MUSCLE (3.8) multiple sequence alignment

KLLA0E12959g       MGDDQESMSKSSGAVEHLINRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQ
SAKL0E14806g       --MATGYMSTSSSTKDMISAR-KSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQ
KLTH0E01144g       -------MSASSSNKGTIKNR-KSHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQ
Kwal_55.19721      --MDGNLMSASSSAMDTIKNR-KSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQ
                          ** **.    :  * :*: :: .*.: **  :*********::** .**** *

KLLA0E12959g       VLAEIGYKEELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLI
SAKL0E14806g       VLAEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLI
KLTH0E01144g       VLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLI
Kwal_55.19721      VLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLV
                   ****:*********:*::*******************:**** **.***.****:****:

KLLA0E12959g       LSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLA
SAKL0E14806g       LTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLA
KLTH0E01144g       LTIGIALGELSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLA
Kwal_55.19721      LTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLA
                   *::****.****::********:****** . **.*************.***********

KLLA0E12959g       QQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSIIANVFLIIL
SAKL0E14806g       QQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCFLIIL
KLTH0E01144g       QQILSAVLVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVL
Kwal_55.19721      QQILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIIL
                   *******:*.**.* .*:*******.**::.:::***: : :*:.:**:**::* ***:*

KLLA0E12959g       FFIVLPIGVSRSDKV--SFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCL
SAKL0E14806g       FFIALPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCL
KLTH0E01144g       FFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCL
Kwal_55.19721      FFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCL
                   ***.:********.:   ** . :***. :* : ** **.*** *: *************

KLLA0E12959g       HMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQ
SAKL0E14806g       HMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFY
KLTH0E01144g       HMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIY
Kwal_55.19721      HMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIY
                   ******.** ****:***.**: ***:***:***:****:*::: :::* :**.:**:: 

KLLA0E12959g       DALGKRWTLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPM
SAKL0E14806g       DALGKRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPI
KLTH0E01144g       DALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPV
Kwal_55.19721      DALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPV
                   ********* ***::************:*************.:***:*****.    **:

KLLA0E12959g       RSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFY
SAKL0E14806g       RAVWGSSILSLALGCLCLAGEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFY
KLTH0E01144g       RAVWGSSALSLALGCLCLVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFY
Kwal_55.19721      RAVWGSSALSLALGCLCLVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFY
                   *::**** :*:***.***.*:.*:.******:*******:***:******..********

KLLA0E12959g       LGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQ
SAKL0E14806g       MGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQ
KLTH0E01144g       LGDFWSPIINWISVFFQAFVIIMMMFPSD-STVTPTTMNYTVVIGPGFWVLSLIYYFVWQ
Kwal_55.19721      LGDVWSPIINWIAVFAQAFMIIMMMFPSD-ATVDPSTMNYTVVIGPGFWVLSLIYYFVWQ
                   :* .**.  .*::*  * * ::*:*** :   :   ********************:.**

KLLA0E12959g       RKFYEGPKSNLTDEEFVEAVGEDAIDAMLSNYSQAHQDKLS
SAKL0E14806g       SKFYEGPKSNLSDEEFAERVGDDVLDAILSSNVEVNNDRLS
KLTH0E01144g       RKFYKGPKSNLTDEEFQEYVGDDVIDAIMSNNEADYKPGDA
Kwal_55.19721      RKFYQGPKSNLTDEEFQEYVGEDVIDAIISNNVATQKDRMV
                    ***:******:**** * **:*.:**::*.     :    

