MUSCLE (3.8) multiple sequence alignment

KLTH0F01606g       MKGFEMKNIKSPEDGVVESFDSV---EVVKETSPRSEGSRDGL-----------------
Kwal_33.13215      MKDFELHNMKSPDNGVVESFDSV---EVLKEESPRSDSRSDGL-----------------
TBLA0A05190        --MQTPKDYEITSEHEVEYFDQPSLHNRSTHHSSKDATNVQFAPGDSDNDDSDNESTNNN
KAFR0D00520        --MSSLSPSITKDGLHLSVNKNV----IVTNENQINESHSKLIE----------------
KAFR0D04120        --MSSSSNQKDSDRISFSTESKYEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSD
                               .   ..  ..       .  .  .    .                   

KLTH0F01606g       ---------------------FHRFVDSFKRPEEEY--------------------NGGD
Kwal_33.13215      ---------------------FRRFADSFRRHEAHNG-------------------GGGD
TBLA0A05190        QSSSPHGASKFLP--QVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLE
KAFR0D00520        --------------------NLKDFVDSFKKIDDNN--------------------NQYE
KAFR0D04120        SDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTN------------RDIENELT
                                        :.   ***.. :                       .   

KLTH0F01606g       GIHSTHERVSGEDF-------ERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVG
Kwal_33.13215      GDDEDHEGLT--------------PIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVG
TBLA0A05190        NKKSNLH-IRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSLGTGIGTGLLVG
KAFR0D00520        IEKNEINNIKSDQF-------------NDKLNNQLQKTIQPRHVIMISLGTGIGTGLLVG
KAFR0D04120        TTLSPLSATKDPQF----------APHAEEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVG
                      .                         .    *::.*.****:::**.******:***

KLTH0F01606g       NGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFS
Kwal_33.13215      NGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFS
TBLA0A05190        NGTPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFA
KAFR0D00520        NGATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFA
KAFR0D04120        NGSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFS
                   ** .* :.**. *:*** *:.: :**:**:..*:*: *  : *.** :*::*** .: *:

KLTH0F01606g       VSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAFVVIFYVVLIVINFI-GAAGYAEAE
Kwal_33.13215      VSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINFV-GAAGYAEAE
TBLA0A05190        VAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDVFVVIFYVLILLINFF-GAKGYAEAE
KAFR0D00520        VAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAE
KAFR0D04120        VAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADVFVVIFYVLIIFINVF-GAKGYAEAE
                   *:****:****: ******:****:**. .::.*.**.***:::: **.. ** ******

KLTH0F01606g       FFFNTCKVLMLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLV
Kwal_33.13215      FFFNCCKVLMIIGFFILGIIINCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLV
TBLA0A05190        FFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDTFV
KAFR0D00520        FFFNLCKILMIAGFFILGIILICGGAGTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLV
KAFR0D04120        FFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSTFT
                   **** **::*: ****:.* :  *.**..**:*  **::******     ***.:: .:.

KLTH0F01606g       NAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL
Kwal_33.13215      NAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELL
TBLA0A05190        TAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLM
KAFR0D00520        TAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELL
KAFR0D04120        TAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM
                   .***::* :** .: *:**.**..:* **:*.: ** : *:: :  ::*****:** :*:

KLTH0F01606g       GSGSAATHASPFVIAIASHGVKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFA
Kwal_33.13215      GSGGSATHASPFVIAVASHGVRVVPHFINAVILLSVLSVANSALYSSSRILLSLSEQGFA
TBLA0A05190        GSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYA
KAFR0D00520        GSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYA
KAFR0D04120        GSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYA
                   ** .. . ***:*:* : **:.:. *:******:********::***.*:*  *:: *:*

KLTH0F01606g       PKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLS
Kwal_33.13215      PRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLS
TBLA0A05190        PKWFDYVDRNGRPLRSMLCAAIIAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVS
KAFR0D00520        PKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLS
KAFR0D04120        PSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVS
                   *  : *:** ***   :: :.::. :.* * *.**  **:*********::*** :*.:*

