MUSCLE (3.8) multiple sequence alignment

Suva_3.190         -------------MAMAKPSNTIGPWRLGETLGSGSTGRVQLAQHERTGHKTAVKVISKT
Skud_3.39          -----MTVANTETQTAAKSSSTIGPWKLGETLGVGSAGKVRLAQHEGTAHKTAVKIISKS
Smik_3.54          -----MAVANMETYRITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKS
YCL024W            -----MTVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS
TBLA0A07150        ------MVKLTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKA
CAGL0K05709g       ------MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKA
AFR696C            -------MGDKNNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKS
Ecym_1058          ------MGTKDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKS
KLLA0C01650g       ---------MNGNGITTLKGDTIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKS
SAKL0C01716g       MSTHSRQNSIISSPLTTLKNDKIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKS
KLTH0F01672g       MSTHSRQNSVVKSTLTTLKGDKIGPWKLGSTLGAGSTGKVVMAQHESTGQQAAVKIVSKS
Kwal_33.13225      ------------------------------------------------------------
TPHA0E03640        -------MLKANISDVTVTGNNIGPWKLGETLGFGSTGKVQLATNEQTNQQAAIKIISKS
Kpol_2002.46       -------MISSNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVISKS
NDAI0A00660        --------MTSVVGETKMKGDTIGPWKLGKTLGLGSTGKVELAYNETTSQQAAIKIISKS
NCAS0B08600        ----MTTLAENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKS
ZYRO0F17402g       ------MSGMNKRSAPTVRGDKVGPWKLGETLGFGSTGKVQLACNEITQQSAAVKEISKA
TDEL0C06490        ------MAAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKA
KNAG0F00290        --------MITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKT
KAFR0D04100        --------MTASNNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKS
Suva_2.687         -------MAVNGNSIQAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA
Skud_4.783         -------MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA
Smik_4.789         -------MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKT
YDR507C            -------MAINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKA
                                                                               

Suva_3.190         IFDT---EDGGGX---------------XXLALPYNIEREIVVMKLLSHPNVLSLYDVWE
Skud_3.39          IFNTE--GNYGN----------------HGSVLPYNIEREIVIMKLLSHPNVLGLYDVWE
Smik_3.54          IFKSE--GSHGN----------------NDSVLPFNIEREIVIMKLLSHPNVLSLYDVWE
YCL024W            IFNNN--GNHSN----------------DDSVLPYNIEREIVIMKLLSHPNVLSLYDVWE
TBLA0A07150        VFNND-NANASDSALL------------TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWE
CAGL0K05709g       VFEAMNNSESNGD---------------ATNALPYNIEQEIIIMKLLNHPNVLRLFDVWE
AFR696C            VFNA------QGSTFVGSN---------DPDVLPYGIEREIIIMKLLNHPNVLRLYDVWE
Ecym_1058          IF------NAQGSTFVGSN---------DPDVLPYGIEREITIMKLLNHPNVLRLYDVWE
KLLA0C01650g       IFN------AQGSTMIGGN---------DPDVLPYGIEREIIIMKLLNHPNVLRLYDVWE
SAKL0C01716g       IFGAV--AQNNSSTIVGSN---------DPDLLPYGIEREIIIMKLLNHTNVLRLYDVWE
KLTH0F01672g       IFG----NQSNSSTIVGSN---------DPDVLPYGIEREIIIMKLLNHPNVLRLYDVWE
Kwal_33.13225      ------------------------------------------------------------
TPHA0E03640        VFDHLVNSNNNNNSALAASDVNNGSVQHNQEALPYGIEREIIIMKLLNHTNVLRLYDVWE
Kpol_2002.46       VFSSM----GNNSSMVSS----------TPDSLSYGIEREIIIMKLLNHPNVLRLYDVWE
NDAI0A00660        IFSQ---GTVGESSMVSNS---------SPDALPYGIEREIIIMKLLRHPNVLSLYDVWE
NCAS0B08600        IFNTK--PNSNETSMVAN----------TPDSLPYGIEREIIIMKLLRHANVLSLYDVWE
ZYRO0F17402g       IFSAK--TAPGNSSIAAS----------TPDPLPYGIEREIIIMKLLNHPNVLRLYDVWE
TDEL0C06490        IFNVK--GSVKDSSVAAS----------TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWE
KNAG0F00290        IF-----QDSNVTSMVDNT---------TPDALPYGIEREIVIMKLLNHANVLRLYDVWE
KAFR0D04100        VFNN---NSAQSSSLT------------TPDALPYGIEREIIIMKLLNHPNVLRLYDVWE
Suva_2.687         VFNS---GNVSGTSIVGSN---------TPDALPYGIEREIIIMKLLNHPNVLRLYDVWE
Skud_4.783         VFNA---GNMSGTSIVGSI---------TPDALPYGIEREIIIMKLLNHPNVLRLYDVWE
Smik_4.789         VFNT---GNVSGTSIVGST---------TPDALPYGIEREIIIMKLLNHPNVLRLYDVWE
YDR507C            VFNT---GNVSGTSIVGST---------TPDALPYGIEREIIIMKLLNHPNVLRLYDVWE
                                                                               

Suva_3.190         TNNNLYLILEYAEKGELFNLLVDRGPLPEKEAVKCFRQIIIAISYCHALGIVHRDLKPEN
Skud_3.39          TNNNLYLILEYAEKGELFNLLVDRGALPEREAMKCFRQIIIAVSYCHALGIVHRDLKPEN
Smik_3.54          TDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPEN
YCL024W            TNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPEN
TBLA0A07150        TDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPEN
CAGL0K05709g       TNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEN
AFR696C            TAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPEN
Ecym_1058          TSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPEN
KLLA0C01650g       TSKDLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPEN
SAKL0C01716g       TKSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPEN
KLTH0F01672g       TNSSLYMVLEYVEKGELFNLLVDRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPEN
Kwal_33.13225      ----------------------------------------------------MRRLR---
TPHA0E03640        TNNNLYMVLEYAEKGELFNLLVEKGPLAENEAVRFFRQIIIGMSYCHALGIVHRDLKPEN
Kpol_2002.46       TNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPEN
NDAI0A00660        TNSKLYMILEYAEKGELFNLLVERGPLPEKEAIRFFRQIIIGISYCHALGIVHRDLKPEN
NCAS0B08600        TNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPEN
ZYRO0F17402g       TNPSLYMVLEYAEKGELFNLLVENGPLPENEAVCFFRQIIIGVSYCHALGIVHRDLKPEN
TDEL0C06490        TNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPEN
KNAG0F00290        TNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPEN
KAFR0D04100        TNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPEN
Suva_2.687         TNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPEN
Skud_4.783         TNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPEN
Smik_4.789         TNADLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPEN
YDR507C            TNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPEN
                                                                        * *.   

Suva_3.190         LLLDNDYNIKIADFGMAALQTDARLLETSCGSPHYAAPEIVSGLPYRGFASDVWSCGVIL
Skud_3.39          LLLDSDYNIKVADFGMAALQTDAALLETSCGSPHYAAPEIVSGLPYEGFSSDVWSCGVIL
Smik_3.54          LLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVIL
YCL024W            LLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVIL
TBLA0A07150        LLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIIL
CAGL0K05709g       LLLDNKLNIKIADFGMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVIL
AFR696C            LLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVIL
Ecym_1058          LLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVIL
KLLA0C01650g       LLLDHKFNVKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVIL
SAKL0C01716g       LLLDHKFNIKIADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVIL
KLTH0F01672g       LLLDHKFNIKIADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGIIL
Kwal_33.13225      ----------------------------SCP-----------VLPYHGFESDVWSCGIIL
TPHA0E03640        ILLDHKSNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYNGLETDIWSCGVIL
Kpol_2002.46       ILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVIL
NDAI0A00660        LLLDHKLNIKIADFGMAALETKDKMLETSCGSPHYAAPEIVSGVPYHGFQSDVWSCGVIL
NCAS0B08600        LLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVIL
ZYRO0F17402g       LLLDHDLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDIWSCGVIF
TDEL0C06490        LLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVIL
KNAG0F00290        LLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVIL
KAFR0D04100        LLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVIL
Suva_2.687         LLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVIL
Skud_4.783         LLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVIL
Smik_4.789         LLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVIL
YDR507C            LLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVIL
                                               **             :** *: :*:****:*:

Suva_3.190         FALLTGRLPFDEDNGNVRDLLLKVQRGQFEMPDATEISKDAQNLISRILVVDPTQRMKTR
Skud_3.39          FALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDDTEISKDAQDLISKILVVDPAQRIKIR
Smik_3.54          FALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIR
YCL024W            FALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIR
TBLA0A07150        FALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTR
CAGL0K05709g       FALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIR
AFR696C            YALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTR
Ecym_1058          YALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTR
KLLA0C01650g       YALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTR
SAKL0C01716g       YALLTGRLPFDEDNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTR
KLTH0F01672g       FALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPDTNEISGEAQDLIAKILTVDPAARIKSR
Kwal_33.13225      FALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIAKILTVDPAARIKSR
TPHA0E03640        FALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTR
Kpol_2002.46       FALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSR
NDAI0A00660        FALLTGRLPFDEEDGNIRNLLLKVQSGEYEMPDDDEISKEAQDLIGRILTVDPEQRIKTR
NCAS0B08600        FALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTR
ZYRO0F17402g       FALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPDDDEISPEAQDLLAKILTVDPECRIKPR
TDEL0C06490        FALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKAR
KNAG0F00290        YALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITAR
KAFR0D04100        FALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRAR
Suva_2.687         FALLTGRLPFDEEDGNIRALLLKVQKGEFELPSDDEISREAQDLISKILTVDPERRIKAR
Skud_4.783         FALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKAR
Smik_4.789         FALLTGRLPFDEEDGNIRTLLLKVQKGEFELPSDDEISREAQDLISRILTVDPERRIKTR
YDR507C            FALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTR
                   :**********:::**:* ***:** * :*:*   *:: :*.:*: .:*.*:*  *:  *

Suva_3.190         DILTHPLLKKYQTIRDSKSIRNLPRENTYLYPLADAGNHTN--ATIDGSILQNLVVLWHG
Skud_3.39          DILSHPLLKRYQTIKDSKSIKDLPREDTYLYPLADA----G--AAIDDSILQNLVVLWHG
Smik_3.54          DILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADADNHTS--VTIDDSILQNLVILWHG
YCL024W            DILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADSNNHTS--ASIDDSILQNLVVLWHG
TBLA0A07150        EILKHPLVQKYPSIKDSKTIRNLPREDTYLNPLSDDN---GDVCEIDPKILQNLVVLWHG
CAGL0K05709g       EILKHPLLQKYPSIKDSRSIRNLPREDTYLSPLADTN---S--K-IDDAILQNLVILWHG
AFR696C            EILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDHND---G--T-IDQAILQNLVVLWHG
Ecym_1058          EILKHPLLKKYPSIKDSKSIRNLPREDTYLNPLDHND---G--T-VDRTILKNLVVLWHG
KLLA0C01650g       EILKHPLLRKYPSIKDSKSIRNLPREDTYLNPLSLEG---GNQC-VDETILQNLVVLWHG
SAKL0C01716g       EILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDHGD---G--S-IDDGILQNLVVLWHG
KLTH0F01672g       GILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVD---G--T-IDDTIIGNLVVLWHG
Kwal_33.13225      EILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVN---G--S-IDESIINNLVVLWHG
TPHA0E03640        EILKHPLLQKYPNIKDSKTIRDLPREDTYLNPLADNN---GVDTEIDESILQNLTVLWHG
Kpol_2002.46       EILKHPLLQKYPSIKDSKTIRNLPREDTYLNPLIGND---GGDATIDKTILQNLVVLWHG
NDAI0A00660        DILKHPLLQKYPSIKDSRSIKNLPREDTYLYPLSENN---S--I-IDDSILQNLVALWHG
NCAS0B08600        EILKHPLLQKYPSIKDSKSIKNLPREDTYLFPLSDNN---S--V-IDPSILQNLVVLWHG
ZYRO0F17402g       EILKHPLLQKYPNVSDNKSIRNLPREDTYLHPLSDSG---S--SEVDQNILQNLVVLWHG
TDEL0C06490        DILKHPLLQKYPSINDSKSIRNLPREDTYLHPLSEGE---S--AEIDENILQNLVVLWHG
KNAG0F00290        DILKHPLLQKYPSIKDSKSIRNLPREDTYLHPLAETN---S--A-IDENILQNLVVLWHG
KAFR0D04100        DILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLSDNN---S--T-IDKTILQNLVVLWHG
Suva_2.687         DILKHPLLQKYPSIRDSKSIRDLPREDTYLTPLSESN---S--S-IDATILQNLVILWHG
Skud_4.783         DILKHPLLQKYPSIRDSKSIRGLPREDTYLTPLSESN---S--S-IDATILQNLVILWHG
Smik_4.789         DILKHPLLQKYPSIKDSKSIRGLPREDTYLTPLSESN---S--S-IDATILQNLVILWHG
YDR507C            DILKHPLLQKYPSIRDSKSIRGLPREDTYLTPLSESN---S--S-IDATILQNLVILWHG
                    **.***:..* .: *..:*..****:*** **       .    :*  *: **. ****

