MUSCLE (3.8) multiple sequence alignment

Ecym_5262         MRQSFVILLCLGMIITGCINSIATKYQDKQCVRNCLTDSPELLQQPVLQTVQMFLGEASA
KLLA0C04433g      MRKELVIVTALSLIVTGCINSIATKYQDNQCVRDCDSISPVLFEQPVLQTLQMFIGEISL
SAKL0C07986g      MKQSLVIALSAGLIVTGCINSIASKYQDNQCVRDCDGPRPVLFEQPVLQTLQMFIGESSV
KLTH0E15862g      MGQLFIPVICIGVVVCGGVNSLMTKYQDNQCVRDCQGASPVYFNQPVLQTLQMFIGEMS-
Kwal_27.9830      MSRLYIASICVGVIVFGCVNSLATKYQDNQCVRDCDGDNPIYFNQPVLQTLQMFIGEMA-
                  * .  :   . .::: * :**: :****:****:*    *  ::******:***:** : 

Ecym_5262         LFAFYLLGARPSTS---------VTKFLLQNKNTVLLSIPAVCDICGTTMMHLALTLVPV
KLLA0C04433g      MFVMFWQKYNSRNGYEAVPSAESLNKTKLPSRQSYALALPAICDICGTTLMNLALTMIPV
SAKL0C07986g      FVVLLLRVIAGGGS----PRPRSVEKPPLPGNRVLLLALPAVCDICATTLMNVALTMIPV
KLTH0E15862g      MLALWWFQLRGTGR----QQHEFDNKPLIKGRSYVLLALPAICDIIATTLMNLALVMIPV
Kwal_27.9830      MLAFLRGQQRSKLP----LEQGFRGKPAISLQGYLLLALPAVCDIIATTLMNWALVMIPV
                  :..:                     *  :  .    *::**:*** .**:*: **.::**

Ecym_5262         SIYQMVRGSLVIVVATFSVVFLNKKLTRGEWLSLYTVMFGIGIVGLTGFDD---------
KLLA0C04433g      SIYQMTRGVLILFVALFSVFFLKHKISRFEWLSLFIVVFGVFLVGYSGNVG---------
SAKL0C07986g      SVYQMTRGALIIFVAMFSIVFLGHRISRLEWCSLFVVVLGVTIVGCNGGSGSDGGSGGNN
KLTH0E15862g      SIYQMVRGAIVFFVALFSVLFLGRQVCRLEWAYLATIVAGVAVVGYSGQSA---------
Kwal_27.9830      SIYQMTRGAIVFFVALFSVVFLHRRVTRFEWASLAIIVAGVAVVGYSGQED---------
                  *:***.** :::.** **:.** ..: * **  *  :: *: :** .*            

Ecym_5262         -----WNSDKPAANTLLGITLILVAQLFMAAQYVIEEHLISRYPFDSLEVVGFEGLFGGA
KLLA0C04433g      --------VTVDVSLVTGVLLIVLAQVCTATQFVLEEHIMSKWIIPPSTLVAFEGIYGAS
SAKL0C07986g      SLLSSVATARLSSSLFAGVFLILIAQLFMASQFVIEEHIMSRWTMMPVKLVGFEGVFGGS
KLTH0E15862g      ---DTVSEQSFSSSLLVGVLLILFALLFMATQFIVEEHVMSRWAVSPVGLIGHEGLFGSS
Kwal_27.9830      ---EVLSEEVISTSSVFGISLILVALFFMATQFIVEEHILSRWEINPVGLVGFEGFFGTS
                               . . *: **:.* .  *:*:::***::*.: . .  ::..**.:* :

Ecym_5262         ITLFFLLLGTFTIAWKDPSSPLNLFQGLKDVSYSGNLMVSSFTIMISIAFYNFFGIAITN
KLLA0C04433g      ITLLTMLIASVTFAQNKQNSSFNIVYSLQDMFVNPRVLYSSIIIMISIACFNFFGITLTN
SAKL0C07986g      ITLAVMLLGHLTFASGNPHSPFNVVQAFTDMFASPRVLYSSVAIMFSIACFNFFGISITN
KLTH0E15862g      ITVALLVVGNYMGGYRDVNSTFNMKQAFSDMFARPAVLNSSFVIMVSIALFNFFGVSITK
Kwal_27.9830      ITLAFLLVGNVAGGNRNKNSSFNMKQAFMDMYEHSAVLISSIIIMISIALFNFTGVSITK
                  **:  :::.    .  .  *.:*:  .: *:     :: **. **.*** :** *:::*:

Ecym_5262         HMNATSRSTIDTSRTLLVWLVSLILGWERFSFLQLIGFALSVVGTLIFNGAISFANYQVP
KLLA0C04433g      SMNATVRSTIDTCRTLLVWLVSLSLGWESFKLTQFNGFVLLVLGTLLFNGAITIDKKRLP
SAKL0C07986g      SVNATARSTIDTCRTLMVWCVSLSIGWESFKFGQLFGFVLLILGTLVFNGAIKLRRESLP
KLTH0E15862g      NVSATSRSTVDTCRTLLVWCVSLSLGWESFKFTQLCGFALLVIGTLLFNNAIEIPDKYLP
Kwal_27.9830      HVSATSRSTVDTCRTLLVWCVSLILGWESFKFMQLCGFVLLVLGTLLFNGAIEIPPKYLP
                   :.** ***:**.***:** *** :*** *.: *: **.* ::***:**.** :    :*