KLTH0F01606g       HVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMILLILIGQFWVAISPVGSNKLDANN
Kwal_33.13215      HVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANN
TBLA0A05190        HIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAEN
KAFR0D00520        HIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITN
KAFR0D04120        HIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQN
                   *:*:**.* :**** .*:*: :..** *: **  ::   *:.:***:: *:.    :  *

KLTH0F01606g       FFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLR
Kwal_33.13215      FFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLR
TBLA0A05190        FFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLR
KAFR0D00520        FFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLK
KAFR0D04120        FFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGELIKQEEEEFKERLR
                   **::*******: :*.*:*   .*:.::* :.::**::** *:* :::. *. : **.*.

KLTH0F01606g       HASWTKRAAEFWC
Kwal_33.13215      HAPWTTRLANFWC
TBLA0A05190        NGPKWKRVVDFWC
KAFR0D00520        NGSLWLKIYAFWC
KAFR0D04120        NGPFWKKVVAFWC
                   :..   .   ***

FASTA FORMAT for MUSCLE Version 3.6

>KLTH0F01606g
MKGFEMKNIKSPEDGVVESFDSV---EVVKETSPRSEGSRDGL-----------------
---------------------FHRFVDSFKRPEEEY--------------------NGGD
GIHSTHERVSGEDF-------ERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVG
NGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFS
VSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAFVVIFYVVLIVINFI-GAAGYAEAE
FFFNTCKVLMLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLV
NAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELL
GSGSAATHASPFVIAIASHGVKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFA
PKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLS
HVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMILLILIGQFWVAISPVGSNKLDANN
FFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLR
HASWTKRAAEFWC
>Kwal_33.13215
MKDFELHNMKSPDNGVVESFDSV---EVLKEESPRSDSRSDGL-----------------
---------------------FRRFADSFRRHEAHNG-------------------GGGD
GDDEDHEGLT--------------PIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVG
NGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFS
VSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINFV-GAAGYAEAE
FFFNCCKVLMIIGFFILGIIINCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLV
NAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELL
GSGGSATHASPFVIAVASHGVRVVPHFINAVILLSVLSVANSALYSSSRILLSLSEQGFA
PRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLS
HVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANN
FFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLR
HAPWTTRLANFWC
>TBLA0A05190
--MQTPKDYEITSEHEVEYFDQPSLHNRSTHHSSKDATNVQFAPGDSDNDDSDNESTNNN
QSSSPHGASKFLP--QVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLE
NKKSNLH-IRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSLGTGIGTGLLVG
NGTPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFA
VAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDVFVVIFYVLILLINFF-GAKGYAEAE
FFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDTFV
TAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLM
GSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYA
PKWFDYVDRNGRPLRSMLCAAIIAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVS
HIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAEN
FFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLR
NGPKWKRVVDFWC
>KAFR0D00520
--MSSLSPSITKDGLHLSVNKNV----IVTNENQINESHSKLIE----------------
--------------------NLKDFVDSFKKIDDNN--------------------NQYE
IEKNEINNIKSDQF-------------NDKLNNQLQKTIQPRHVIMISLGTGIGTGLLVG
NGATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFA
VAWVYCIQWLCVCPLELVTASMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAE
FFFNLCKILMIAGFFILGIILICGGAGTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLV
TAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELL
GSKSSQTKASPYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYA
PKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLS
HIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITN
FFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLK
NGSLWLKIYAFWC
>KAFR0D04120
--MSSSSNQKDSDRISFSTESKYEMKEITKNSDAKSPEQDNIVEYFENTTGIPAAVNDSD
SDFEYNGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTN------------RDIENELT
TTLSPLSATKDPQF----------APHAEEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVG
NGSALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFS
VAWVYCLQWLCVMPLELVTASMTIQYWTTTVNADVFVVIFYVLIIFINVF-GAKGYAEAE
FFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSTFT
TAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELM
GSGSAATKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYA
PSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVS
HIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQN
FFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGELIKQEEEEFKERLR
NGPFWKKVVAFWC