Suva_3.190         RPADEIVANLKDNGTNTEKTLYALLYRFKQEANKRSRHKIKKTTKKN-------------
Skud_3.39          RHADEIKAKLKASGTNTEKTLYALLYRFKLESMRESNKRRRHKTKKT-------------
Smik_3.54          RPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMKETNKRSRSKINKT-------------
YCL024W            RHADDIVSKLKENGTNKEKILYALLYRFKLDSVRGSNKKNRNKIKKT-------------
TBLA0A07150        RDSKEITKKLKEPGANAEKTLYALLDRFKNDTEKEIKRQSQLKKRQSQ------------
CAGL0K05709g       KDAREIAAKLREPGANTEKTLYALLYRFKCDTQREANRARRQSKIVQ-------------
AFR696C            RDKNEITMKLKEPGANLEKTFYALLHRFKFENEQQQLKQQQIAKRISST-----------
Ecym_1058          RDENEIVMKLNEQGPNLEKTFYALLHRFKYENEQQQLKQQQIAKRISSA-----------
KLLA0C01650g       RNKEDIITKLMEPGANLEKTFYALLHRFKHDNYQDQLKQQELQKKQS-------------
SAKL0C01716g       RDRNEIVAKLNEPGANLEKTFYVLLFRFKHDVHQQQQQQQQQQQQQQQQQQQQQQQQQQQ
KLTH0F01672g       RDRNEITNKLKEPGANLEKTFYALLFRFKHDSQQEQLKQQRRSQAMQ-------------
Kwal_33.13225      RDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQASH-------------
TPHA0E03640        KDKNEIIKKLKEPGANAEKTLYVLLHRFKEDTERENHKNSQLRKRQS-------------
Kpol_2002.46       RNEDDIAKKLREPGANAEKTLYALLYRFKVDSEQEALKNSQIKKRQS-------------
NDAI0A00660        RDKDDIAGKLRESGADAEKTVYALLYRFKVEAEKMNTC----------------------
NCAS0B08600        RDKEQIAAKLKESGANAEKTIYALLYRFKIEAENLSAKQEQVKRKQS-------------
ZYRO0F17402g       RPAGEIAAKLKDPGANAEKTLYALLARFKNDTEREAARQKQIKKRSS-------------
TDEL0C06490        REQLEIINKLREPGANAEKTLYALLDRFKSDTENDSVKHPQSKKRVS-Q-----------
KNAG0F00290        RDPAEIRVKLKEHGANAEKTLYAMLNRFKLDVEQENLKNEHLKNRQS-------------
KAFR0D04100        RDVNEIISKLKEPGANAEKTLYALLDRFKIDSEKENFKNEQIRKRQS-------------
Suva_2.687         RDPDGIRAKLQEPGANAEKTLYALLYRFKCDTQKELIKQQQIRKRQS-------------
Skud_4.783         RDPDGIKEKLKEPGANAEKTLYALLYRFKCDTQKELIRQQQIKKRQS-------------
Smik_4.789         RDPDGIKEKLRETGANAEKTLYALLYRFKCDTQKELVKQQQIKKRQS-------------
YDR507C            RDPEGIKEKLREPGANAEKTLYALLYRFKCDTQKELIKQQQVKKRQS-------------
                   .    *  :*   *.: ** .*.:* *** :  .                          

Suva_3.190         --------------------------------PPYPS--MSILSSSSS---HNRLSG---
Skud_3.39          ------------------------------------KNRKFSTSSSLV---KGRNLE---
Smik_3.54          ----------------------------------KKSKRVSTLSSSSS---S--AFNHQS
YCL024W            ----------------------------------KKNKRSSTLSSSSSLLLNNRSIQ---
TBLA0A07150        ------VQQTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASMVSVSSA---HKRPVSFNR
CAGL0K05709g       ---------RNSTIRSTAPESPSKKKT----YTPQKKNKRASIIASSS----KRPVSVTK
AFR696C            ------SSSPQQNIVKSSSRRSINNIL----STPKKK-RSSAINVSSA---HKRPVSIQK
Ecym_1058          ------SSSPQRNIVKSSSRRSINQIL----VTPKKK-RSSGINVSSA---HKRPVSIQK
KLLA0C01650g       ------VSSNSLMYVGSLPSPNKSDSP----VTTPKKKRTSIIVASSS---HKRPVSMQK
SAKL0C01716g       SRQSGYVSPKKLAMKKSASRKSITSTSLSGTTTPKKKNRVSMISVSSS---HKRPVSFNK
KLTH0F01672g       ------VSPKKTGLRKSNSRRSINS------TTPKKKTRAPVISASSS---HKRPVSFSR
Kwal_33.13225      ------ISPKRSNMRNSVSRRSITN------VTPKKKNKAPVISASSS---HKRPVSFNR
TPHA0E03640        -------------LMKASSSSSSNQGN----VPRRRKNRNSMISVTSS---HKKPVSYNK
Kpol_2002.46       ------------IISNNNLKSGNINTT----TPQKKKNRNSVISVSSS---HKRPVSLNR
NDAI0A00660        -------------------------------SSPRRKNRISMISVSSS---HKRPVSMKK
NCAS0B08600        -----------------IIKKSTANVS----TPPRKKNRISTMSVSSS---RKRPVSFNR
ZYRO0F17402g       ---------------LNGTGAGVNNNH----VSPKKRNRASTINASSS---HKRPVSLIK
TDEL0C06490        ------INPVRQPTTKKAPSKPQTN------ASPKRRNRTSMISVSSS---HKRPVSFNK
KNAG0F00290        ------GGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTSS---HKRPISFQK
KAFR0D04100        -------------ITSSVSRSPAKKAS----TPQRRKNRISMISVSSS---HKKPASFNR
Suva_2.687         -------------IGSVSISPPKRTST----TPQRRRNRESIISVSSS---RKKPISFNK
Skud_4.783         -------------ISSVSTSSPNKIST----TPQRRKNRESIISVTSS---RKKPISFNK
Smik_4.789         -------------ISSLSISPSKKLST----TPQRRKNRESMISVSSS---RKKPISFNK
YDR507C            -------------ISSVSVSPSKKVST----TPQRRRNRESLISVTSS---RKKPISFNK
                                                                :              

Suva_3.190         -----------------------------STPRRRTPKRRSMNFSSSKKRSS--FILASN
Skud_3.39          -----------------------------STPRKRTSKTHSNNFSSGKKRSS--FILSPN
Smik_3.54          LD---------------------------SAPRKHASRGHSKNFPSSRKRSS--FILSSN
YCL024W            -----------------------------STPRRRTSKRHSREFSSSRKRSS--FLLSSN
TBLA0A07150        LSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSINLSSNKRISQ--LLANDL
CAGL0K05709g       TATNITVNSS-------------------ITGTPKSAKRMSMNNSARKRMSA--LYGT--
AFR696C            LNDCG------------------------TLNPTSPSKKRSL---SNRKLSA--VL----
Ecym_1058          WGEIGGG----------------------NNGLISPSKKRSL---SNRKLSA--IL----
KLLA0C01650g       LSSQHSS----------------------PVKNGSIGKRLSKTFPSNKRISQ--LV----
SAKL0C01716g       LSTAGKSDSA-------------------CGTPGSSTKRMSISLSSSKRLSA--M-----
KLTH0F01672g       LSYSNGSNTD-------------------HNTPNSSGKRSSVNLSSNKRISA--LI----
Kwal_33.13225      LSFNNGSNTA-------------------HTPPTSASKRASVNLSSNKRISA--LI----
TPHA0E03640        IAMVGGSSKDVISLPSS------------SNTTPASSKRISLSLSSSNKRNSR-LYTQSN
Kpol_2002.46       LSTIQNGKDVISVPSS-------------SNTTPGSSKRISMSLSSNKGSK---ILPQSN
NDAI0A00660        ISTV-------------------------QNNTPPSNRRLSISLSSTQRKRMSGILQHT-
NCAS0B08600        LPTISNGKTNNIIPNGRNGDS--------NNTTPKSNKRLSINLSSNKRLSNLLVQGHSN
ZYRO0F17402g       LSGSSNSNSNSNP----------------SSTSTTPPKRMSVNLSSNKRLST--VKTQGN
TDEL0C06490        LSNVVSPGSVP------------------SSNSNTPSKRVSVNLSSNKRLSA--VYTN--
KNAG0F00290        LPTLNSTSSLA------------------AITPSTSARRKRLSKISGYPVSN--V-----
KAFR0D04100        LSSVVHNNL--------------------SASSSTTTTPASKKFSMNKKLSM--IADKSN
Suva_2.687         FTASSASSS--------------------NLTTPGSSKRLSKNFSSKKKLST--IVN---
Skud_4.783         FTASSASSS--------------------NLTTPGSSKRLSKNFSSKKRLST--IVN---
Smik_4.789         FTASSASSS--------------------NLTTPGSSKRLSKNFSSKKKLST--IVN---
YDR507C            FTASSASSS--------------------NLTTPGSSKRLSKNFSSKKKLST--IVN---
                                                                         .     

Suva_3.190         SSNGSPMPSR-NSKRSSFFNTAS----ANVPPVPVKLLNSYK------------------
Skud_3.39          SINSSPIPLR-NSKGISLRNATS----GGSPVVPVILLNSFK------------------
Smik_3.54          STDCSPIPLR-SSKRISISSAVP----GNTLQVPDSSLK-LK------------------
YCL024W            PTDSSPIPLR-SSKRITHINVAS----ANTQATPSGVPNPHK------------------
TBLA0A07150        --NTSPTPSN-CTKRMSII--------NGTPPVPMDIMKNYNDANMATTVSSSTTVTTSN
CAGL0K05709g       --RDSPTKTS-RSRRSSIITK-DFL--GNRPRDSVISMSHN-------------------
AFR696C            --AGSNSSSP-SRKRMSVG--------QDAPPVPTAVLRDYN------------------
Ecym_1058          ---NTPSSSP-SRKRMSIA--------QDAPPMPTSVLRDYN------------------
KLLA0C01650g       --SNSSSPTPAAHKRVSRIND------SAAPPVPKEMLRDYK------------------
SAKL0C01716g       --GPNTSPTP-ANKRMSVRDM-D----SSAPPVPMDVLNDYTSAL---------------
KLTH0F01672g       --NPNSSPTP-ASKRASLREL-D----PSAPPIPVDMLKDYNKAA---------------
Kwal_33.13225      --NPNNSPTP-VHKRSSMRDL-D----ASAPPIPMDMLKDYNKSA---------------
TPHA0E03640        --SSSPTPAP-RSRRSSNQNLINKE--SEAPPIPVDVLKDYNKIS---------------
Kpol_2002.46       --SGSPTPAP-RNKRMSVQNL-ETS--SNPPPIPVDMLKDYGNST---------------
NDAI0A00660        --NSSPTPS--RTKRISVINI-DDSENKAPPPVPMEMLEDYKNNS---------------
NCAS0B08600        GNSNSPTPS--RSKRISLINLDN----STAPPIPVNVLKDYKNKS---------------
ZYRO0F17402g       --GGSPTPAS-RSKRVSIIES-DKN--GGAPPVPIDMLKDYNKTP---------------
TDEL0C06490        --SGSPTPAS-RHKRVSIVDL-ERERENDTPPVPIEMLKDYSSTA---------------
KNAG0F00290        --NGSPTPAS-RKKRNSMANI------QAARSSTIKKTNTF-------------------
KAFR0D04100        SNNSSPTPAH-RNKRTSMINT------DRQSILSKN------------------------
Suva_2.687         --QSSPTPSS-RNKRTSIANV-D----KNQKRASIFSTTKKN------------------
Skud_4.783         --QASPTPAS-RNKRTSIINV-D----KNQRRASVFSTAKRN------------------
Smik_4.789         --QSSPTPAS-RNKRASVINI-E----KNQKRASVFSTAKKN------------------
YDR507C            --QSSPTPAS-RNKRASVINV-E----KNQKRASIFSTTKKN------------------
                       .        .  :                .                          

