKILKTDYCNVPMEEIINTNLFDFEKASTSAGWLQSINEMTVRTGFDDKKKSILTPKPE
KLTH0C10450g       VAKVIATDYCNVPLSSILDTKLHDFEKASLSAGWLQSINEMTVRDGFGNKGSSVLTPKPE
Kwal_56.22530      VAKTVAADYCNVPLSLILNTGLHDFEKASTSAGWLQSINEMTVREGFGEKGGSVLTPKPE
                   *** : :.**:**:. *::* *.:****: *****:******:. *:.:*  *:*:*.**

KLLA0E09901g       TVEYGVNSFVYKSRKPFHPKRLYDALKDKFYIIEQQALAEQEHVDLYEVDEEEKEEERSL
SAKL0H26246g       TEEYGVNNFVYTARRPFHPERLYSMLKDKFFIIEQTEIDDQA--DGEEMDEDEDGEDKDG
KLTH0C10450g       TEEYGVNNFVYRRRRPFHPERLYDLIRDKFFVIEQAGAAGM---DEEEEDDEEESEEQSS
Kwal_56.22530      TEEYGVNNFVYRRRRPFHPERLYELIRDKFFIIEQAGGVPTG--EEGEDWQDEEGSESEE
                   * *****.***  *.****:***. :.***::***         :  *  ::*. .: . 

KLLA0E09901g       AATPDTSKVHELLQSEDEAESESEGDDDDEEELSERELIRNKKNSPFGPLLRSKGFFWLA
SAKL0H26246g       EDSSVSDQEEEI---EEESEDGSAG-------LTEKQILKNKKISSFGPLLRSKGFFWLA
KLTH0C10450g       ESEADSEMEAEV---DEGARDGEEKEEEEGEEYTEEEINKNRANSPFGKLLRSKGFFWLA
Kwal_56.22530      ESEADSGSN------SADEEDEGGEDDDEAEEYTEEEINTNRSKSPFGQLLRSKGFFWLA
                      . :         .    .            :* ::  *.  *.** ***********

KLLA0E09901g       TRYLLRGEWSSAGPMLTLKGGIPWFHVAGLDKQEDIPPEALTLIKRDFQGPFGDRRNELV
SAKL0H26246g       TRHIMRGEWSSAGPMLTLKGGTPWFAVSGL---ESVPDDTAKLIKQEFEGEFGDRRNEIV
KLTH0C10450g       TRFVVRGEWSSAGPMLTLNGGLPWFAVSGL---EDVPEEALELVKKDYEGEFGDRRNELV
Kwal_56.22530      TRYVVRGEWSSAGPMLTLNGGLPWFAVSGL---DNVPEEALPLIKKDFDGEFGDRRNELV
                   **.::*************:** *** *:**   :.:* ::  *:*.:::* *******:*

KLLA0E09901g       FIGTGIDSVKLKQILDDCLLTEDEYKQFVDCSLKEHNLLKVERRLSELFQDGFEDWLLYD
SAKL0H26246g       FIGLDIEKRALTKDLDSCLLNDEEFATFVAATKGKKNILKVEKELATIFEDGFEDWFIFN
KLTH0C10450g       FIGLDINEKLLSEALDSCLLTDKEYKRFKNIT-SKHNALVADEKLSKVWDDGFEDWIIMG
Kwal_56.22530      FIGLKINEKLLSEVLDSCLLTDKEMAQFKRIT-DKHNELVADEKLAKIWDDGFEDWQIMG
                   ***  *:.  *.: **.***.:.*   *   :  ::* * .:  *: :::****** : .

KLLA0E09901g       DDDDDEDD-------DEEKEEEGEEED----------------
SAKL0H26246g       EEDLE----------DIAAEGPSKEVVKAIDEEQYNHVDLVK-
KLTH0C10450g       AGDEEEEDREQEEEQEEEEEEEGKERSQKSVPMEISTSKGISV
Kwal_56.22530      AGDED----------EEEDQGEAKKVAQEKGVLGARHSHTIST
                     * :          :   :  .::                  

