MUSCLE (3.8) multiple sequence alignment

ZYRO0D09856g       MRKGYYYLEYGTTKLCKTTVGTASNMSRVDWNQLGTSN--PLLSPAFVVSSAHHLVFTSG
KLLA0E04005g       ------------------------MARKITWKDVGVKDGFPLISPGFATESGNQLLFSSG
SAKL0F02684g       ------------------------MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSG
Kwal_55.21247      ------------------------MARQVTWKEVGPGKGYPILAPAYVT-SNSDLVFTSG
KLTH0F14916g       ---------MIQTLHPLLTSCVRKMAKKVTWQEVGATKGIDLLSPAFVT-SGSKLVFTSG
                                              .  *:::*  .   :::*.:.. *   *:::**

ZYRO0D09856g       CLGTDD-QDQLPECPAEQTKNAFENLSKVLEASG-SSLSSVIKVLLFVKDPALVPVVNRI
KLLA0E04005g       CVGTDPVTNELPEDLEQQARNSMINLKKVLEVSG-SSVDSVLKILLFVSDGSYAGIVNKV
SAKL0F02684g       CVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKV
Kwal_55.21247      CVGTDPVTGELPTDLEQQVRNALENLKNVLRASG-SSLEQVIKVLLFVSDGSYAPAVNKV
KLTH0F14916g       CIGSDPVTDELPEDLEQQARNALQNLRNVLEASG-SNSDRVLKVLLFVADGAYSQTVNRI
                   *:*:*   .:**    :*..*:: **  **  ** *. . *:*:**** *      **.:

ZYRO0D09856g       YQKYFPEKPARSCIVVAFPNPKVQVELECVAVTKSRESKL--
KLLA0E04005g       FKEFFPNQPARSCIVVAFPNNKLKVELECIAEIPSKKRWFKL
SAKL0F02684g       YKEYFTNQPCRSCVVVGFPNEKIKVELECVAEIDKKTRWFKL
Kwal_55.21247      YSEYFPGAPARSCIVVSFPNASLKVELECIAEAGPAKPKF--
KLTH0F14916g       YREQFPNSPARSCVVVSFPNPKIKVELECIAEVQPKARWFKL
                   : : *.  *.***:**.*** .::*****:*       .:  

FASTA FORMAT for MUSCLE Version 3.6

>ZYRO0D09856g
MRKGYYYLEYGTTKLCKTTVGTASNMSRVDWNQLGTSN--PLLSPAFVVSSAHHLVFTSG
CLGTDD-QDQLPECPAEQTKNAFENLSKVLEASG-SSLSSVIKVLLFVKDPALVPVVNRI
YQKYFPEKPARSCIVVAFPNPKVQVELECVAVTKSRESKL--
>KLLA0E04005g
------------------------MARKITWKDVGVKDGFPLISPGFATESGNQLLFSSG
CVGTDPVTNELPEDLEQQARNSMINLKKVLEVSG-SSVDSVLKILLFVSDGSYAGIVNKV
FKEFFPNQPARSCIVVAFPNNKLKVELECIAEIPSKKRWFKL
>SAKL0F02684g
------------------------MPTKTTWKDIGAPEASALLSPAFVTTSNTPLVYTSG
CVGTDPKTGELPEDLEQQTRNAIENLRIVLSKSGCSSLDQVVKVLLFVADGKYAPVVNKV
YKEYFTNQPCRSCVVVGFPNEKIKVELECVAEIDKKTRWFKL
>Kwal_55.21247
------------------------MARQVTWKEVGPGKGYPILAPAYVT-SNSDLVFTSG
CVGTDPVTGELPTDLEQQVRNALENLKNVLRASG-SSLEQVIKVLLFVSDGSYAPAVNKV
YSEYFPGAPARSCIVVSFPNASLKVELECIAEAGPAKPKF--
>KLTH0F14916g
---------MIQTLHPLLTSCVRKMAKKVTWQEVGATKGIDLLSPAFVT-SGSKLVFTSG
CIGSDPVTDELPEDLEQQARNALQNLRNVLEASG-SNSDRVLKVLLFVADGAYSQTVNRI
YREQFPNSPARSCVVVSFPNPKIKVELECIAEVQPKARWFKL