Suva_3.190         ------------------------------------------------------------
Skud_3.39          ------------------------------------------------------------
Smik_3.54          ------------------------------------------------------------
YCL024W            ------------------------------------------------------------
TBLA0A07150        PISTLNNMPHTRYTNDTNTNLTDINNNKRNSVINTKYTNPANSTQISTNGQTSDSAAQNV
CAGL0K05709g       ------------------------------------------------------------
AFR696C            ------------------------------------------------------------
Ecym_1058          ------------------------------------------------------------
KLLA0C01650g       ------------------------------------------------------------
SAKL0C01716g       ---------------------------------------------------PN---RKAT
KLTH0F01672g       ---------------------------------------------------P-----KAN
Kwal_33.13225      ---------------------------------------------------P-----KVS
TPHA0E03640        ---------------------------------------------------------NQN
Kpol_2002.46       ---------------------------------------------------SS---HANA
NDAI0A00660        ---------------------------------------------------KNVRRTIKK
NCAS0B08600        ----------------------------------------------------------SS
ZYRO0F17402g       ----------------------------------------------------------NS
TDEL0C06490        ----------------------------------------------------------KQ
KNAG0F00290        ------------------------------------------------------------
KAFR0D04100        ------------------------------------------------------------
Suva_2.687         ------------------------------------------------------------
Skud_4.783         ------------------------------------------------------------
Smik_4.789         ------------------------------------------------------------
YDR507C            ------------------------------------------------------------
                                                                               

Suva_3.190         RNS-KRSSKRLSYVPNVKRGSLTSKSLSKYTNLIDEDDWEYIEKDTKRTSSNFATLIDEI
Skud_3.39          RNS-KLSSKRSSYMPNLKSGSVTSRLLSNYNKLIDEDDWECIEKDTKRTSSNFATLIDEI
Smik_3.54          RNS-KRSSKRLSYMPNLGRGSLTTNLLSNYTNLIDDDDWEYIDKDTKRTSSNFATLIDEI
YCL024W            RNSKKRSSKRLSYMPNTKRSSLTSKSLSNFTNLIDDDDWEYIEKDAKRTSSNFATLIDEI
TBLA0A07150        NRA-SRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNI
CAGL0K05709g       KRA-SKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYIERETKRTSSDFATLIDEI
AFR696C            KRA-SRASKRLSFLPS-KRGSITTKIIATYAKLSEDNDWEYIDREAKRTSSDFATLIDNI
Ecym_1058          KRA-SRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDWEYIDKEAKRTSSDFATLIDNI
KLLA0C01650g       RQS-KRQSKRFSLLPNMKRGSITTKLIATYAKLSEDSEWEYIEKETKRTSQDFATLMDQI
SAKL0C01716g       KRA-SRASKRLSFLPNIKRGSITTKLIATYAKLSEEDDWEYIEKETKRTSADFATLCDQI
KLTH0F01672g       RKS-SRISKRLSFLPGNKRGSITTKLIATYAKISEDNDWEYIEKETKRTSADFATLCDEI
Kwal_33.13225      RRS-TRLSKRLSFLPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFATLCDEI
TPHA0E03640        KRG-SRLSKRYSFLLNNKRGSVTTKIMSTYAKLAEDDDWEFIEKETKRVSSDFATLIDEI
Kpol_2002.46       KRA-SRISKRLSVLPNAKRGSITTKIISTYAKLSEDDDWEFIEKETKRVSSDFATLIDEI
NDAI0A00660        KKK-KKNNYRLTLV-NNKRVSITTKLLSTYAKLSEDDNWEYIERETKRTSSDFATLIDEL
NCAS0B08600        SKN-KRASKRLTFLGNGKRGSITTKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEI
ZYRO0F17402g       KRL-SRASVRLSFKPTNKRGSVTTKLISTYAKLSEEDDWEYIEKETKRTSSDFATLIDEI
TDEL0C06490        KRL-SRNNMRLSFKPSNKRGSITTKLISTYAKLSEDDDWEYIEKETKRTSSDFATLCDQI
KNAG0F00290        KKN-NRASKRVSILPNNKNGTIASKLISTYAKLSEDDEWEYLEQETKRTSSNFATLIDEI
KAFR0D04100        KRA-SRSSKRLSVMANMKRGSITTKLIATYAKLSEDDDWEYIEKETKRTSSDFATLIDEI
Suva_2.687         KRA-SKSTRRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEI
Skud_4.783         KKT-SRSTKKLSLIPSMKRESVTTKLMSTYAKLAADDDWEYIEKETKRTSSNFATLIDEI
Smik_4.789         KRT-SKSIKRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEI
YDR507C            KRS-SRSIKRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEI
                    .  .    . :        ::::. ::.: ::  :.:** ::.::.*.* :**** *::

Suva_3.190         FEPEKFELARREKAELQRKVQEAK------------------------------------
Skud_3.39          FEPEEFELAKREKVELQRKVRGSK------------------------------------
Smik_3.54          FEPEKFELAKREKAELQKKVQEAK------------------------------------
YCL024W            FEPEKFELAKREKAELQRKVQEAKRQ----------------------------------
TBLA0A07150        FEHEKYEQIRKEKDELERKVRENKKREEEERLVR-EAIEKEKQIELEKE-----------
CAGL0K05709g       FEYEKYEQIRKEKAELERKVRETKEREERERKER---QEKELQERLERE-----------
AFR696C            FEHEKYEQIRREKEELERKVREAKEREERERRARAEAERRKREEEERRR-----------
Ecym_1058          FEHEKYEQIRREKEGLERKVREAKAREARERKEREERKQREEREREERRALERKEQEARE
KLLA0C01650g       FEHEKYEQIRKEKEELERKVNEAREKEEAERKER-ERIEREEQERLERE-----------
SAKL0C01716g       FEHEKYEQIRKEKQELERKVREAKEREERERRKRQEEQEEQERKRRAEE-----------
KLTH0F01672g       FEHEKYEQIRREKEELERRVREAKEQEERERRQREEEERRQREEELARQ-----------
Kwal_33.13225      FEHEKYEQIRKEKEELERRVREAKEQEELERRQREEEERLQREMELQHQ-----------
TPHA0E03640        FEHEKFEKIRKEKEELERKVIEAKQKEERERKEAEAAAKEEARVRREKE-----------
Kpol_2002.46       FEHEKYEQIRKEKEELERKVRENKEREERQKRQK---EVELAAIARERE-----------
NDAI0A00660        FEHEKYERIRKEKEELERKVRETRVREQR-------------REEEERA-----------
NCAS0B08600        FEHEKYEQIRKEKEELARKVREAKEGEARERREQ---ESEKQRKQRERE-----------
ZYRO0F17402g       FEHEKFEQIRKEKAELERRVKETKEREERERKER---EEKELNEKLEND-----------
TDEL0C06490        FEHEKFEQIRREKEELERKVRETKEREERERREK---EIEEKRKIQEKQ-----------
KNAG0F00290        FEHEKYEQIRKEKEELARKVREAKEREEAERKQK---ELQEREKQRERE-----------
KAFR0D04100        FEHEKYEQIRKEKEELARKVRLAKEREEEERRRR---EEEELHKLNEEK-----------
Suva_2.687         FEYEKYDQIRKEKEELERKVKEAKALEELERRKRKQEEKERARKLLEKE-----------
Skud_4.783         FEYEKYEKIRKEKKELELKVREAKAREELERRKRKQEEKEHSRKVLEKE-----------
Smik_4.789         FEYEKYEQIRKEKEELERKVREAKAREELERRRRRQEEKERTRKLLEKE-----------
YDR507C            FEYEKYEQIRKEKEELERKVREAKAREELERRRRKQEEKERARKLLEKE-----------
                   ** *:::  ..**  *  .*   .                                    

Suva_3.190         --------------------RGKSDVAKLNQENGNETG---------KSDAMEELKKIN-
Skud_3.39          ----------------------------MSDNIGDRSE---------FTDGMKELKRIN-
Smik_3.54          --------------------RQVSKNAPISDEKDVGFE---------VSDGMRELKKIN-
YCL024W            ---------------------SVNAQKINEDEFG--SE---------VSDGMKELKKIN-
TBLA0A07150        ---------------------RLQLQKEMEGDIDNAKETVQTTEGKREAHNDKIKTETDD
CAGL0K05709g       ------------RIEK----QKEDIARQMDEEISNLKK---------ELVGDQDNEDKF-
AFR696C            ------------RREVEELIRQRELQKSLEEQVARLKA---------EVAATKQEKRISL
Ecym_1058          REEMEDEEQLRLEEDEQEILRQEELQRSLEDEVAKLRA---------ELEETRVEQQLNS
KLLA0C01650g       ------------ERKRAE--RQKELQDQMEDEIAKLKA---------EYEAVQGSSDERN
SAKL0C01716g       -------ERVLRELEDA---KQQELQELMAKEVAMLRA---------DYGEPQTEPEEQG
KLTH0F01672g       -----------REFEEERYHRQREVQENIDREMALLKE---------GYETSSGVDPNKN
Kwal_33.13225      -----------MRLEEESRRRQRETQELIEQEIALLKQ---------SVNPQGPSDSNH-
TPHA0E03640        ----------LARMNK----EEEQLQNDIDEEARLLKD---------EFNFVNDETQENP
Kpol_2002.46       ------------ELQR----RLEEEETQITKELQQDTK---------NFQEDEVVHKNV-
NDAI0A00660        ------------ELQR----EQLKLQQKIDEEISKLKE---------DA----LEKDNF-
NCAS0B08600        ------------ELER----QQLELQNHIDQEISNLKA---------DLANETKGAEPYE
ZYRO0F17402g       ------------ARQK----REMEAQEAQGDDGTDTES---------DVHSNNQAPNGV-
TDEL0C06490        ------------DLER----RQLEIQRQMDEEVANLGK---------ELQGGMNADQDAD
KNAG0F00290        ------------RKEN----ETNDRQRIMEEEIENLKK---------ELDMMSHEGKTE-
KAFR0D04100        ------------KFEA----QQLQLQRQMDEEIENLRA---------DLKGDVEPNQEKN
Suva_2.687         ------------ELKR----KQEELKKQIDIDISDLEH---------ELINHREEKFEGN
Skud_4.783         ------------ELKR----KQQELKKQIEIDISDLEH---------ELSKHKEEKPDGN
Smik_4.789         ------------ELKM----KQEELKKQIEMDISDLEQ---------ELSRHKEEKPDGN
YDR507C            ------------DLKR----KQEELKKQIEIDISDLEQ---------ELSKHKEEKLDGN
                                                  :                            