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0E09901g
MPSITKKSAPFKAHSGPIPVTILSGFLGSGKTTLLERILTSNHGMKVAVIINDMSELNVD
AALIKDHKVANKEEKLIQLQNGCICCTLRGDLLEELINLHQNNEFDYILIESTGIAEPMQ
VAETFSSEFSQTLLDTPDSVTSDERVLLQKVLDLGGLEKLTKIDTTVTVIDAMNFLANIE
TTDFLANRWGDSGQGEADRTVTDLMIDQIEFADVIIINKTDRIKKKRLTKIQKIIKSLNL
VAKIIKTSYCKVPMSEILNTGLYNFEKAASSAGWLKSINEMTLKEGYGDKTKSVLSPTPE
TVEYGVNSFVYKSRKPFHPKRLYDALKDKFYIIEQQALAEQEHVDLYEVDEEEKEEERSL
AATPDTSKVHELLQSEDEAESESEGDDDDEEELSERELIRNKKNSPFGPLLRSKGFFWLA
TRYLLRGEWSSAGPMLTLKGGIPWFHVAGLDKQEDIPPEALTLIKRDFQGPFGDRRNELV
FIGTGIDSVKLKQILDDCLLTEDEYKQFVDCSLKEHNLLKVERRLSELFQDGFEDWLLYD
DDDDDEDD-------DEEKEEEGEEED----------------
>SAKL0H26246g
------MTVAKKARKTPIPITMLSGFLGSGKTTLLEKILTTNHGLKVAVIINDMSELNID
ATLVQNHSVTKKEEKLIQLQNGCICCTLRGDLLEELFGLAENGEFQYIVIESTGIAEPMQ
VAETFSMEFSEMLLETPGGIPEDEEKLLKKVLEMGGLHKITKIDTCVTVIDALNFLSNIE
TTQFLADRWGDNGQGEADRTITDLMVDQIEFADVVIINKVSLIKKRKLRKIEKIIKGLNP
VAKILKTDYCNVPMEEIINTNLFDFEKASTSAGWLQSINEMTVRTGFDDKKKSILTPKPE
TEEYGVNNFVYTARRPFHPERLYSMLKDKFFIIEQTEIDDQA--DGEEMDEDEDGEDKDG
EDSSVSDQEEEI---EEESEDGSAG-------LTEKQILKNKKISSFGPLLRSKGFFWLA
TRHIMRGEWSSAGPMLTLKGGTPWFAVSGL---ESVPDDTAKLIKQEFEGEFGDRRNEIV
FIGLDIEKRALTKDLDSCLLNDEEFATFVAATKGKKNILKVEKELATIFEDGFEDWFIFN
EEDLE----------DIAAEGPSKEVVKAIDEEQYNHVDLVK-
>KLTH0C10450g
------MTSDKKVSKA-IPITLLSGFLGSGKTTLLEKILTTNHGFKIAVIINDMSELNID
SSLVQAHNVCQKEEKLIELQNGCICCTLRGDLLEELVGIGERGEFDYIVIESTGIAEPMQ
VAETFSVEFSDILLETPGGIPENEEKLLRKVSDMGGLQAIAKLDTCVTVIDALNFLSNIQ
TTEFLADRWGENGQGEAERTITDLMVDQIEFSDVIIVNKKSMVSKKKLKEIKKMVKILNP
VAKVIATDYCNVPLSSILDTKLHDFEKASLSAGWLQSINEMTVRDGFGNKGSSVLTPKPE
TEEYGVNNFVYRRRRPFHPERLYDLIRDKFFVIEQAGAAGM---DEEEEDDEEESEEQSS
ESEADSEMEAEV---DEGARDGEEKEEEEGEEYTEEEINKNRANSPFGKLLRSKGFFWLA
TRFVVRGEWSSAGPMLTLNGGLPWFAVSGL---EDVPEEALELVKKDYEGEFGDRRNELV
FIGLDINEKLLSEALDSCLLTDKEYKRFKNIT-SKHNALVADEKLSKVWDDGFEDWIIMG
AGDEEEEDREQEEEQEEEEEEEGKERSQKSVPMEISTSKGISV
>Kwal_56.22530
------MTSDQNTKKA-IPITLLSGFLGSGKTTLLEKILTTNHGYKVAVIINDMSELNID
SSLIQNHNVCQKEEKLIELQNGCICCTLRGDLLEELVGIAEKGHFDYIVIESTGIAEPMQ
VAETFSVEFSDMLLETPGGIPEDEEKLLRKVSNMGGLQSLAKIDTCVTVVDALNFFANIN
TTQFLADRWGENGQGESERTITDLMVDQIEFADVVIINKKNTVSKKKMQKIRKMIKALNP
VAKTVAADYCNVPLSLILNTGLHDFEKASTSAGWLQSINEMTVREGFGEKGGSVLTPKPE
TEEYGVNNFVYRRRRPFHPERLYELIRDKFFIIEQAGGVPTG--EEGEDWQDEEGSESEE
ESEADSGSN------SADEEDEGGEDDDEAEEYTEEEINTNRSKSPFGQLLRSKGFFWLA
TRYVVRGEWSSAGPMLTLNGGLPWFAVSGL---DNVPEEALPLIKKDFDGEFGDRRNELV
FIGLKINEKLLSEVLDSCLLTDKEMAQFKRIT-DKHNELVADEKLAKIWDDGFEDWQIMG
AGDED----------EEEDQGEAKKVAQEKGVLGARHSHTIST