Ecym_5262         QRQHDYYG---YEELPN------DRS
KLLA0C04433g      QWLTKDYP-GD-DRIINVIDEEVERF
SAKL0C07986g      RFLAEDYP-QDYERLIDVVDEEVDRF
KLTH0E15862g      SYFLEDKS-GESQRLINTIDEEVERF
Kwal_27.9830      RYFKEDSSEGERQRLIDTIDEEVERF
                      .       : : :      :* 

FASTA FORMAT for MUSCLE Version 3.6

>Ecym_5262
MRQSFVILLCLGMIITGCINSIATKYQDKQCVRNCLTDSPELLQQPVLQTVQMFLGEASA
LFAFYLLGARPSTS---------VTKFLLQNKNTVLLSIPAVCDICGTTMMHLALTLVPV
SIYQMVRGSLVIVVATFSVVFLNKKLTRGEWLSLYTVMFGIGIVGLTGFDD---------
-----WNSDKPAANTLLGITLILVAQLFMAAQYVIEEHLISRYPFDSLEVVGFEGLFGGA
ITLFFLLLGTFTIAWKDPSSPLNLFQGLKDVSYSGNLMVSSFTIMISIAFYNFFGIAITN
HMNATSRSTIDTSRTLLVWLVSLILGWERFSFLQLIGFALSVVGTLIFNGAISFANYQVP
QRQHDYYG---YEELPN------DRS
>KLLA0C04433g
MRKELVIVTALSLIVTGCINSIATKYQDNQCVRDCDSISPVLFEQPVLQTLQMFIGEISL
MFVMFWQKYNSRNGYEAVPSAESLNKTKLPSRQSYALALPAICDICGTTLMNLALTMIPV
SIYQMTRGVLILFVALFSVFFLKHKISRFEWLSLFIVVFGVFLVGYSGNVG---------
--------VTVDVSLVTGVLLIVLAQVCTATQFVLEEHIMSKWIIPPSTLVAFEGIYGAS
ITLLTMLIASVTFAQNKQNSSFNIVYSLQDMFVNPRVLYSSIIIMISIACFNFFGITLTN
SMNATVRSTIDTCRTLLVWLVSLSLGWESFKLTQFNGFVLLVLGTLLFNGAITIDKKRLP
QWLTKDYP-GD-DRIINVIDEEVERF
>SAKL0C07986g
MKQSLVIALSAGLIVTGCINSIASKYQDNQCVRDCDGPRPVLFEQPVLQTLQMFIGESSV
FVVLLLRVIAGGGS----PRPRSVEKPPLPGNRVLLLALPAVCDICATTLMNVALTMIPV
SVYQMTRGALIIFVAMFSIVFLGHRISRLEWCSLFVVVLGVTIVGCNGGSGSDGGSGGNN
SLLSSVATARLSSSLFAGVFLILIAQLFMASQFVIEEHIMSRWTMMPVKLVGFEGVFGGS
ITLAVMLLGHLTFASGNPHSPFNVVQAFTDMFASPRVLYSSVAIMFSIACFNFFGISITN
SVNATARSTIDTCRTLMVWCVSLSIGWESFKFGQLFGFVLLILGTLVFNGAIKLRRESLP
RFLAEDYP-QDYERLIDVVDEEVDRF
>KLTH0E15862g
MGQLFIPVICIGVVVCGGVNSLMTKYQDNQCVRDCQGASPVYFNQPVLQTLQMFIGEMS-
MLALWWFQLRGTGR----QQHEFDNKPLIKGRSYVLLALPAICDIIATTLMNLALVMIPV
SIYQMVRGAIVFFVALFSVLFLGRQVCRLEWAYLATIVAGVAVVGYSGQSA---------
---DTVSEQSFSSSLLVGVLLILFALLFMATQFIVEEHVMSRWAVSPVGLIGHEGLFGSS
ITVALLVVGNYMGGYRDVNSTFNMKQAFSDMFARPAVLNSSFVIMVSIALFNFFGVSITK
NVSATSRSTVDTCRTLLVWCVSLSLGWESFKFTQLCGFALLVIGTLLFNNAIEIPDKYLP
SYFLEDKS-GESQRLINTIDEEVERF
>Kwal_27.9830
MSRLYIASICVGVIVFGCVNSLATKYQDNQCVRDCDGDNPIYFNQPVLQTLQMFIGEMA-
MLAFLRGQQRSKLP----LEQGFRGKPAISLQGYLLLALPAVCDIIATTLMNWALVMIPV
SIYQMTRGAIVFFVALFSVVFLHRRVTRFEWASLAIIVAGVAVVGYSGQED---------
---EVLSEEVISTSSVFGISLILVALFFMATQFIVEEHILSRWEINPVGLVGFEGFFGTS
ITLAFLLVGNVAGGNRNKNSSFNMKQAFMDMYEHSAVLISSIIIMISIALFNFTGVSITK
HVSATSRSTVDTCRTLLVWCVSLILGWESFKFMQLCGFVLLVLGTLLFNGAIEIPPKYLP
RYFKEDSSEGERQRLIDTIDEEVERF