Suva_3.190         -----------NKVSSPLIN-------YEYSQQELLQDINTLLTNRCQLSAYTRPISKLD
Skud_3.39          -----------AKVSSPLIN-------YEFSQQELLQDIDTLLTNRYQLSAYTRPISKLD
Smik_3.54          -----------NKVSSPLMN-------YEFSQKELLQDIDTLLTNRYQLSSYTRPISRLD
YCL024W            -----------DKVSSPLIN-------YEFSQQELLQDIDTLLTNRYQLSSYTRPISRLD
TBLA0A07150        EERDIIVDIQPRSVSAPLEK-----------TEKSRDSPFDYSKQR-NFSLRTRPVSRLD
CAGL0K05709g       -----------RSVSEPLES-------KSKKIEDIEEDIDGILRNR-KYSLQTRPVSRLD
AFR696C            AQEQHV-----RSISEPMERKGTRP-SKRDSFLALQNNINSLLKRR-TLSLETRPISRLD
Ecym_1058          MSKNQVAR---RSVSEPHKRHSSTS--KRDSLLALQYSINTVLNKR-AVSVQTRPISRLD
KLLA0C01650g       TANG-------RSVSAPIETDRTAN--KRDSTFGIKNDINELINTR-NFSLQTRPVSRLD
SAKL0C01716g       ASKN-------RCVSAPIASSSAKDDGKRDSIARLSGDIDDLLKRR-TVSLQTRPVSRLD
KLTH0F01672g       -----------RSVSAPVESVLKVD--KRSSMDALDGDIMDLLNRR-TFSLETRPKSRLD
Kwal_33.13225      V----------RSVSAPAESVLKVD--KRGSTGNLDNDIMALLNRR-TFSLETRPKSRLD
TPHA0E03640        INS--------RSVSEPVKN-----------------GGTDEKGQR-NFSLQTRPISRLD
Kpol_2002.46       -----------RSISSPVEN------------GNEAKSEEDASGQR-SFSLQTRPVSKLD
NDAI0A00660        -----------RSVSAPIKE-----------NEDEDENENELRNRR-QFSLQTRPVSRLD
NCAS0B08600        NP---------RSVSAPLER---------ENPEAIERDINDLFARR-NVSLQTRPKSRLD
ZYRO0F17402g       -----------RSVSAPLERK------KRDSMVNVQSDIEEIFGQR-TMSLQTRPVSRLD
TDEL0C06490        EGDEHGAVNG-RSVSEPLQKK------SADPMADLQANIDDLLRQR-TFSLQTRPVSRLD
KNAG0F00290        ----------SRSVSEPLNK----------KQGGVEIEVKELLRQR-NAALQTRPKSRLD
KAFR0D04100        EDNY-------RSVSVPLSK---------------ETVNDNLLRQR-NFSLQTRPISRLD
Suva_2.687         I----------RSISAPMEN-------EENNINHLEADIDNILRRR-NFSLQTRPVSRLD
Skud_4.783         I----------RSISAPMES-------EEKNINHLEVDIDNILRRR-NFSLQTRPVSRLD
Smik_4.789         I----------RSISAPMEN-------EEKNIDHLGTDIDNILRRR-NFSLQTRPVSRLD
YDR507C            I----------RSISAPMEN-------EEKNINHLEVDIDNILRRR-NFSLQTRPVSRLD
                                :* *                            *   :  *** *.**

Suva_3.190         PGLMPTPETIPYDIKEKTD----------LLLDTEMKILETIRKSKILDSSLNLRKEVSR
Skud_3.39          PGLMPAAGTTPHDIKEQTA----------LIRDTEVKIIETIHRSKFLGSLLNVREGMSK
Smik_3.54          PGLTPVTGAIPHSIKEKTA----------LLQDTEMKIIETIRKSEFLGSLLNVREGISQ
YCL024W            PGLTPVTETLPNNLKEKTA----------LLQDTEKKIIETIRRSKFLGSLLNVRGGLSP
TBLA0A07150        PGLMYSSGTGSSAYNPSHSTEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDLKKELEM
CAGL0K05709g       PGIGFIDKPRQSEQHVPETVNLE-P----ELEETEQKILETIRRSKFLGSSFDIKKELEN
AFR696C            PGIRLSEENTILEDDLECNE---------DRLRVEKNILETIRRSKFLGSQYDIDKELQR
Ecym_1058          PGIMAQEVAHELDYDDEEILSE-------RTLRREKTILETIRRSNFLGSQFDIHKELKN
KLLA0C01650g       PGIIAAESRLSANLED-------------DQASKEKTILETIRRSKFLGSQFNLNVELEK
SAKL0C01716g       PGIVAAENLGSVIYEEADGVDE-------TTLRTEKTILETIRRSRFLGSSFDIKKELER
KLTH0F01672g       PGIYTLEEVPNSDIKDGG-----------RDLKTEKTILETIRRSKFLGSSFDINKELAR
Kwal_33.13225      PGIYTSEEEDFGSKNHG------------ADLSTEKTILETIRRSKFLGSSFDINKELAR
TPHA0E03640        PGLMFSKLGDVDNNSSVDEN---------LTMNNQKTILETIRRSKFLGSSFDINKELNN
Kpol_2002.46       PGIKCGSNKPVQMEEIVEDELD-------KTIDSQKVILETIRRSKFLGSSFNIDKELKQ
NDAI0A00660        PGILYSAPAEIPSYERVVVNESGNK----SSAQQQRKILETIRRSKFLGSSFNIQQELEF
NCAS0B08600        PGILYSAPAETVSNPLLSDID--------QEIDREKKILETIRRSRFLGSSYNINKELEF
ZYRO0F17402g       PGLFYAEESNEPEAGDTEEE---------KKLRTQKNILETIRRSKFLGSSFDIGKELQN
TDEL0C06490        PGVFSSDSSEKDQYTGSEDR---------AKLNNDKIILETIRRSKFLGSSFDINKELKR
KNAG0F00290        PGLFFDSAESDTRNPSLQVFEGEVD----NKLKTEKAILETIRRSKFLGSSFDISKELKS
KAFR0D04100        PGLFFSEQSPTEEKPISPDEPVP-N----KKLDTEKMILETIRRSKFLGSSFDINRELKA
Suva_2.687         PGIIFSSPIETEDPVEPKKAEN-------ERLTTEKKILETIRRSKFLGSSFNIDKELKL
Skud_4.783         PGIMFSSPVEKESAVEPKRTEN-------ERLTTEKKILETIRRSKFLGSSFNIEKELKL
Smik_4.789         PGIVFSNPIETVYPVEPKRSEN-------ERLTTEKKILETIRRSKFLGSSFNIEKELKL
YDR507C            PGIMFSSPTEEVSPVEPKRTEN-------ERLTTEKKILETIRRSKFLGSSFNIDKELKL
                   **:                               :  *:***..* :*.*  ::   :  

Suva_3.190         DADRLPS----------------------------VEESPIAST-----TPLVYNN----
Skud_3.39          DDDELAP----------------------------IEESSIIST-----TPLIYD-----
Smik_3.54          DNNQLAS----------------------------IEVSPKIST-----TPLMYN-----
YCL024W            GKSELAP----------------------------IEESPIVST-----TPLIYN-----
TBLA0A07150        VEELESNRIKQQAFQDSHLEEMNDVTEDLSQHNVDTSNDRIVST-----TNDRYETEILP
CAGL0K05709g       VKRHR------------------------------QTSQPIEKE-----MAPPALPETLP
AFR696C            VRREKLEKVNMRKSQDRKLEPGLHSRQEQRF----VSDGTTVTS-----SHEDSESIILP
Ecym_1058          AKKEKIEKAKKRKQL-NRKLPDRISYHDQRF----VSDGTTITS-----AHDGYDTTSLT
KLLA0C01650g       AQKDLVSKER-------------------------QEQLRKYSE-----QTAKYEVQKLP
SAKL0C01716g       AQRKKEEALARQHQQRI------------------LSSATAASA-----TNDAYESRALP
KLTH0F01672g       ERRLKEERAAALKQR--------------------KKEDRVVSNATGNYSENGYEPQTLP
Kwal_33.13225      ERRLKEERAALAKRK-----------DEERV----ASNATTANV-----VGNGYESQTLP
TPHA0E03640        ANEERKRLRQLQLQK------------QKEL----EEKERIAST-----SYVSNENQVLS
Kpol_2002.46       VKKDAE-VKRMRKSQ------------KEDR----DVSGRIVSE-----TNEQYETQVLP
NDAI0A00660        SQRNVLV----------------------------PTKEQVVDV-----DEVK-------
NCAS0B08600        AKKTAL-----------------------------AETSKKEKR-----SKVTSQNIVAD
ZYRO0F17402g       EELKKKASQ--------------------------PHRDRTVSQ-----TNEPYDTRVLP
TDEL0C06490        AADNEAKKQRQSK----------------------ATSDRIIST-----TNDEYETQILP
KNAG0F00290        ASARSDYS---------------------------RAPGRVITA-----PSNLERSDVLP
KAFR0D04100        AEKRV------------------------------MQPPTVQKL-----TTENKSSDELP
Suva_2.687         SQMEYPGMAAPQR----------------------LSEERIVSD-----SNGKYESLVLP
Skud_4.783         SKMEYPSMVPPQR----------------------LSEERIVSD-----PSDDYGSLVLP
Smik_4.789         SKMEYPSVLAPEK----------------------LSGERVVSD-----LNGKYESLILP
YDR507C            SKMEYPSIIAPQR----------------------LSEERVVSD-----SNDGYESLILP
                                                                               

Suva_3.190         ------------------------DSKEVCKISDIQVPHFTRKSKCFTPTNNRRSVLSLY
Skud_3.39          ------------------------DRTEVRKISDVEVPHFTRKSRHFTAASNRRSVLSLY
Smik_3.54          ------------------------DQVEIRKISDVEVPHFTRKSKHFTTANNRRSVLSLY
YCL024W            ------------------------DRMEPRRISDVEVPHFTRKSKHFTTANNRRSVLSLY
TBLA0A07150        KSHAGKTQTIGLND----------SSVQPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLY
CAGL0K05709g       KAVEKKNVS---------------MDPSLRKISDIKVPQFTRKSRHFSTSNRRLSVLSMY
AFR696C            KNVTAIGV---LKD----------EESEPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMY
Ecym_1058          RHTTVGV----LRD----------DESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMY
KLLA0C01650g       KNAKAVAT---LRD----------DEVEPRKLSEVKVPQFTRRSKHFSSSNKRFSVLSLY
SAKL0C01716g       KNAAAVDT---LNDE---------RNPEPRKISEIKVPQFTRRSRHFTASNKRLSVLSMY
KLTH0F01672g       KNAAATKI---SND----------AGSDPRKISEVQVPQFTRRSRHFTASNKRLSVLSMY
Kwal_33.13225      KRKMGSAM-------E--------ASSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSMY
TPHA0E03640        KNAIGVVD---LKDFS--------SDVEPRKISEVQVPQFTRKSKYFSESNKRLSVLSFY
Kpol_2002.46       KNATAFGA---LKDDS--------EEVEPRKISDIQVPQFTRKSKLFTDSNKRLSVLSIY
NDAI0A00660        ------------------------LEGGLRKISEVKIPQFTRKSRHFSDSNKRLSVLSMY
NCAS0B08600        KAAIGVIP---LND----------TEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMY
ZYRO0F17402g       TQAVATAP---L------------RDQEPRKISEISVPQFTRKSRFFSDSNKRLSVLSMY
TDEL0C06490        KNATASAP---LKDHN--------HQAEPRKISDIKVPQFTRKSRQFGDSNKRLSVLSMY
KNAG0F00290        KNAIATAP---LRIHS--------DQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMY
KAFR0D04100        KHAVGTAA---LNS----------STAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMY
Suva_2.687         KDAKGVAH---LKDNTAPTTTELLSNGELRKISDIRVPQFTRKSRHFSESNKRLSVLSMY
Skud_4.783         KDARGYSQ---LEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFSESNKRLSVLSMY
Smik_4.789         KDAKGVSQ---LKDDITSTTTEHLSDGKLRKISEVRVPQFTRKSRHFSESNKRLSLLSMY
YDR507C            KDGNGVSQ---LKDSTATTAPV--SDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLSMY
                                                  :*:: :* .**.*. :  :..* *:**:*

