MUSCLE (3.8) multiple sequence alignment

KAFR0D03940        ----MPILRNIIRSKRNEDSTESNDDSTT-----------SYDNFEIIEIQHNDS-----
ZYRO0F16654g       -------------MDYKGPLEFNQHELD------------SSKENTDKPSLNETY-----
KLTH0F02398g       --------------------------------------------MEMQSFEKQPQ-----
Kwal_33.13401      ----------------------------------------------MLKTSEKEG-----
CAGL0J08184g       --------------MEIGPSD-------------------LKEKSVIQDIDTIID-----
YNL270C            ---------------MDETVNI------------------QMSKEGQYEINSSSI-----
Smik_14.67         ---------------MNESVDM------------------RMSKVSQYEINSIST-----
Suva_14.73         ------------------------------------------------------------
Skud_14.70         ---------------MNENVDI------------------CTSKEGKREANSAPT-----
TDEL0C06180        --------------MWNAKQDVSEEGYELGNF--------SGMNDEDSSSGQAGA-----
Kpol_2000.65       MGQQNDELTQYELQSFNSSSSNGVNKTYNY----------ITADAELKKLKKKEY-----
TPHA0B04480        --MSQKDLSQYELQSYTSNNRSSASEMNKGSDAKEKVDVISSSGSLSKRKRINRS-----
TBLA0A05450        --MDNKDNASIELHSYHESLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYA
KAFR0D00700        ----------------------MDT---------------LESSSQSVPRQRKSG-----
KNAG0C00790        -------------MEFSEKPGASVGSSPD-----------MRHRKKAEEMRETKL-----
Suva_5.4           MTTPKQDSEVEEKHMYTEPAGTFFH---------------DVEASQTHHRRGSLS-----
Smik_5.24          MTDPKQNTEIEEKHMYNEPVTTLFH---------------DVEASQTHRRRGSLP-----
Skud_5.26          MTNPKQEAEIEEKHMYNEPVTTLLH---------------DVEASQTHRRRGSLS-----
YEL063C            MTNSKEDADIEEKHMYNEPVTTLFH---------------DVEASQTHHRRGSIP-----
NDAI0A00610        ----------------------------------------MDKKQEEPLKNGKIK-----
NCAS0B08570        ------------------------------------------------------------
NDAI0F04200        ------------------------------------MSILDINTEETLEGKSKIV-----
NCAS0A00600        ------------------------------------------------------------
KLLA0C02343g       --------------MTSIAQQIELEELE------------ALHSNLSQSQSARSG-----
SAKL0C02662g       ------------------------------------------------------------
AFR668W            ------------------------------------------MTNIIYEPKGDGS-----
Ecym_1087          ----------------------MVENVE------------LETYPAGKQHNDRSA-----
                                                                               

KAFR0D03940        KDNSIKKKIPNSELASLTHAYSRSRVEPEHDEDAEEADYEDKQVKRELKQRHIGMIALGG
ZYRO0F16654g       VKEYDRSISSPPKENDGYGYRVDNEYDVDDSVDGEKGEVRSTEVKRALKPRHIGMIALGG
KLTH0F02398g       LHKNEIKVMEEGESSSLADGVLEQQSQIDTASSQERG------IQRALKPRHVSMIALGG
Kwal_33.13401      MSQKTETRLEDYEMGSFAEEALDQEAQSSQDSQLGSSGHGRNAVQRQLKPRHVSMIALGG
CAGL0J08184g       GNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHIGMIALGG
YNL270C            IKEEEFVDEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHIGMIALGG
Smik_14.67         IKEEELICARYDGQDTEEAVAGKSSINNDSAKETETSPRKGGEVKRKLKQRHIGMIALGG
Suva_14.73         ------------------------------------------------------MIALGG
Skud_14.70         IKEKELVDAQYEEQDTSAAIAANSSIENDGAKGTETSPRSRGEVQRKLKERHIGMIALGG
TDEL0C06180        INHRKKSVVSKTTAVDESLPGLSSSDLESSDDFVKEGQVHEAEVKRALKQRHIGMIALGG
Kpol_2000.65       ETGSSSIVVDGSSRHLHGSHGSHSVSGDEDEPYVDQGVVQDAEVKRELKQRHIGMIALGG
TPHA0B04480        RANSNSDLEGSAADGTARARDIDNADVDDDDYYMDEGVVKEAEVKRQLKQRHIGMIALGG
TBLA0A05450        KSDEDATLTKASKRHVRASSVSTASSSIAEEDIDATGVVEEAQVKRELKPRHIGMIALGG
KAFR0D00700        VQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHIGMIALGG
KNAG0C00790        AAVTSYTSLGESRADIRHRMSFES--GEDGESEEQTGYVHDAEVKRELKQRHIGMIALGA
Suva_5.4           LKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHIGMIALGG
Smik_5.24          LKDEKNKELYPLHSFSTRVDGEDTFSMGDVIRDEDQGEVRNAEVKRELKQRHIGMIALGG
Skud_5.26          LKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHIGMIALGG
YEL063C            LKDEKSKELYPLRSFPTRVNGEDTFSMEDGIGDEDEGEVQNAEVKRELKQRHIGMIALGG
NDAI0A00610        SSSYELDDYPLHRRTNSVHSIPSQITIESQEEEIANGQIREAEVKRELKQRHIGMIALGG
NCAS0B08570        -----------------MLGGHNQDSKMKEEIREISVEVEAETVRRELKQRHMGMIALGG
NDAI0F04200        IKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDE---YHEVKRDLSKRHIAMIALGG
NCAS0A00600        ---------MKLNQPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMIALGG
KLLA0C02343g       MHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGG
SAKL0C02662g       --MSLSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGG
AFR668W            SSSTITAKPGAIKAEVLNHNTSEVESLCEKPN--------QSDVKRELKPRHVTMISLGG
Ecym_1087          ESSESSDVLHHRKETKNEGIFINQENMSEVESLYGND---DPDVKRDLKPRHMSMISLGG
                                                                         **:**.

KAFR0D03940        TIGTGLFVGIATPLADAGPVGALIAYIFMGSIVYFVTQALGEMATFIPVTSSITVFSQRF
ZYRO0F16654g       TIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSVMQSLGEMATYIPVTSAFSVFSQRF
KLTH0F02398g       TIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMATFIPVASSFTVFTRRF
Kwal_33.13401      TIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMATFIPVTSSFTVFTRRF
CAGL0J08184g       TIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRF
YNL270C            TIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRF
Smik_14.67         TIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRF
Suva_14.73         TIGTGLIIGIGPPLAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRF
Skud_14.70         TIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRF
TDEL0C06180        TIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEMATFIPVTSAFTVFSSRF
Kpol_2000.65       TIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFSSRF
TPHA0B04480        TIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFSSRF
TBLA0A05450        TIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRF
KAFR0D00700        TIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRF
KNAG0C00790        TIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQSLGEMATFIPVTSSFTVFAQRF
Suva_5.4           TIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRF
Smik_5.24          TIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRF
Skud_5.26          TIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRF
YEL063C            TIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRF
NDAI0A00610        TIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFIPVTSSFTVFSQRF
NCAS0B08570        TIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRF
NDAI0F04200        TIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRF
NCAS0A00600        TIGTGLFLGIARPLIIAGPIGALIAYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRF
KLLA0C02343g       TIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRF
SAKL0C02662g       TIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRF
AFR668W            TIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRF
Ecym_1087          TIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRF
                   ******::.:  *:  :**:* *::::::.:: : * *:**** *:***:::::::: **

KAFR0D03940        LSPAFGVANGYMYWFNWAITFAVEISVVGQVIQYWTDAVPLAAWIAIFWVLVTLMNFFPV
ZYRO0F16654g       LSPAFGAANGYMYWFSWSITFALELSVIGQIVQYWTFKVPVAAWISIFWVLIAGLNFCPV
KLTH0F02398g       LSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTLGVPNAAWIIIFWVPISLSNLVSV
Kwal_33.13401      LSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAAWIAIFWVPITLSNLVPV
CAGL0J08184g       LSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPV
YNL270C            LSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPV
Smik_14.67         LSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTDAVPLVAWIVIFWCLLTLMNMFPV
Suva_14.73         LSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPV
Skud_14.70         LSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTHAVPLAAWIVIFWCLLTLMNMFPV
TDEL0C06180        LSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPV
Kpol_2000.65       ISPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPV
TPHA0B04480        LSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTHAVPLSAWIVIWWVILTIMNLFPV
TBLA0A05450        VSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPV
KAFR0D00700        LSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPV
KNAG0C00790        LSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYAVPLAAWISIFWVVITAGNMFPV
Suva_5.4           LSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPV
Smik_5.24          LSPAFGAANGYMYWFSWAITFALELSVVGQVIEFWTNKVPLAAWISIFWVIITIMNLFPV
Skud_5.26          LSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPV
YEL063C            LSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPV
NDAI0A00610        LSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAMNMFPV
NCAS0B08570        VSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPV
NDAI0F04200        LSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPV
NCAS0A00600        LSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPV
KLLA0C02343g       ISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPV
SAKL0C02662g       LSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPV
AFR668W            VSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPV
Ecym_1087          LSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPV
                   :* ..* : **:* :.*..*:*:*:*::* :: :*:  **  .*: : *  :   *: .*

KAFR0D03940        KVYGEVEFWVAFMKVIAIVGYLLYALIIVCGGSKKQGPIGFRYWRNPGAWGNGLTSDGEP
ZYRO0F16654g       KFYGEFEFWIAFIKVVAIVGFIIYCFIMVCGAGKT-GPVGFRYWRHGYAFGDGI------
KLTH0F02398g       KFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKT-GPVGFRYWRNPGPWGDGI------
Kwal_33.13401      KFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKT-GPVGFRYWRNPGPWGDGI------
CAGL0J08184g       KFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKT-GPIGFRYWRNPGAMGPGI------
YNL270C            KYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGI------
Smik_14.67         KYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGPIGFRYWRNPGAWGPGI------
Suva_14.73         KYYGEFEFCIASIKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGI------
