MUSCLE (3.8) multiple sequence alignment

KLTH0C11374g       MIPYPTRDTDDFSLTDFRSRGSGGGQKQAKYVAETEISAPVRRELKPKAIAHARREPSWG
Kwal_56.22396      MIPYPTRDSDDFSLTDFRP--AENRRRRGRSMGDSR-AEPARVQRTQIRKISNPYEDSVG
                   ********:*********.  : . ..... :.::  : *.* : .         * * *

KLTH0C11374g       T---LEGGTAPVETNIYLRSLAHESDEPNLAAERKRSKGDTFAINDDST--LLDTGDKIV
Kwal_56.22396      TRRHLQVSSLPLEVPSYARAKIGKKLEP-VAVPREYALHSTSSREDDESTLLVDSGDKIS
                   *   *: .: *:*.  * *:   :. ** :*. *: :  .* : :**.:  *:*:**** 

KLTH0C11374g       ARQ-KADVRTECVQQWRSTDVIHANRFLPQKRQLQVTSKRSAPL-----TLKAPMIHQGD
Kwal_56.22396      TRQERKQMPVEAVVHQFSQPVVPLE-FAPVMQPVEQIAETFFSMGADKNALSTVMFSGGG
                   :** . :: .*.* :. *  *:  : * *  . ::  ::   .:     :*.: *:  *.

KLTH0C11374g       TLKKILLTFALLITVLTFESMSSKLINIIKASTGLS
Kwal_56.22396      SI-KIIWILALAVAVLLFDSLSSRLIESIKEKSGLN
                   :: **:  :** ::** *:*:**.**: ** .:**.

FASTA FORMAT for MUSCLE Version 3.6

>KLTH0C11374g
MIPYPTRDTDDFSLTDFRSRGSGGGQKQAKYVAETEISAPVRRELKPKAIAHARREPSWG
T---LEGGTAPVETNIYLRSLAHESDEPNLAAERKRSKGDTFAINDDST--LLDTGDKIV
ARQ-KADVRTECVQQWRSTDVIHANRFLPQKRQLQVTSKRSAPL-----TLKAPMIHQGD
TLKKILLTFALLITVLTFESMSSKLINIIKASTGLS
>Kwal_56.22396
MIPYPTRDSDDFSLTDFRP--AENRRRRGRSMGDSR-AEPARVQRTQIRKISNPYEDSVG
TRRHLQVSSLPLEVPSYARAKIGKKLEP-VAVPREYALHSTSSREDDESTLLVDSGDKIS
TRQERKQMPVEAVVHQFSQPVVPLE-FAPVMQPVEQIAETFFSMGADKNALSTVMFSGGG
SI-KIIWILALAVAVLLFDSLSSRLIESIKEKSGLN