Suva_3.190         SSRHSFKGLSRILNSKDPSANPYSHING-PLSEEIDLTEDIANMK---------NIENNN
Skud_3.39          SSRDSFKDLSQISKNEYSDSPSQRSVDDTSSSKKVGHTESLASVAEHIDDDSYNDHNSGM
Smik_3.54          SLKESLEDLNQISKNEEPDSPPQGSTDNASKSELVDVIEEVTEQKNSQHDQDDSNDSNGM
YCL024W            A-KDSIKDLNEFLIKEDPDLPPQGSTDNESRSEDPEIAESITDSRNIQYDEDDSKDGDNV
TBLA0A07150        SSRESFTNLVDMLKEDGINVEPTERS---PTTK-SQEPEFLFESP------SVDTYSRDS
CAGL0K05709g       STKESYSNLADILKNGPGEKEMIQTA---PTPKSADDSDQLFDTI------DEADTPASV
AFR696C            STKVSYTNLADYLN-NDVQLKSLQPSAP-TSIKIPQEPEFMFESA-----GQENRYQAAA
Ecym_1058          STMTSYTNLADFMK-SDVQLKPLNDT---ASSKVTQQPEFMFEST------IDNVERISS
KLLA0C01650g       STKTSFTNLVDHLK-NDNYLEPLPGQPEYSSSKVAQEPEFMFETV------------EEL
SAKL0C01716g       STKSSFTNLADHLK-GGADLQEVSGSAP-STTKITQEPEFLFESVHE----EDSEETPDT
KLTH0F01672g       STKASFTNLADHLR-GKTDLQSINGSPP-STSRMEPETEFMFESV-D----GEGKETADT
Kwal_33.13225      STKTSFTNLADHLK-GKADVQLIQTSPP-SASKMDQEAEFMFESV-----DKEGKETADT
TPHA0E03640        SSKQSYTNLVDMIKENPVEDE-----------DVTEDPGFNFEDS-QYDYLEEKNEAPLE
Kpol_2002.46       SSTQSYTNLANVLKEGGVDIGVNEGS---NNVEVSEEPEFQFETV-G--------TEIEN
NDAI0A00660        STKQSYTNLGHILKDGTEESEPAKKT-----------PELLFES----------------
NCAS0B08600        STKQSYTNLGDILKEGGVNLASEANNT--TTSKASTEPEFQFESV-------------NE
ZYRO0F17402g       STKHSYNNLSNLLNDSDASDGRLNSAAEYSDVKGKKEPEFQFEAV-REASDEDNGISRLS
TDEL0C06490        SSKQSYTNLADLLNEEASNAKGNRDS---PNDQSGHEPEFLFENV-Q----EDGEVTGDS
KNAG0F00290        STRQSFKNLSDMMNFESENTDAAENRGQIATPNSAGQSEFLFESV-N----EEAENTNNT
KAFR0D04100        STRQSFSNLVDILKNTEAGTELGQRT---PTPHSAGDSEFIFETV-N----EEAEYTGNS
Suva_2.687         STKESFTNLVDILKNGNLDINPQQNQRV-PTPRSADDSEFLFETV-N----EEAEYTGNS
Skud_4.783         SSKESFTNLVDILKNGNIDVHKQQSQRI-PTPKSADDSEFLFETV-N----EEAEYTGNS
Smik_4.789         STKESFTNLVDILKNSNLDVNNQQSQRI-PTPRSADDSEFLFETV-N----EEAEYTGNS
YDR507C            STKESFTNLVDILKNGNLDVNNQQSQRI-PTPRSADDSEFLFETV-N----EEAEYTGNS
                   :   *  .*                                 .                 

Suva_3.190         NNNNRLYD---------VSESAI--------LLQGNDDDDDDDDNENDDGSQSIQSSV--
Skud_3.39          NSDNVLYD---------VPEGVD-----LPQEVKNSDEQSSC-------------SLV--
Smik_3.54          NNNNILYD---------VPECVD-----SPQGYDINDAHSTQ-------------SPA--
YCL024W            NNDNILSD---------FPQGVG-----ISQEYDMKDKNPNQ-------------SPI--
TBLA0A07150        STEDKPIN---------EKENSE---PIQSNNLRLSFHDRFNRQLSTEDTEKTKNSPSGH
CAGL0K05709g       SREERLYE---------VAEESE----NELANKKIDIADLLNSE----------GSNL--
AFR696C            PTDTYLER-------PKVGVEGDHEPGEPVELIELDDSEDRS---------------K--
Ecym_1058          NDNSHISS---------MEAPNN-------TVIKLNYADRFYKPVEVIELDDT-DNTQ--
KLLA0C01650g       DENSKLFE---------VPETEE---GKLASAARKESTDA--------------------
SAKL0C01716g       TADSRLYE---------VPDGSESSKTSTKAAMRLNFADRFN------------------
KLTH0F01672g       SADSRLYE---------VAEGND-PKGAARSAVRLNFADRFNKP----------TSPP--
Kwal_33.13225      SADSRLYE---------VAETKD--AKNAKPAVKLNFADRFNRP----------TSPP--
TPHA0E03640        VSDEVPKE---------VDDKVQ-EEEKNSVSMKLNFADRFS------------NVNS--
Kpol_2002.46       NKYEEEKE---------IENENN---LSQGANIKLNYADRFD------------------
NDAI0A00660        GRDDRLYE---------VSEEPE---I---------------------------------
NCAS0B08600        GTANKLYE---------LQEEPE-------------YTDVN-------------------
ZYRO0F17402g       NNDERLRNVSGTSGGSGVPHDNL---SSK-HNMKLNFADRFSADEP--------TAGS--
TDEL0C06490        SHDGRLYE---------VPEDSN---MTK-EKLKLNFADRFK------------TSNG--
KNAG0F00290        STDGKLYE---------VSESPE---SSSKKGLRVNLSDRYN------------------
KAFR0D04100        SNDDKLYE---------VADLDA---AEKPSGMKLNFADRFN---K--------KEED--
Suva_2.687         SNDERLYD---------VGDSCI---KDK-NTLKLNFADRFN---------------G--
Skud_4.783         SNDERLYD---------VGDSTI---KDK-SALKLNFADRFN---------------A--
Smik_4.789         SNDERLYD---------VGDSTI---KDK-TALKLNFADRFN---------------E--
YDR507C            SNDERLYD---------VGDSTI---KDK-SALKLNFADRFN---------------G--
                                                                               

Suva_3.190         -----------------SNNTEPTTFVKLPSLSSF----QEK------NASGLGIYQ---
Skud_3.39          -----------------SSSLEPTPVVELPSLSSF----QGK------NASGLGIYQ---
Smik_3.54          -----------------SKSTEPKPVVKLPSLSSF----QRK------NASGLGIYQ---
YCL024W            -----------------SKSAEPTLVVKLPSLSSF----QGK------NASGLGLYQ---
TBLA0A07150        IKDEPKKDDDNGVDLSTPKAKDESNLVKLPALPPL----TTK------KTDGLGIYQKSK
CAGL0K05709g       -----------------KSVEEQEDSMKLPKLPPL--------------------FE---
AFR696C            -----------------QYSEEDIAKVKLPILPPL----DHL---N--KPNGLGIYQ---
Ecym_1058          -----------------PDTEEDITKVKLPALPPL----EKL---NK-SPNGLGIYQ---
KLLA0C01650g       -----------------RKQSTNDKDINLPSLPPLQVSHDVA---DENGALGLGIYQ---
SAKL0C01716g       -----------------TRAGDNPADVKLPPLPPL----EKN---GSKKPNGLGIYQSPE
KLTH0F01672g       -----------------PQSVEDPNGIKLPSLPPL----DKA---KSDGVNGLGLYQ---
Kwal_33.13225      -----------------SQDTDSSAAIKLPALPPL----DKN---KPNMVSGLGLYQ---
TPHA0E03640        -----------------NTKQESSFEDKFP---NI---LSKS------GTEGLGLYS---
Kpol_2002.46       -------------------TAGNVNEVKLPTLPPL---GDDK------VSDGLGIYS---
NDAI0A00660        -----------------QEEKEDIETVTLPQLPPLKQSANTNANANETEINGLAIFR---
NCAS0B08600        -----------------KEDGKPKKNVKLPTLPPL----HEK----TNQANGLAIYQ---
ZYRO0F17402g       -----------------SNSSSASKNVKLPTLPPL----DGT-----SEANGLGIYQ---
TDEL0C06490        -----------------EDRTAEDKNVRLPTLPPL----DGK------EAKGLGIYQ---
KNAG0F00290        -----------------KANSEADMENKLPILPPL----DPE-------IAGLGIYQD--
KAFR0D04100        -----------------STEPSRDIQNKLPVLPPL----DGK--------AGLGIYQ---
Suva_2.687         -----------------STNEKETKNLHLPTLPPL----NGK--------DEAGKQG---
Skud_4.783         -----------------STNEKETENLHLPTLPPL----NGG--------DEVN------
Smik_4.789         -----------------STEYKETDNLHLPSLPPL----SGD--------DEMR------
YDR507C            -----------------SNEAKQTDNLHLPILPPL---------------NGDNELR---
                                               :*    :                         

Suva_3.190         -REPSIEPSIESS--------------IEP----LPNVTIAIEDV---------------
Skud_3.39          -REPSKVSLP----------------------TATIDTSDAVENR---------------
Smik_3.54          -RESSRESLP----------------------SVTINISESDKTT---------------
YCL024W            -REPSKVTLP----------------------SLTSNNSSVGENI---------------
TBLA0A07150        QRTSSNASNPITPSSTNAQLTSAAVNVTPPTTTMINESIQKLQESREKVNNSSKLIPPKN
CAGL0K05709g       ----DGSTKETKE--------------QSK--SMIPENMQ--------------------
AFR696C            -APAPPKEPLGQP--------------VMK--SMIPDDIKI-------------------
Ecym_1058          ---HSSPREDFKH--------------AVR--SVTP------------------------
KLLA0C01650g       --PNDQTQKPHKT-------------------MLIDESIDE-------------------
SAKL0C01716g       RPRADPNPTSMVH--------------EPKVFSMIPDDIAGPAKSTKPAESENVPTSATK
KLTH0F01672g       -PASDSSETEIHH--------------QPK--SMIPVDAEQKEAAEA-------------
Kwal_33.13225      -ATAEPSHEDAQP--------------VAK--SMVIDDVESEITTEPRNT----------
TPHA0E03640        -KNEKTEPKPVK--------------------SMIP------------------------
Kpol_2002.46       -SKSGSEGNESKP---------------------VPSIK---------------------
NDAI0A00660        -PKENIELEDITK--------------EVK--EVIP------------------------
NCAS0B08600        -SSSDDDKKPTEP--------------QPKSQSMIPERQDSINNSAS-------------
ZYRO0F17402g       -SSSESFRDIVEP--------------TPK--SKLQDNSSNPEQEVEEEVAGREGSVKHS
TDEL0C06490        -SSSESLPEPAQH--------------NVK--SMIQNDENQPSETAE-------------
KNAG0F00290        -QPEEVNAKPQEK--------------KSK--SKSAETGDIS------------------
KAFR0D04100        -TSSPIEPQLLER--------------PVKGDKFMETISSDNEKP---------------
Suva_2.687         -EEQEKEDLHEQP--------------KVK--SMIPESDSLSHAEK--------------
Skud_4.783         -KQKDEDVLGIQP--------------KVK--SMIPQSDSSSHTGKEEEKEEKGEE----
Smik_4.789         -KQNSEEDSLVQP--------------KVK--SMIPQSDSSSHTEKVEEKEGE-------
YDR507C            -KQNSQEGDQAHP--------------KIK--SMIPESGSSSHTEKEEENEEKEEKKPEQ
                                                                               