Skud_14.70         KYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIGFRYWRNPGAWGPGI------
TDEL0C06180        KYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT-GPVGFRYWRNPGAWGPGI------
Kpol_2000.65       KFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVT-GPVGFRYWRNPGPWGPGI------
TPHA0B04480        KFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVT-GPVGFRYWRNPGPWGPGI------
TBLA0A05450        KVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGIT-GPVGFRYWRHPGPWGPGI------
KAFR0D00700        KFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVT-GPVGFRYWRNPGPWGDGLTSNGVE
KNAG0C00790        KYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVT-GPVGFRYWRNPGPWGPGI------
Suva_5.4           KYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT-GPVGFRYWRNPGAWGPGI------
Smik_5.24          KYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVT-GPVGFRYWRNPGAWGPGI------
Skud_5.26          KYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT-GPVGFRYWRNPGAWGPGI------
YEL063C            KYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVT-GPVGFRYWRNPGAWGPGI------
NDAI0A00610        RFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT-GPVGFRYWRNPGPMGPGI------
NCAS0B08570        KYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVT-GPVGFRYWRHPGAFGPGI------
NDAI0F04200        RIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKT-GPVGFRYWRNPGPWGTGI------
NCAS0A00600        RIYGEIEFWIASVKVLAILGFIIYGICIICGAGVT-GPVGFRYWKNPGPWGMGI------
KLLA0C02343g       KWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPE-GPIGFRYWRKPGPWGNGI------
SAKL0C02662g       KYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKT-GPVGFRYWRNPGPWGPGI------
AFR668W            KFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKL-GRIGFRYWKDPGPWGVGI------
Ecym_1087          RFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSE-GALGFRYWKNPGPWGMGM------
                   . ***.:* :* :** ::. ::.: : ::**..   * :*****.   . * *:      

KAFR0D03940        IYSSKYEGRFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYI
ZYRO0F16654g       ISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPKSIKRTLWRILIFYI
KLTH0F02398g       ISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPKAIRKVFLRILLFYV
Kwal_33.13401      ISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVFFRILLFYV
CAGL0J08184g       ISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYI
YNL270C            ISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYI
Smik_14.67         ISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAVPRAIKKVVVRILVFYI
Suva_14.73         ISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYI
Skud_14.70         ISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVIRILVFYI
TDEL0C06180        ISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILVFYY
Kpol_2000.65       ISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVSFRILIFYI
TPHA0B04480        ISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVTFRILIFYI
TBLA0A05450        ISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRILLFYI
KAFR0D00700        ISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYI
KNAG0C00790        ISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAVPRAIKKVVFRILFFYI
Suva_5.4           ISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYI
Smik_5.24          ISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYI
Skud_5.26          ISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYI
YEL063C            ISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYI
NDAI0A00610        IAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYI
NCAS0B08570        IAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILFFYI
NDAI0F04200        ISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYI
NCAS0A00600        ISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYI
KLLA0C02343g       IAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYI
SAKL0C02662g       ISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYI
AFR668W            VSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYI
Ecym_1087          ISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYI
                   :  .   ..*:**  **:..***:*******::***  :**.::*.:*. .  **: ** 

KAFR0D03940        MSLFFIGLLVPFTDSRLSDDT--TVIASSPFVISIENAGTKILPDIFNAIVMVTVLSAAN
ZYRO0F16654g       FSLLFVGLLVPFNDHGLQDSR--SYAASSPFILAIKNSGTKALPDIFNAVILTTVISAAN
KLTH0F02398g       GSLFFIGLLVPFNDPKLDSTA--NYSASSPFIIAIQNSGTRALPDIFNAVILTTIISAAN
Kwal_33.13401      GSLFFIGLLVPFNDEKLTSSD--SYSAGSPFIIAIQNSGTKILPDIFNAVILATIISAAN
CAGL0J08184g       GSLFFIGLTVPYNDPKLTSTD--SYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGN
YNL270C            LSLFFIGLLVPYNDPKLDSDG--IFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGN
Smik_14.67         LSLFFIGLLVPYNDPKLDSEG--TFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGN
Suva_14.73         MSLFFIGLLVPYNDPKLDSDG--SFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGN
Skud_14.70         LSLFFIGLLVPYNDPKLDSDG--TFVSASPFMISIENSGTKVLPDIFNAVVLITIFSAGN
TDEL0C06180        PIAVFIGLLVPYNDPKLNSSD--SYVSSSPFIIAIENSGTKVLPHIFNAVVLTTIISAGN
Kpol_2000.65       LSLFFIGLLVPFDDPKLSSDD--SYVSSSPFIIAIQNSGTKVLPHIFNAVILSTIISAGN
TPHA0B04480        LSLFFIGLLVPYDDEKLTSTD--SYISASPFIIAIENSGTKILPHIFNAVILSTIISAGN
TBLA0A05450        LSLFFIGLLVPYNDPKLSSTD--SYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAAN
KAFR0D00700        GSLFFIGLLVPFDDPKLSSDD--SYVSSSPFIIAIENSGTKILPDIFNAIILITIISAGN
KNAG0C00790        GSLFFIGLLVPYNDDALNNTD--SYVASSPFIIAIKNSGTPVLPHIFNAVIACTIVSAGN
Suva_5.4           GSLLFIGLLVPYNDPKLTSAT--SYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAAN