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0E12959g
MGDDQESMSKSSGAVEHLINRNNSNDEIGFGSVSELRVVTSAHGAPIRYIDALSATSDTQ
VLAEIGYKEELKREYSTVQIFGVAFSIMGLLPSIASTMDGGLAAGAVGLNWGWFVAGGLI
LSVGIALGELSSSIPTAGAVYVACYQWAPEKWRKCISYSVGFLDTLSLCASVCSIVYGLA
QQILSAVVVGNPDFEVTDPITYGVFCACIVAITVLTSMNSKITARLQTFSIIANVFLIIL
FFIVLPIGVSRSDKV--SFNKASYIFGDVQNLTDWNTGWSWCINGLTPAIWTIGAYDSCL
HMAEEAKDARRAVPIGIVASISSCWILGWLICIVILACMNPDVNAIVNSPYGQGITQVFQ
DALGKRWTLTFLSLIIICQFLMGASTVLANSRQFWAFARDDGIPFSKFFKKVDERSHVPM
RSIWGSSFFSIALGALCLAGDTAADALFSLSIAGMYMALVFPIALRLTYGRKDFRPGPFY
LGHFWSTANGWLAVFFQLFAVLMVMFPYDKSGITKETMNYTVVIGPGFWVLSLIYYFVWQ
RKFYEGPKSNLTDEEFVEAVGEDAIDAMLSNYSQAHQDKLS
>SAKL0E14806g
--MATGYMSTSSSTKDMISAR-KSNVDIGVGNVAELRSITSAHGAPIRYIDAKNATSDQQ
VLAEIGYKEELKREFSTLQIFGVAFSIMGLLPSIASTMDGGLYAGPVGLSWGWFVAGGLI
LTVGIALAELSSSIPTAGAVYVSCYQWAPARWRKSISYSVGFLDTLSLCASVCSIVYGLA
QQILSAVVVSNPDFVVTDPITYGVFAACVIAMAVLTSLASGFTSKLQTISIVSNCFLIIL
FFIALPIGVSRSDKLNHSFNNAKFIFGKSENFTDWNGGWSWCINGLTPAIWTIGAYDSCL
HMAEEARDAVRAVPIGIVGSIASCWILGWLICIVLLACMDPDLNNIINSPYGQGITQVFY
DALGKRWTLAFLSFMIICQFLMGASTVVANSRQFWAFARDDALPFSNFFKKVNGSVAVPI
RAVWGSSILSLALGCLCLAGEVAADALFSLSIAGMYMALIFPITLRLTYGKKDFRPGPFY
MGDFWSPIINWISVAFQLFTIIMVMFPYQQHNIDKDTMNYTVVIGPGFWVLSLIYYYFWQ
SKFYEGPKSNLSDEEFAERVGDDVLDAILSSNVEVNNDRLS
>KLTH0E01144g
-------MSASSSNKGTIKNR-KSHVDVEVGQMRELGTITSAHGAPIRFVDARSATSDQQ
VLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLI
LTIGIALGELSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSASVCSIVYGLA
QQILSAVLVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTISIISNCFLIVL
FFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPAIWTIGAYDSCL
HMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLDSQFGQAMTQIIY
DALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSNFFKKVDGLTGVPV
RAVWGSSALSLALGCLCLVGETASGALFSLSVAGMYMALIFPITLRLTYGKKDFRPGPFY
LGDFWSPIINWISVFFQAFVIIMMMFPSD-STVTPTTMNYTVVIGPGFWVLSLIYYFVWQ
RKFYKGPKSNLTDEEFQEYVGDDVIDAIMSNNEADYKPGDA
>Kwal_55.19721
--MDGNLMSASSSAMDTIKNR-KSNVEVEVGQVRELRTITSAHGAPIRFVDARSATSDKQ
VLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWGWFIAGGLV
LTIGIALAELSSSIPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLCASVCSIVYGLA
QQILSAVLVSNPSFNVTNPITYGVFAACIIAMTILTSMPTKFTSRMQTISIVSNVFLIIL
FFIAVPIGVSRSDKLGRHFNDGHFIFGKNDNLSSWNKGWNWCIAGMMPAIWTIGAYDSCL
HMAEEARDAVRAVPFGIVGSISVCWIVGWLICIVLLACMDPNIDNVLNSEFGQGMTQIIY
DALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGIPFSNFFKKVSNTTGVPV
RAVWGSSALSLALGCLCLVGEAASGALFSLSVAGMYMALIFPITLRLTYGKRDFRPGPFY
LGDVWSPIINWIAVFAQAFMIIMMMFPSD-ATVDPSTMNYTVVIGPGFWVLSLIYYFVWQ
RKFYQGPKSNLTDEEFQEYVGEDVIDAIISNNVATQKDRMV