Suva_3.190         -----------------DEDG---ENEIQHENITTS----LSNDNIKKNDDTKD------
Skud_3.39          -----------------ETEV---KKELKHDSIATN----LPDDNVKENNNATA------
Smik_3.54          -----------------ENEA---QKEIKHDKSDTI----LSNHDGKADSYKGD------
YCL024W            -----------------EDGA---EKGTESEKIAAS----LSDDDLKEDNDKKD------
TBLA0A07150        SEIISQQNESVQIRDDYKTKP---ERSNKADQSERA----PPAETTLNDVMTKR------
CAGL0K05709g       -----------------SSES---QKQIEKNNSDEG----GSLNPFMTKHRDVS------
AFR696C            -----------------KCVP---NQLSPRRRATER----APEKKLTKTVPERV------
Ecym_1058          -----------------NENK---ENEDPAGTTQQK----APLTSVGKELG--I------
KLLA0C01650g       -----------------NISS---TSDVSRTEVVKK----PPLNDVVRKNN-NE------
SAKL0C01716g       -----------------KSEP---KNALHSADAPEASQ--PPLNGMMRKNN--D------
KLTH0F01672g       -----------------KPEE---QKQVPPKDVESAP---APLNKVMKKNTEAE------
Kwal_33.13225      -----------------VTET---EEAAKNSTVVPT-APVAPLNNVMKKNTDAD------
TPHA0E03640        -----------------EEDK---VNSSPVVE--------APLNKVVNKTRAEN------
Kpol_2002.46       -----------------ENKS---EETLKEKNVEPK----PPLNDVVPKTRDTK------
NDAI0A00660        -----------------SQDH---GKDKP-----------IAINNPKQRLEVKP------
NCAS0B08600        -----------------VKKT---PVVEPESQATKK----INKPKQRQPKKEEE------
ZYRO0F17402g       AIDTASKERSKRTDRIDAKKPSSFQENLASAGASKG----PPLNDSMPKRRNEDPRNGST
TDEL0C06490        -----------------VLSI---KEDNAQVERQQE----APLNASIPKHRTDG------
KNAG0F00290        -----------------EGEP---EVSDLKAENIRK----APQPPITEKKKLDA------
KAFR0D04100        -----------------EKEI---KSMIPEAVIEEPKNVSPIEVQKTRKDQEHD------
Suva_2.687         -----------------EQKE---REDQQRGGKDLE----PPLNKSVQKTREKN------
Skud_4.783         -----------------GRED---QEKDAKGAKDIE----PPLNKSVQKTRAND------
Smik_4.789         -----------------SQEV---QEESEKEAKDIE----PPLNKSVQKLREKN------
YDR507C            HK---------------QEED---QEKREKVVDDME----PPLNKSVQKIREKN------
                                                                               

Suva_3.190         ----------------------------TIREYSNVS-----FLKKFSKGKI--------
Skud_3.39          -------EAPSR----------------IKKS-SNVS-----ILKNISKGKI--------
Smik_3.54          -------ISNI-----------------VRES-SHGS-----FLKKLSKGKI--------
YCL024W            -------NDTVNAPTT------------VKKP-PNSV-----LLKKFSKGKI--------
TBLA0A07150        -------NQSKSRDNPQPSE--------EGKK-GVNS-----FFRKFSKGSSRQSSNSSN
CAGL0K05709g       -------DKGVTKEKPTVTMKTTSEQVSADKK-RNMS-----FLRKLSKGSSS-------
AFR696C            -------IAAETFPPPN-----------TKKK---PS-----FFKKFSREK---------
Ecym_1058          -------REPLTDLAQQ-----------GVPK-KRPS-----FFRKFSKEK---------
KLLA0C01650g       -------RKPLEEITPK-----------VENK-RKIS-----FFRKFSQGSEK-----KL
SAKL0C01716g       -------RKPLEDITPA-----------AEKK-RNRS-----FFRKFSRSSEEK------
KLTH0F01672g       -------KNQPNQPAPN-----------AVKK-NNKS-----FFRRFSGKSDD-----EK
Kwal_33.13225      -------RKPLSDITPA-----------VEKK-ANKS-----FFRKFSSKGSD-----EK
TPHA0E03640        -------KSTSKGPSG------------SQKVSNTSS-----FLRKISGKSSNS----TV
Kpol_2002.46       -------KTNVVQNNNAKHS--------SDKP-RSTS-----FFRKISKGLTV-----QN
NDAI0A00660        -------ERQLDEIAPNKVGT-------TEKK-RNVS-----FFRKFSNNSA--------
NCAS0B08600        -------RKPLNEMPPN-----------VEKK-RNVS-----FFRKFSKSSAVS----TL
ZYRO0F17402g       AAKGENGRAPLKDITTN-----------SDKK-RNVS-----FFRKFSKSNEK-------
TDEL0C06490        -------AQKSERMPSKEG---------SEKK-RNTS-----FFRKFSKSSN------EK
KNAG0F00290        -------KKQRNDERTKA----------SKENTFSNN-----FLRKLSGQSNTTTQSVKK
KAFR0D04100        -------KRPVMEKKPEVVAPKQRESD-QEKK-RSVS-----FFRKFSGSSISS----NK
Suva_2.687         -------NDTQAKNQSTD----------PKPN-KNVS-GNGSFFRKFSKS----------
Skud_4.783         -------SGPQVKSHPRE----------PKKD-RNIS-GNGSFFRKFSKS----------
Smik_4.789         -------PGPQEKDHQRDHLKE------HKQD-RNTT-GNSSFFRKFSKS----------
YDR507C            -------AGSQAKDHSKDHLKE------HKQDK-NTAIGNGSFFRKFSKSS---------
                                                             ::..:*            

Suva_3.190         ------------------------------LELEIHAKIPAERLFEGLHKLLEGWKQYGL
Skud_3.39          ------------------------------LELEIHAKIPNKRLFEGLHKLLEGWKQYGL
Smik_3.54          ------------------------------LELDVRAKISEKRLYEGLHKLLEGWKQYGL
YCL024W            ------------------------------LELEIHAKIPEKRLYEGLHKLLEGWKQYGL
TBLA0A07150        KNKSLADDKNIPSVPKPVAHPASPVSTSNDYDFQLKANVAAPQMFKGLDTLFRGWSKYGL
CAGL0K05709g       --------------------------SKDNVDVTLSTSVSSKQLFSGLVNLLKGWTKYGL
AFR696C            --------------------------MHSDCDVQLDTTVGDSKMFRALNKLLNGWTSYGL
Ecym_1058          --------------------------IKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYGL
KLLA0C01650g       --------------------------GPESFDSQLKAGVSAPKMYKALDRLLNEWTNYGL
SAKL0C01716g       --------------------------KSDNFDAKLNTSVEAVQMFNALGKLLGGWKDYGL
KLTH0F01672g       --------------------------RPGEYDFKFDTVIEGTQMFNALSKLLAAWKDYGL
Kwal_33.13225      --------------------------KSGDYDFRFKTVIEETQMFNALSKLLAAWKDYGL
TPHA0E03640        --------------------------AKGAFEVNLYSSVTETQLFNGLQNLLKGWTNYGL
Kpol_2002.46       --------------------------DTTGYDVKLFSNVSVTQLYNGLFNLLKGWKDYGL
NDAI0A00660        --------------------------TIKGYDHEIYVNIGSRQLYTGLRKLLEGWTQYGL
NCAS0B08600        --------------------------TKNGFDYEVYVNVSAPQLYKGLLRLLQGWSKYGL
ZYRO0F17402g       --------------------------DTTGFDGEINTTVSAKQLFLGLQNLLHGWTQYGL
TDEL0C06490        --------------------------TNGEFDAELYASVAAKQLFNGLQNLLQGWKKYGL
KNAG0F00290        --------------------------TKLGAEDGIHTTVSATQMYQGLYNLLRGWGSYGL
KAFR0D04100        --------------------------SKAETEKVLVTNIAARQVFDGLRRLLNGWSKYGL
Suva_2.687         --------------------------STSEKSTELYAKVSAKQLFNGLEKLLRGWNQYGL
Skud_4.783         --------------------------STSDKSVELYAKVSAKQLFNGLEKLLRGWTQYGL
Smik_4.789         --------------------------SASDKLVELYAKVSARQLFNGLEKLLRGWTQFGL
YDR507C            -----------------------------DKTMELYAKISAKQLFNGLEKLLRGWTQYGL
                                                     .   :   .:: .*  *:  * .:**

Suva_3.190         KNLGFDTANMIITGKLVNDNILSLRSTLFEIIVL-PNRDDRSLIKFNKKTGSTKTLKKLG
Skud_3.39          KKLGFDAAKMIIKGKLVNDSILSLRSTLFEIIVL-PNGDDRSLIKFNKKTGSSKVLTKLA
Smik_3.54          KNLGINTADMIISGKLVNDGILSLRSTLFEIVIL-PNGSGRSLIKFNKKTGSTKTLTKFA
YCL024W            KNLVFNITNMIITGKLVNDSILFLRSTLFEIMVL-PNGDGRSLIKFNKKTGSTKTLTKLA
TBLA0A07150        KNIKSSPESLRFTGKVSSENILSFKSTVFELEII-SNSVKTCLLRFKKTSGSSKSVRRLV
CAGL0K05709g       KGIAIDSTSQTITGKLANDNILSFRSTAFSILIF-SQEKG-SAVTFRKVSGSGKAVRRLS
AFR696C            KEVRSMPASYTITGKLSSDNILSLRSTAFEIVIL-SVADTGSSVKFTKKSGSKKTFTRLV
Ecym_1058          KQVRSSPSVSMITGKLSSDNILSLRSTAFQVVVA-GSNHG-SSVRFTKKSGSKKTFARLV
KLLA0C01650g       KHVESSPNDFVISGKLTSDNILSLRSTGFKITVLPGEGNG-SIIQFTKKSGSTKTFNRLV
SAKL0C01716g       KEVRVQGPTKTITGKLSSDNILSLRSTMFEILVRDDSSKG-SVVWFVKKSGSTKTFKRLV
KLTH0F01672g       KDVVASPSQKKIKGKMSSDNMLSLRSTLFEISIV-SKGEG-SIVGFTKKSGSTKTFKKLV
Kwal_33.13225      KDVIASPSLKQIRGKLSSDNILSLRSTLFIITVV-GRGEG-SYVEFTKKSGSNKTFKKLV
TPHA0E03640        KDVKVDKQKKMIVGKLSNDNILSLRSTIVELCVF-TESKF-SVIGIRKKSGSSKTMRRLA
Kpol_2002.46       KEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVF-SEGKH-SVIGFRKKSGSSKTLKRLT
NDAI0A00660        KDVRSDNTAMKITGKLANDNILSLRSTLFELLVE-PKGSKYSLIGFTKVQGSSKVVRRLF
NCAS0B08600        KDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVE-SKGKQ-SVVGFNKISGSSKTVRRLF
ZYRO0F17402g       KDVRSHPEKMTLTGKLTSENILSLRSTLFEMVVW-SRGKV-SVVGFRKKSGSSKAMRRLV
TDEL0C06490        KGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVW-SRGKG-SIVGFRKKSGSTKTLKRLV
KNAG0F00290        KSIKGNSENMTITGKLASENILSLRSTIFEIIII-REGKG-SKVDIKKKSGSTKAVNRLA
KAFR0D04100        KNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVT-SNGES-SSVLIRKKSGSSKAVLRLT
Suva_2.687         KNVKSNPNNLTLTGKLSSENMFSLRSTLFEVSIY-QKGKV-SVVEFKKISGSFKTVKKLV
Skud_4.783         KNIKSHPNNLTLTGKLSSENIFSLRSTLFEISIY-PRGKM-SVVQFKKVSGAFKAVKKLV
Smik_4.789         KNIKSHPNNLTLTGKLSSENIFSLRSTLFEINIY-PKGRM-SVVQFKKISGSFKAVKKLV
YDR507C            KNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVNIY-PRGKM-SVVQFKKVSGSFKAVKKLV
                   * :        :  .: .:.:: :.** . : :        . : : *  *: * . .: 