Smik_5.24          GSLLFIGLLVPYNDPKLTTAT--SYVSVSPFIIAIENSGTKVLPHIFNAVILTTIISAAN
Skud_5.26          GSLLFIGLLVPYNDPKLTEAT--SYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAAN
YEL063C            GSLLFIGLLVPYNDPKLTQST--SYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAAN
NDAI0A00610        GSLFFIGLLVPYNDPKLTSDD--SYVAASPFIISIQNSGTPILPHIFNAVILSTIISAAN
NCAS0B08570        LSLFFIGLLVPYDDWKLTSTD--SYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGN
NDAI0F04200        LSLFFIGLLVPYDDVKLKSEN--SYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGN
NCAS0A00600        GSLLVIGLLVPYNDPKLQSND--SYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGN
KLLA0C02343g       GSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGN
SAKL0C02662g       LSLLFIGLLVPFNDPKLKSED--SYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGN
AFR668W            GSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGN
Ecym_1087          LSLFFVGLLVPYTDPRLSTTSD-SDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGN
                      ..:** * : *  *           ***:::*  . *  ** ::*.::  *:.**.*

KAFR0D03940        SNVYVGSRVLYSLAHTKVAPKIFARVTRQGVPFMGVICTSLLGLLAFLVVDNNANTAFNW
ZYRO0F16654g       SDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSAIGALAYLETSSSGANVFNW
KLTH0F02398g       SNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYLSVSSGSAKAFDW
Kwal_33.13401      SNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFDW
CAGL0J08184g       SNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNW
YNL270C            SNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNW
Smik_14.67         SNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFLAFLETSAGSGKVFNW
Suva_14.73         SNVYIGSRVLYSLSKNDLAPRFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNW
Skud_14.70         SNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFLETSAGSGKAFNW
TDEL0C06180        SNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYMELSTGGASAFNW
Kpol_2000.65       SNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNW
TPHA0B04480        SNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGALAFLEVSSGGAKAFNW
TBLA0A05450        SNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNW
KAFR0D00700        SNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDW
KNAG0C00790        SNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGALAYMETSTGGQNAFNW
Suva_5.4           SNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAW
Smik_5.24          SNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVFGALAYMETSTGGDKVFEW
Skud_5.26          SNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEW
YEL063C            SNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEW
NDAI0A00610        SNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNW
NCAS0B08570        SNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNW
NDAI0F04200        SNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQW
NCAS0A00600        SNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTW
KLLA0C02343g       SNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDW
SAKL0C02662g       SNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNW
AFR668W            SNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDW
Ecym_1087          SNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDW
                   *::*:***: :.:.    .*  :      *:*   *   . .* *.::     .  .* *

KAFR0D03940        LVDISTLAGLCAWLFISLAHVRFMQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIF
ZYRO0F16654g       LMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKASFMPWIAIYSFFFMTLIIL
KLTH0F02398g       LLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGAYYAAFFILLIII
Kwal_33.13401      LLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLIII
CAGL0J08184g       LLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIIL
YNL270C            LLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVL
Smik_14.67         LLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMPFLAYYASFFIALIVL
Suva_14.73         LLNITGVAGFFAWLLISFSHIRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVL
Skud_14.70         LLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLAYYASFFIALIVL
TDEL0C06180        LLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLAYYALFFMVVIIL
Kpol_2000.65       LLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYAIFFMIIIII
TPHA0B04480        LLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFMPHLAYYSIFFMTIIII
TBLA0A05450        LLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIIL
KAFR0D00700        LVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIII
KNAG0C00790        LLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMPGLAYYASFLMFVIII
Suva_5.4           LLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIIL
Smik_5.24          LLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKAKLMPGLAYFAATFMIIIIL
Skud_5.26          LLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMIIIII
YEL063C            LLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIII
NDAI0A00610        LLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIII
NCAS0B08570        LLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIII
NDAI0F04200        LLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIF
NCAS0A00600        LLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIV
KLLA0C02343g       LLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPYAAYYAAFFITVIII
SAKL0C02662g       LLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIII
AFR668W            LLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIIL
Ecym_1087          LLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIIL
                   *: :  ::*: :*  *  .*:**:: :  .*:**::**:.*  **  : :.   : :*:.