Suva_3.190         YEIQIVLQKEGVLDS---
Skud_3.39          TEIQIILQKEGVLDK---
Smik_3.54          TEIQIILQKEGVLDE---
YCL024W            TEIQIILQKEGVLDK---
TBLA0A07150        NEVENVLRKEGVLLK---
CAGL0K05709g       DEVKKVLSKEGVLRD---
AFR696C            NEIEKILEKESVLVLAS-
Ecym_1058          NEIEKILEKEKVLISTN-
KLLA0C01650g       KEIEKILEKEKVLVFSF-
SAKL0C01716g       KEVEKVLERENVLTSTS-
KLTH0F01672g       KEIEKILESKKALVFNN-
Kwal_33.13225      KEIEKILESKKALVFSN-
TPHA0E03640        SEIEKVLSKEGVLQK---
Kpol_2002.46       SEVEKVLRKEGVLAK---
NDAI0A00660        TEIEKVLNKEGVL-----
NCAS0B08600        VEIEKVLRQEGVLSA---
ZYRO0F17402g       SEVEKVLLKEGVISK---
TDEL0C06490        SEIEKVLLKERVLTKESS
KNAG0F00290        GEVKNVLVKEGVMITIK-
KAFR0D04100        TEIENIFSKEGVLLP---
Suva_2.687         KEVENVLNKEGVLQK---
Skud_4.783         NEVENVLSKEGVLEK---
Smik_4.789         NEVENVLNKEGVLQK---
YDR507C            NEVENVLNKEGVLQK---
                    *:: ::  : .:     