KAFR0D03940        VQGFQAFSPHFDVTTFFTDYISLILLAVVFIGAQLYYRCRFLWKLEDVDIDSDRREIEDA
ZYRO0F16654g       VQGFTCFTPHFQASDFVASYISVGLFFVIWAVFQIWFRCPLLVPIAEIDIDTDRRDVDAE
KLTH0F02398g       IQGFTAFAPKFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRLIHKVEDVDIDSDRREIEAE
Kwal_33.13401      IQGFTSLAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDSDRREVDAQ
CAGL0J08184g       IQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESV
YNL270C            IQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRRQIEEL
Smik_14.67         IQGFTAFAPTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWKLQDVDIDSDRRDIEEQ
Suva_14.73         IQGFTAFAPSFQPVDFVAAYISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQ
Skud_14.70         IQGFTAFAPTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDIDIDSDRREIEEQ
TDEL0C06180        IQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLDEVDIDTDRRDIEAV
Kpol_2000.65       IQGFTAFAPTFNGSDFVAAYISVFLFFFLWVSFQLYFRCKLYWSLDEVDIDTDRRDIDAI
TPHA0B04480        IQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWTVEEVDIDTDRRDVDAI
TBLA0A05450        IQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLDDVDIDTDRRDIDTV
KAFR0D00700        FQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKI
KNAG0C00790        IQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHKVEDVDIDTDRRDIEAV
Suva_5.4           IQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAI
Smik_5.24          IQGFTAFAPKFDGIDFLAAYISIFLFLAIWILFEIIFRCRFIWKIEDVDIDSDRRDIEAI
Skud_5.26          IQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAI
YEL063C            IQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDVDIDSDRRDIEAI
NDAI0A00610        IQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRRDIEEV
NCAS0B08570        IQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEA
NDAI0F04200        FQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVDIDIDKDRREIEDR
NCAS0A00600        IQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEE
KLLA0C02343g       IQGFTAFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLDEVDIDSDRRDIDVI
SAKL0C02662g       IQGFTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDV
AFR668W            VQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVDEIDIDTDRRDIDAI
Ecym_1087          IQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDAL
                   .*** .: * :    * : *:*  ::   :   :  :.         :*:*.:** ::  

KAFR0D03940        IW-EDDEPKTI--WDKFWAAIA
ZYRO0F16654g       VW-EDEPPKTL--WDKFWNIVA
KLTH0F02398g       VW-EDDEPTNL--WGKFWAAMA
Kwal_33.13401      QW-DNTEPTTL--WGKFWAAMA
CAGL0J08184g       VW-EDDAPKTL--WDKFWDFVA
YNL270C            VW-IEPECKTR--WQRVWDVLS
Smik_14.67         VW-IEPECKTR--WQHVWDILS
Suva_14.73         VW-IEPLRKTK--WQCVWDVLA
Skud_14.70         VW-IEPECKTR--WQRVWDILS
TDEL0C06180        VW-DDEPPKTL--WDKFWNIVA
Kpol_2000.65       IW-EDSAPKTF--WDRFWDVVA
TPHA0B04480        IW-EDSGPKTF--WDKFWDVVA
TBLA0A05450        IW-EE-GPQTF--WDKFWAVIA
KAFR0D00700        IW-EDPEPKTF--WDKFWNVVA
KNAG0C00790        VW-EDAEPKTV--WDKFWNIIA
Suva_5.4           VW-EEPEPKTL--WDKFWNVVG
Smik_5.24          VW-EDHEPKTF--WDKFWNVVA
Skud_5.26          VW-EDHEPKTF--WDKFWNVVA
YEL063C            VW-EDHEPKTF--WDKFWNVVA
NDAI0A00610        VW-EDPPPVTF--WDKFWNVVA
NCAS0B08570        VW-IEQEPRGF--WDKFWNVVA
NDAI0F04200        VW-QDTTPANL--WGKFWDFVA
NCAS0A00600        VWSDDVEDKNKNWWDRFWNYVA
KLLA0C02343g       IW-EEEEPKNL--WEKFWAVAA
SAKL0C02662g       VW-EEQKPRNL--WEKFWAAIA
AFR668W            IW-DDDKPTTL--WGKIWYHLS
Ecym_1087          VWSDDDEPKTL--LQKLWQSFS
                    *  :           .*   .

FASTA FORMAT for MUSCLE Version 3.6

>KAFR0D03940
----MPILRNIIRSKRNEDSTESNDDSTT-----------SYDNFEIIEIQHNDS-----
KDNSIKKKIPNSELASLTHAYSRSRVEPEHDEDAEEADYEDKQVKRELKQRHIGMIALGG
TIGTGLFVGIATPLADAGPVGALIAYIFMGSIVYFVTQALGEMATFIPVTSSITVFSQRF
LSPAFGVANGYMYWFNWAITFAVEISVVGQVIQYWTDAVPLAAWIAIFWVLVTLMNFFPV
KVYGEVEFWVAFMKVIAIVGYLLYALIIVCGGSKKQGPIGFRYWRNPGAWGNGLTSDGEP
IYSSKYEGRFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYI
MSLFFIGLLVPFTDSRLSDDT--TVIASSPFVISIENAGTKILPDIFNAIVMVTVLSAAN
SNVYVGSRVLYSLAHTKVAPKIFARVTRQGVPFMGVICTSLLGLLAFLVVDNNANTAFNW
LVDISTLAGLCAWLFISLAHVRFMQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIF
VQGFQAFSPHFDVTTFFTDYISLILLAVVFIGAQLYYRCRFLWKLEDVDIDSDRREIEDA
IW-EDDEPKTI--WDKFWAAIA
>ZYRO0F16654g
-------------MDYKGPLEFNQHELD------------SSKENTDKPSLNETY-----
VKEYDRSISSPPKENDGYGYRVDNEYDVDDSVDGEKGEVRSTEVKRALKPRHIGMIALGG
TIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSVMQSLGEMATYIPVTSAFSVFSQRF
LSPAFGAANGYMYWFSWSITFALELSVIGQIVQYWTFKVPVAAWISIFWVLIAGLNFCPV
KFYGEFEFWIAFIKVVAIVGFIIYCFIMVCGAGKT-GPVGFRYWRHGYAFGDGI------
ISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPKSIKRTLWRILIFYI
FSLLFVGLLVPFNDHGLQDSR--SYAASSPFILAIKNSGTKALPDIFNAVILTTVISAAN
SDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSAIGALAYLETSSSGANVFNW
LMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKASFMPWIAIYSFFFMTLIIL
VQGFTCFTPHFQASDFVASYISVGLFFVIWAVFQIWFRCPLLVPIAEIDIDTDRRDVDAE
VW-EDEPPKTL--WDKFWNIVA
>KLTH0F02398g
--------------------------------------------MEMQSFEKQPQ-----
LHKNEIKVMEEGESSSLADGVLEQQSQIDTASSQERG------IQRALKPRHVSMIALGG
TIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMATFIPVASSFTVFTRRF
LSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTLGVPNAAWIIIFWVPISLSNLVSV
KFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKT-GPVGFRYWRNPGPWGDGI------
ISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPKAIRKVFLRILLFYV
GSLFFIGLLVPFNDPKLDSTA--NYSASSPFIIAIQNSGTRALPDIFNAVILTTIISAAN
SNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYLSVSSGSAKAFDW
LLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGAYYAAFFILLIII
IQGFTAFAPKFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRLIHKVEDVDIDSDRREIEAE
VW-EDDEPTNL--WGKFWAAMA
>Kwal_33.13401
----------------------------------------------MLKTSEKEG-----
MSQKTETRLEDYEMGSFAEEALDQEAQSSQDSQLGSSGHGRNAVQRQLKPRHVSMIALGG
TIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMATFIPVTSSFTVFTRRF
LSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAAWIAIFWVPITLSNLVPV
KFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKT-GPVGFRYWRNPGPWGDGI------
ISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVFFRILLFYV
GSLFFIGLLVPFNDEKLTSSD--SYSAGSPFIIAIQNSGTKILPDIFNAVILATIISAAN
SNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFDW
LLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLIII
IQGFTSLAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDSDRREVDAQ
QW-DNTEPTTL--WGKFWAAMA
>CAGL0J08184g
--------------MEIGPSD-------------------LKEKSVIQDIDTIID-----
GNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHIGMIALGG
TIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRF
LSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPV
KFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKT-GPIGFRYWRNPGAMGPGI------
ISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYI
GSLFFIGLTVPYNDPKLTSTD--SYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGN
SNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNW
LLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIIL
IQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESV
VW-EDDAPKTL--WDKFWDFVA
>YNL270C
---------------MDETVNI------------------QMSKEGQYEINSSSI-----
IKEEEFVDEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHIGMIALGG
TIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRF
LSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPV
KYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGI------
ISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYI
LSLFFIGLLVPYNDPKLDSDG--IFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGN
SNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNW
LLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVL
IQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRRQIEEL
VW-IEPECKTR--WQRVWDVLS
>Smik_14.67
---------------MNESVDM------------------RMSKVSQYEINSIST-----
IKEEELICARYDGQDTEEAVAGKSSINNDSAKETETSPRKGGEVKRKLKQRHIGMIALGG
TIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRF
LSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTDAVPLVAWIVIFWCLLTLMNMFPV
KYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGPIGFRYWRNPGAWGPGI------
ISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAVPRAIKKVVVRILVFYI
LSLFFIGLLVPYNDPKLDSEG--TFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGN
SNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFLAFLETSAGSGKVFNW
LLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMPFLAYYASFFIALIVL
IQGFTAFAPTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWKLQDVDIDSDRRDIEEQ
VW-IEPECKTR--WQHVWDILS
>Suva_14.73
------------------------------------------------------------
------------------------------------------------------MIALGG
TIGTGLIIGIGPPLAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRF
LSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPV
KYYGEFEFCIASIKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGI------
ISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYI
MSLFFIGLLVPYNDPKLDSDG--SFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGN
SNVYIGSRVLYSLSKNDLAPRFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNW
LLNITGVAGFFAWLLISFSHIRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVL
IQGFTAFAPSFQPVDFVAAYISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQ
VW-IEPLRKTK--WQCVWDVLA
>Skud_14.70
---------------MNENVDI------------------CTSKEGKREANSAPT-----
IKEKELVDAQYEEQDTSAAIAANSSIENDGAKGTETSPRSRGEVQRKLKERHIGMIALGG
TIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRF
LSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTHAVPLAAWIVIFWCLLTLMNMFPV
KYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIGFRYWRNPGAWGPGI------
ISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVIRILVFYI
LSLFFIGLLVPYNDPKLDSDG--TFVSASPFMISIENSGTKVLPDIFNAVVLITIFSAGN
SNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFLETSAGSGKAFNW
LLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLAYYASFFIALIVL
IQGFTAFAPTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDIDIDSDRREIEEQ
VW-IEPECKTR--WQRVWDILS
>TDEL0C06180
--------------MWNAKQDVSEEGYELGNF--------SGMNDEDSSSGQAGA-----
INHRKKSVVSKTTAVDESLPGLSSSDLESSDDFVKEGQVHEAEVKRALKQRHIGMIALGG
TIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYSVVQSLGEMATFIPVTSAFTVFSSRF
LSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPV
KYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGIT-GPVGFRYWRNPGAWGPGI------
ISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILVFYY
PIAVFIGLLVPYNDPKLNSSD--SYVSSSPFIIAIENSGTKVLPHIFNAVVLTTIISAGN
SNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGALAYMELSTGGASAFNW
LLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMPWLAYYALFFMVVIIL
IQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRLDEVDIDTDRRDIEAV
VW-DDEPPKTL--WDKFWNIVA
>Kpol_2000.65
MGQQNDELTQYELQSFNSSSSNGVNKTYNY----------ITADAELKKLKKKEY-----
ETGSSSIVVDGSSRHLHGSHGSHSVSGDEDEPYVDQGVVQDAEVKRELKQRHIGMIALGG
TIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFSSRF
ISPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPV
KFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVT-GPVGFRYWRNPGPWGPGI------
ISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVSFRILIFYI
LSLFFIGLLVPFDDPKLSSDD--SYVSSSPFIIAIQNSGTKVLPHIFNAVILSTIISAGN
SNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNW
LLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYAIFFMIIIII
IQGFTAFAPTFNGSDFVAAYISVFLFFFLWVSFQLYFRCKLYWSLDEVDIDTDRRDIDAI
IW-EDSAPKTF--WDRFWDVVA
>TPHA0B04480
--MSQKDLSQYELQSYTSNNRSSASEMNKGSDAKEKVDVISSSGSLSKRKRINRS-----
RANSNSDLEGSAADGTARARDIDNADVDDDDYYMDEGVVKEAEVKRQLKQRHIGMIALGG
TIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFSSRF
LSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTHAVPLSAWIVIWWVILTIMNLFPV
KFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVT-GPVGFRYWRNPGPWGPGI------
ISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVTFRILIFYI
LSLFFIGLLVPYDDEKLTSTD--SYISASPFIIAIENSGTKILPHIFNAVILSTIISAGN
SNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGALAFLEVSSGGAKAFNW
LLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFMPHLAYYSIFFMTIIII
IQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWTVEEVDIDTDRRDVDAI
IW-EDSGPKTF--WDKFWDVVA
>TBLA0A05450
--MDNKDNASIELHSYHESLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYA
KSDEDATLTKASKRHVRASSVSTASSSIAEEDIDATGVVEEAQVKRELKPRHIGMIALGG
TIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRF
VSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPV
KVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGIT-GPVGFRYWRHPGPWGPGI------
ISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRILLFYI
LSLFFIGLLVPYNDPKLSSTD--SYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAAN
SNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNW
LLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIIL
IQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLDDVDIDTDRRDIDTV
IW-EE-GPQTF--WDKFWAVIA
>KAFR0D00700
----------------------MDT---------------LESSSQSVPRQRKSG-----
VQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHIGMIALGG
TIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRF
LSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVPIAAWISIFWVILTALNMFPV
KFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVT-GPVGFRYWRNPGPWGDGLTSNGVE
ISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYI
GSLFFIGLLVPFDDPKLSSDD--SYVSSSPFIIAIENSGTKILPDIFNAIILITIISAGN
SNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDW
LVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMVIIII
FQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEKI
IW-EDPEPKTF--WDKFWNVVA
>KNAG0C00790
-------------MEFSEKPGASVGSSPD-----------MRHRKKAEEMRETKL-----
AAVTSYTSLGESRADIRHRMSFES--GEDGESEEQTGYVHDAEVKRELKQRHIGMIALGA
TIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQSLGEMATFIPVTSSFTVFAQRF
LSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYAVPLAAWISIFWVVITAGNMFPV
KYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVT-GPVGFRYWRNPGPWGPGI------
ISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAVPRAIKKVVFRILFFYI
GSLFFIGLLVPYNDDALNNTD--SYVASSPFIIAIKNSGTPVLPHIFNAVIACTIVSAGN
SNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGALAYMETSTGGQNAFNW
LLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMPGLAYYASFLMFVIII
IQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHKVEDVDIDTDRRDIEAV
VW-EDAEPKTV--WDKFWNIIA
>Suva_5.4
MTTPKQDSEVEEKHMYTEPAGTFFH---------------DVEASQTHHRRGSLS-----
LKDEKSKELYPLRSFPNGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHIGMIALGG
TIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRF
LSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPV
KYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT-GPVGFRYWRNPGAWGPGI------
ISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYI
GSLLFIGLLVPYNDPKLTSAT--SYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAAN
SNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAW
LLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIIL
IQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAI
VW-EEPEPKTL--WDKFWNVVG
>Smik_5.24
MTDPKQNTEIEEKHMYNEPVTTLFH---------------DVEASQTHRRRGSLP-----
LKDEKNKELYPLHSFSTRVDGEDTFSMGDVIRDEDQGEVRNAEVKRELKQRHIGMIALGG
TIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRF
LSPAFGAANGYMYWFSWAITFALELSVVGQVIEFWTNKVPLAAWISIFWVIITIMNLFPV
KYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVT-GPVGFRYWRNPGAWGPGI------
ISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYI
GSLLFIGLLVPYNDPKLTTAT--SYVSVSPFIIAIENSGTKVLPHIFNAVILTTIISAAN
SNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVFGALAYMETSTGGDKVFEW
LLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKAKLMPGLAYFAATFMIIIIL
IQGFTAFAPKFDGIDFLAAYISIFLFLAIWILFEIIFRCRFIWKIEDVDIDSDRRDIEAI
VW-EDHEPKTF--WDKFWNVVA
>Skud_5.26
MTNPKQEAEIEEKHMYNEPVTTLLH---------------DVEASQTHRRRGSLS-----
LKDEKSKELYPLRSFPTGVNGQDTFSMEENLQDEDEGEVQNAEVKRELKQRHIGMIALGG
TIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRF
LSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPV
KYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVT-GPVGFRYWRNPGAWGPGI------
ISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYI
GSLLFIGLLVPYNDPKLTEAT--SYVSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAAN
SNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEW
LLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMIIIII
IQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRDIEAI
VW-EDHEPKTF--WDKFWNVVA
>YEL063C
MTNSKEDADIEEKHMYNEPVTTLFH---------------DVEASQTHHRRGSIP-----
LKDEKSKELYPLRSFPTRVNGEDTFSMEDGIGDEDEGEVQNAEVKRELKQRHIGMIALGG
TIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRF
LSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPV
KYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVT-GPVGFRYWRNPGAWGPGI------
ISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYI
GSLLFIGLLVPYNDPKLTQST--SYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAAN
SNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEW
LLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIII
IQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDVDIDSDRRDIEAI
VW-EDHEPKTF--WDKFWNVVA
>NDAI0A00610
----------------------------------------MDKKQEEPLKNGKIK-----
SSSYELDDYPLHRRTNSVHSIPSQITIESQEEEIANGQIREAEVKRELKQRHIGMIALGG
TIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFIPVTSSFTVFSQRF
LSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWISIFWVLLVAMNMFPV
RFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVT-GPVGFRYWRNPGPMGPGI------
IAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYI
GSLFFIGLLVPYNDPKLTSDD--SYVAASPFIISIQNSGTPILPHIFNAVILSTIISAAN
SNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNW
LLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIII
IQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRRDIEEV
VW-EDPPPVTF--WDKFWNVVA
>NCAS0B08570
------------------------------------------------------------
-----------------MLGGHNQDSKMKEEIREISVEVEAETVRRELKQRHMGMIALGG
TIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRF
VSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPV
KYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVT-GPVGFRYWRHPGAFGPGI------
IAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILFFYI
LSLFFIGLLVPYDDWKLTSTD--SYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGN
SNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNW
LLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIII
IQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEEA
VW-IEQEPRGF--WDKFWNVVA
>NDAI0F04200
------------------------------------MSILDINTEETLEGKSKIV-----
IKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDE---YHEVKRDLSKRHIAMIALGG
TIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRF
LSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLPAWISIFWVILTISNLFPV
RIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKT-GPVGFRYWRNPGPWGTGI------
ISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYI
LSLFFIGLLVPYDDVKLKSEN--SYVSSSPFIIAIENSGTKILPHIFNGVILVTIISAGN
SNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQW
LLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIF
FQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVDIDIDKDRREIEDR
VW-QDTTPANL--WGKFWDFVA
>NCAS0A00600
------------------------------------------------------------
---------MKLNQPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMIALGG
TIGTGLFLGIARPLIIAGPIGALIAYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRF
LSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPV
RIYGEIEFWIASVKVLAILGFIIYGICIICGAGVT-GPVGFRYWKNPGPWGMGI------
ISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYI
GSLLVIGLLVPYNDPKLQSND--SYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGN
SNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTW
LLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIV
IQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEE
VWSDDVEDKNKNWWDRFWNYVA
>KLLA0C02343g
--------------MTSIAQQIELEELE------------ALHSNLSQSQSARSG-----
MHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGG
TIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRF
ISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPV
KWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPE-GPIGFRYWRKPGPWGNGI------
IAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYI
GSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGN
SNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDW
LLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPYAAYYAAFFITVIII
IQGFTAFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLDEVDIDSDRRDIDVI
IW-EEEEPKNL--WEKFWAVAA
>SAKL0C02662g
------------------------------------------------------------
--MSLSKDYEATREKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGG
TIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRF
LSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPV
KYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKT-GPVGFRYWRNPGPWGPGI------
ISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYI
LSLLFIGLLVPFNDPKLKSED--SYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGN
SNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNW
LLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIII
IQGFTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDV
VW-EEQKPRNL--WEKFWAAIA
>AFR668W
------------------------------------------MTNIIYEPKGDGS-----
SSSTITAKPGAIKAEVLNHNTSEVESLCEKPN--------QSDVKRELKPRHVTMISLGG
TIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTVFASRF
VSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPV
KFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKL-GRIGFRYWKDPGPWGVGI------
VSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYI
GSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDIMNGVIMVTIISAGN
SNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDW
LLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIIL
VQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVDEIDIDTDRRDIDAI
IW-DDDKPTTL--WGKIWYHLS
>Ecym_1087
----------------------MVENVE------------LETYPAGKQHNDRSA-----
ESSESSDVLHHRKETKNEGIFINQENMSEVESLYGND---DPDVKRDLKPRHMSMISLGG
TIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRF
LSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPV
RFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSE-GALGFRYWKNPGPWGMGM------
ISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYI
LSLFFVGLLVPYTDPRLSTTSD-SDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGN
SNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDW
LLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIIL
IQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDAL
VWSDDDEPKTL--LQKLWQSFS