FASTA FORMAT for MUSCLE Version 3.6

>Suva_3.190
-------------MAMAKPSNTIGPWRLGETLGSGSTGRVQLAQHERTGHKTAVKVISKT
IFDT---EDGGGX---------------XXLALPYNIEREIVVMKLLSHPNVLSLYDVWE
TNNNLYLILEYAEKGELFNLLVDRGPLPEKEAVKCFRQIIIAISYCHALGIVHRDLKPEN
LLLDNDYNIKIADFGMAALQTDARLLETSCGSPHYAAPEIVSGLPYRGFASDVWSCGVIL
FALLTGRLPFDEDNGNVRDLLLKVQRGQFEMPDATEISKDAQNLISRILVVDPTQRMKTR
DILTHPLLKKYQTIRDSKSIRNLPRENTYLYPLADAGNHTN--ATIDGSILQNLVVLWHG
RPADEIVANLKDNGTNTEKTLYALLYRFKQEANKRSRHKIKKTTKKN-------------
--------------------------------PPYPS--MSILSSSSS---HNRLSG---
-----------------------------STPRRRTPKRRSMNFSSSKKRSS--FILASN
SSNGSPMPSR-NSKRSSFFNTAS----ANVPPVPVKLLNSYK------------------
------------------------------------------------------------
RNS-KRSSKRLSYVPNVKRGSLTSKSLSKYTNLIDEDDWEYIEKDTKRTSSNFATLIDEI
FEPEKFELARREKAELQRKVQEAK------------------------------------
--------------------RGKSDVAKLNQENGNETG---------KSDAMEELKKIN-
-----------NKVSSPLIN-------YEYSQQELLQDINTLLTNRCQLSAYTRPISKLD
PGLMPTPETIPYDIKEKTD----------LLLDTEMKILETIRKSKILDSSLNLRKEVSR
DADRLPS----------------------------VEESPIAST-----TPLVYNN----
------------------------DSKEVCKISDIQVPHFTRKSKCFTPTNNRRSVLSLY
SSRHSFKGLSRILNSKDPSANPYSHING-PLSEEIDLTEDIANMK---------NIENNN
NNNNRLYD---------VSESAI--------LLQGNDDDDDDDDNENDDGSQSIQSSV--
-----------------SNNTEPTTFVKLPSLSSF----QEK------NASGLGIYQ---
-REPSIEPSIESS--------------IEP----LPNVTIAIEDV---------------
-----------------DEDG---ENEIQHENITTS----LSNDNIKKNDDTKD------
----------------------------TIREYSNVS-----FLKKFSKGKI--------
------------------------------LELEIHAKIPAERLFEGLHKLLEGWKQYGL
KNLGFDTANMIITGKLVNDNILSLRSTLFEIIVL-PNRDDRSLIKFNKKTGSTKTLKKLG
YEIQIVLQKEGVLDS---
>Skud_3.39
-----MTVANTETQTAAKSSSTIGPWKLGETLGVGSAGKVRLAQHEGTAHKTAVKIISKS
IFNTE--GNYGN----------------HGSVLPYNIEREIVIMKLLSHPNVLGLYDVWE
TNNNLYLILEYAEKGELFNLLVDRGALPEREAMKCFRQIIIAVSYCHALGIVHRDLKPEN
LLLDSDYNIKVADFGMAALQTDAALLETSCGSPHYAAPEIVSGLPYEGFSSDVWSCGVIL
FALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDDTEISKDAQDLISKILVVDPAQRIKIR
DILSHPLLKRYQTIKDSKSIKDLPREDTYLYPLADA----G--AAIDDSILQNLVVLWHG
RHADEIKAKLKASGTNTEKTLYALLYRFKLESMRESNKRRRHKTKKT-------------
------------------------------------KNRKFSTSSSLV---KGRNLE---
-----------------------------STPRKRTSKTHSNNFSSGKKRSS--FILSPN
SINSSPIPLR-NSKGISLRNATS----GGSPVVPVILLNSFK------------------
------------------------------------------------------------
RNS-KLSSKRSSYMPNLKSGSVTSRLLSNYNKLIDEDDWECIEKDTKRTSSNFATLIDEI
FEPEEFELAKREKVELQRKVRGSK------------------------------------
----------------------------MSDNIGDRSE---------FTDGMKELKRIN-
-----------AKVSSPLIN-------YEFSQQELLQDIDTLLTNRYQLSAYTRPISKLD
PGLMPAAGTTPHDIKEQTA----------LIRDTEVKIIETIHRSKFLGSLLNVREGMSK
DDDELAP----------------------------IEESSIIST-----TPLIYD-----
------------------------DRTEVRKISDVEVPHFTRKSRHFTAASNRRSVLSLY
SSRDSFKDLSQISKNEYSDSPSQRSVDDTSSSKKVGHTESLASVAEHIDDDSYNDHNSGM
NSDNVLYD---------VPEGVD-----LPQEVKNSDEQSSC-------------SLV--
-----------------SSSLEPTPVVELPSLSSF----QGK------NASGLGIYQ---
-REPSKVSLP----------------------TATIDTSDAVENR---------------
-----------------ETEV---KKELKHDSIATN----LPDDNVKENNNATA------
-------EAPSR----------------IKKS-SNVS-----ILKNISKGKI--------
------------------------------LELEIHAKIPNKRLFEGLHKLLEGWKQYGL
KKLGFDAAKMIIKGKLVNDSILSLRSTLFEIIVL-PNGDDRSLIKFNKKTGSSKVLTKLA
TEIQIILQKEGVLDK---
>Smik_3.54
-----MAVANMETYRITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKS
IFKSE--GSHGN----------------NDSVLPFNIEREIVIMKLLSHPNVLSLYDVWE
TDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPEN
LLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVIL
FALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIR
DILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADADNHTS--VTIDDSILQNLVILWHG
RPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMKETNKRSRSKINKT-------------
----------------------------------KKSKRVSTLSSSSS---S--AFNHQS
LD---------------------------SAPRKHASRGHSKNFPSSRKRSS--FILSSN
STDCSPIPLR-SSKRISISSAVP----GNTLQVPDSSLK-LK------------------
------------------------------------------------------------
RNS-KRSSKRLSYMPNLGRGSLTTNLLSNYTNLIDDDDWEYIDKDTKRTSSNFATLIDEI
FEPEKFELAKREKAELQKKVQEAK------------------------------------
--------------------RQVSKNAPISDEKDVGFE---------VSDGMRELKKIN-
-----------NKVSSPLMN-------YEFSQKELLQDIDTLLTNRYQLSSYTRPISRLD
PGLTPVTGAIPHSIKEKTA----------LLQDTEMKIIETIRKSEFLGSLLNVREGISQ
DNNQLAS----------------------------IEVSPKIST-----TPLMYN-----
------------------------DQVEIRKISDVEVPHFTRKSKHFTTANNRRSVLSLY
SLKESLEDLNQISKNEEPDSPPQGSTDNASKSELVDVIEEVTEQKNSQHDQDDSNDSNGM
NNNNILYD---------VPECVD-----SPQGYDINDAHSTQ-------------SPA--
-----------------SKSTEPKPVVKLPSLSSF----QRK------NASGLGIYQ---
-RESSRESLP----------------------SVTINISESDKTT---------------
-----------------ENEA---QKEIKHDKSDTI----LSNHDGKADSYKGD------
-------ISNI-----------------VRES-SHGS-----FLKKLSKGKI--------
------------------------------LELDVRAKISEKRLYEGLHKLLEGWKQYGL
KNLGINTADMIISGKLVNDGILSLRSTLFEIVIL-PNGSGRSLIKFNKKTGSTKTLTKFA
TEIQIILQKEGVLDE---
>YCL024W
-----MTVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKS
IFNNN--GNHSN----------------DDSVLPYNIEREIVIMKLLSHPNVLSLYDVWE
TNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPEN
LLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVIL
FALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIR
DILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADSNNHTS--ASIDDSILQNLVVLWHG
RHADDIVSKLKENGTNKEKILYALLYRFKLDSVRGSNKKNRNKIKKT-------------
----------------------------------KKNKRSSTLSSSSSLLLNNRSIQ---
-----------------------------STPRRRTSKRHSREFSSSRKRSS--FLLSSN
PTDSSPIPLR-SSKRITHINVAS----ANTQATPSGVPNPHK------------------
------------------------------------------------------------
RNSKKRSSKRLSYMPNTKRSSLTSKSLSNFTNLIDDDDWEYIEKDAKRTSSNFATLIDEI
FEPEKFELAKREKAELQRKVQEAKRQ----------------------------------
---------------------SVNAQKINEDEFG--SE---------VSDGMKELKKIN-
-----------DKVSSPLIN-------YEFSQQELLQDIDTLLTNRYQLSSYTRPISRLD
PGLTPVTETLPNNLKEKTA----------LLQDTEKKIIETIRRSKFLGSLLNVRGGLSP
GKSELAP----------------------------IEESPIVST-----TPLIYN-----
------------------------DRMEPRRISDVEVPHFTRKSKHFTTANNRRSVLSLY
A-KDSIKDLNEFLIKEDPDLPPQGSTDNESRSEDPEIAESITDSRNIQYDEDDSKDGDNV
NNDNILSD---------FPQGVG-----ISQEYDMKDKNPNQ-------------SPI--
-----------------SKSAEPTLVVKLPSLSSF----QGK------NASGLGLYQ---
-REPSKVTLP----------------------SLTSNNSSVGENI---------------
-----------------EDGA---EKGTESEKIAAS----LSDDDLKEDNDKKD------
-------NDTVNAPTT------------VKKP-PNSV-----LLKKFSKGKI--------
------------------------------LELEIHAKIPEKRLYEGLHKLLEGWKQYGL
KNLVFNITNMIITGKLVNDSILFLRSTLFEIMVL-PNGDGRSLIKFNKKTGSTKTLTKLA
TEIQIILQKEGVLDK---
>TBLA0A07150
------MVKLTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKA
VFNND-NANASDSALL------------TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWE
TDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPEN
LLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIIL
FALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTR
EILKHPLVQKYPSIKDSKTIRNLPREDTYLNPLSDDN---GDVCEIDPKILQNLVVLWHG
RDSKEITKKLKEPGANAEKTLYALLDRFKNDTEKEIKRQSQLKKRQSQ------------
------VQQTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASMVSVSSA---HKRPVSFNR
LSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSINLSSNKRISQ--LLANDL
--NTSPTPSN-CTKRMSII--------NGTPPVPMDIMKNYNDANMATTVSSSTTVTTSN
PISTLNNMPHTRYTNDTNTNLTDINNNKRNSVINTKYTNPANSTQISTNGQTSDSAAQNV
NRA-SRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNI
FEHEKYEQIRKEKDELERKVRENKKREEEERLVR-EAIEKEKQIELEKE-----------
---------------------RLQLQKEMEGDIDNAKETVQTTEGKREAHNDKIKTETDD
EERDIIVDIQPRSVSAPLEK-----------TEKSRDSPFDYSKQR-NFSLRTRPVSRLD
PGLMYSSGTGSSAYNPSHSTEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDLKKELEM
VEELESNRIKQQAFQDSHLEEMNDVTEDLSQHNVDTSNDRIVST-----TNDRYETEILP
KSHAGKTQTIGLND----------SSVQPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLY
SSRESFTNLVDMLKEDGINVEPTERS---PTTK-SQEPEFLFESP------SVDTYSRDS
STEDKPIN---------EKENSE---PIQSNNLRLSFHDRFNRQLSTEDTEKTKNSPSGH
IKDEPKKDDDNGVDLSTPKAKDESNLVKLPALPPL----TTK------KTDGLGIYQKSK
QRTSSNASNPITPSSTNAQLTSAAVNVTPPTTTMINESIQKLQESREKVNNSSKLIPPKN
SEIISQQNESVQIRDDYKTKP---ERSNKADQSERA----PPAETTLNDVMTKR------
-------NQSKSRDNPQPSE--------EGKK-GVNS-----FFRKFSKGSSRQSSNSSN
KNKSLADDKNIPSVPKPVAHPASPVSTSNDYDFQLKANVAAPQMFKGLDTLFRGWSKYGL
KNIKSSPESLRFTGKVSSENILSFKSTVFELEII-SNSVKTCLLRFKKTSGSSKSVRRLV
NEVENVLRKEGVLLK---
>CAGL0K05709g
------MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKA
VFEAMNNSESNGD---------------ATNALPYNIEQEIIIMKLLNHPNVLRLFDVWE
TNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPEN
LLLDNKLNIKIADFGMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVIL
FALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIR
EILKHPLLQKYPSIKDSRSIRNLPREDTYLSPLADTN---S--K-IDDAILQNLVILWHG
KDAREIAAKLREPGANTEKTLYALLYRFKCDTQREANRARRQSKIVQ-------------
---------RNSTIRSTAPESPSKKKT----YTPQKKNKRASIIASSS----KRPVSVTK
TATNITVNSS-------------------ITGTPKSAKRMSMNNSARKRMSA--LYGT--
--RDSPTKTS-RSRRSSIITK-DFL--GNRPRDSVISMSHN-------------------
------------------------------------------------------------
KRA-SKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYIERETKRTSSDFATLIDEI
FEYEKYEQIRKEKAELERKVRETKEREERERKER---QEKELQERLERE-----------
------------RIEK----QKEDIARQMDEEISNLKK---------ELVGDQDNEDKF-
-----------RSVSEPLES-------KSKKIEDIEEDIDGILRNR-KYSLQTRPVSRLD
PGIGFIDKPRQSEQHVPETVNLE-P----ELEETEQKILETIRRSKFLGSSFDIKKELEN
VKRHR------------------------------QTSQPIEKE-----MAPPALPETLP
KAVEKKNVS---------------MDPSLRKISDIKVPQFTRKSRHFSTSNRRLSVLSMY
STKESYSNLADILKNGPGEKEMIQTA---PTPKSADDSDQLFDTI------DEADTPASV
SREERLYE---------VAEESE----NELANKKIDIADLLNSE----------GSNL--
-----------------KSVEEQEDSMKLPKLPPL--------------------FE---
----DGSTKETKE--------------QSK--SMIPENMQ--------------------
-----------------SSES---QKQIEKNNSDEG----GSLNPFMTKHRDVS------
-------DKGVTKEKPTVTMKTTSEQVSADKK-RNMS-----FLRKLSKGSSS-------
--------------------------SKDNVDVTLSTSVSSKQLFSGLVNLLKGWTKYGL
KGIAIDSTSQTITGKLANDNILSFRSTAFSILIF-SQEKG-SAVTFRKVSGSGKAVRRLS
DEVKKVLSKEGVLRD---
>AFR696C
-------MGDKNNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKS
VFNA------QGSTFVGSN---------DPDVLPYGIEREIIIMKLLNHPNVLRLYDVWE
TAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPEN
LLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVIL
YALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTR
EILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDHND---G--T-IDQAILQNLVVLWHG
RDKNEITMKLKEPGANLEKTFYALLHRFKFENEQQQLKQQQIAKRISST-----------
------SSSPQQNIVKSSSRRSINNIL----STPKKK-RSSAINVSSA---HKRPVSIQK
LNDCG------------------------TLNPTSPSKKRSL---SNRKLSA--VL----
--AGSNSSSP-SRKRMSVG--------QDAPPVPTAVLRDYN------------------
------------------------------------------------------------
KRA-SRASKRLSFLPS-KRGSITTKIIATYAKLSEDNDWEYIDREAKRTSSDFATLIDNI
FEHEKYEQIRREKEELERKVREAKEREERERRARAEAERRKREEEERRR-----------
------------RREVEELIRQRELQKSLEEQVARLKA---------EVAATKQEKRISL
AQEQHV-----RSISEPMERKGTRP-SKRDSFLALQNNINSLLKRR-TLSLETRPISRLD
PGIRLSEENTILEDDLECNE---------DRLRVEKNILETIRRSKFLGSQYDIDKELQR
VRREKLEKVNMRKSQDRKLEPGLHSRQEQRF----VSDGTTVTS-----SHEDSESIILP
KNVTAIGV---LKD----------EESEPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMY
STKVSYTNLADYLN-NDVQLKSLQPSAP-TSIKIPQEPEFMFESA-----GQENRYQAAA
PTDTYLER-------PKVGVEGDHEPGEPVELIELDDSEDRS---------------K--
-----------------QYSEEDIAKVKLPILPPL----DHL---N--KPNGLGIYQ---
-APAPPKEPLGQP--------------VMK--SMIPDDIKI-------------------
-----------------KCVP---NQLSPRRRATER----APEKKLTKTVPERV------
-------IAAETFPPPN-----------TKKK---PS-----FFKKFSREK---------
--------------------------MHSDCDVQLDTTVGDSKMFRALNKLLNGWTSYGL
KEVRSMPASYTITGKLSSDNILSLRSTAFEIVIL-SVADTGSSVKFTKKSGSKKTFTRLV
NEIEKILEKESVLVLAS-
>Ecym_1058
------MGTKDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKS
IF------NAQGSTFVGSN---------DPDVLPYGIEREITIMKLLNHPNVLRLYDVWE
TSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPEN
LLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVIL
YALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTR
EILKHPLLKKYPSIKDSKSIRNLPREDTYLNPLDHND---G--T-VDRTILKNLVVLWHG
RDENEIVMKLNEQGPNLEKTFYALLHRFKYENEQQQLKQQQIAKRISSA-----------
------SSSPQRNIVKSSSRRSINQIL----VTPKKK-RSSGINVSSA---HKRPVSIQK
WGEIGGG----------------------NNGLISPSKKRSL---SNRKLSA--IL----
---NTPSSSP-SRKRMSIA--------QDAPPMPTSVLRDYN------------------
------------------------------------------------------------
KRA-SRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDWEYIDKEAKRTSSDFATLIDNI
FEHEKYEQIRREKEGLERKVREAKAREARERKEREERKQREEREREERRALERKEQEARE
REEMEDEEQLRLEEDEQEILRQEELQRSLEDEVAKLRA---------ELEETRVEQQLNS
MSKNQVAR---RSVSEPHKRHSSTS--KRDSLLALQYSINTVLNKR-AVSVQTRPISRLD
PGIMAQEVAHELDYDDEEILSE-------RTLRREKTILETIRRSNFLGSQFDIHKELKN
AKKEKIEKAKKRKQL-NRKLPDRISYHDQRF----VSDGTTITS-----AHDGYDTTSLT
RHTTVGV----LRD----------DESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMY
STMTSYTNLADFMK-SDVQLKPLNDT---ASSKVTQQPEFMFEST------IDNVERISS
NDNSHISS---------MEAPNN-------TVIKLNYADRFYKPVEVIELDDT-DNTQ--
-----------------PDTEEDITKVKLPALPPL----EKL---NK-SPNGLGIYQ---
---HSSPREDFKH--------------AVR--SVTP------------------------
-----------------NENK---ENEDPAGTTQQK----APLTSVGKELG--I------
-------REPLTDLAQQ-----------GVPK-KRPS-----FFRKFSKEK---------
--------------------------IKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYGL
KQVRSSPSVSMITGKLSSDNILSLRSTAFQVVVA-GSNHG-SSVRFTKKSGSKKTFARLV
NEIEKILEKEKVLISTN-
>KLLA0C01650g
---------MNGNGITTLKGDTIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKS
IFN------AQGSTMIGGN---------DPDVLPYGIEREIIIMKLLNHPNVLRLYDVWE
TSKDLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPEN
LLLDHKFNVKLADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVIL
YALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTR
EILKHPLLRKYPSIKDSKSIRNLPREDTYLNPLSLEG---GNQC-VDETILQNLVVLWHG
RNKEDIITKLMEPGANLEKTFYALLHRFKHDNYQDQLKQQELQKKQS-------------
------VSSNSLMYVGSLPSPNKSDSP----VTTPKKKRTSIIVASSS---HKRPVSMQK
LSSQHSS----------------------PVKNGSIGKRLSKTFPSNKRISQ--LV----
--SNSSSPTPAAHKRVSRIND------SAAPPVPKEMLRDYK------------------
------------------------------------------------------------
RQS-KRQSKRFSLLPNMKRGSITTKLIATYAKLSEDSEWEYIEKETKRTSQDFATLMDQI
FEHEKYEQIRKEKEELERKVNEAREKEEAERKER-ERIEREEQERLERE-----------
------------ERKRAE--RQKELQDQMEDEIAKLKA---------EYEAVQGSSDERN
TANG-------RSVSAPIETDRTAN--KRDSTFGIKNDINELINTR-NFSLQTRPVSRLD
PGIIAAESRLSANLED-------------DQASKEKTILETIRRSKFLGSQFNLNVELEK
AQKDLVSKER-------------------------QEQLRKYSE-----QTAKYEVQKLP
KNAKAVAT---LRD----------DEVEPRKLSEVKVPQFTRRSKHFSSSNKRFSVLSLY
STKTSFTNLVDHLK-NDNYLEPLPGQPEYSSSKVAQEPEFMFETV------------EEL
DENSKLFE---------VPETEE---GKLASAARKESTDA--------------------
-----------------RKQSTNDKDINLPSLPPLQVSHDVA---DENGALGLGIYQ---
--PNDQTQKPHKT-------------------MLIDESIDE-------------------
-----------------NISS---TSDVSRTEVVKK----PPLNDVVRKNN-NE------
-------RKPLEEITPK-----------VENK-RKIS-----FFRKFSQGSEK-----KL
--------------------------GPESFDSQLKAGVSAPKMYKALDRLLNEWTNYGL
KHVESSPNDFVISGKLTSDNILSLRSTGFKITVLPGEGNG-SIIQFTKKSGSTKTFNRLV
KEIEKILEKEKVLVFSF-
>SAKL0C01716g
MSTHSRQNSIISSPLTTLKNDKIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKS
IFGAV--AQNNSSTIVGSN---------DPDLLPYGIEREIIIMKLLNHTNVLRLYDVWE
TKSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPEN
LLLDHKFNIKIADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVIL
YALLTGRLPFDEDNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTR
EILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDHGD---G--S-IDDGILQNLVVLWHG
RDRNEIVAKLNEPGANLEKTFYVLLFRFKHDVHQQQQQQQQQQQQQQQQQQQQQQQQQQQ
SRQSGYVSPKKLAMKKSASRKSITSTSLSGTTTPKKKNRVSMISVSSS---HKRPVSFNK
LSTAGKSDSA-------------------CGTPGSSTKRMSISLSSSKRLSA--M-----
--GPNTSPTP-ANKRMSVRDM-D----SSAPPVPMDVLNDYTSAL---------------
---------------------------------------------------PN---RKAT
KRA-SRASKRLSFLPNIKRGSITTKLIATYAKLSEEDDWEYIEKETKRTSADFATLCDQI
FEHEKYEQIRKEKQELERKVREAKEREERERRKRQEEQEEQERKRRAEE-----------
-------ERVLRELEDA---KQQELQELMAKEVAMLRA---------DYGEPQTEPEEQG
ASKN-------RCVSAPIASSSAKDDGKRDSIARLSGDIDDLLKRR-TVSLQTRPVSRLD
PGIVAAENLGSVIYEEADGVDE-------TTLRTEKTILETIRRSRFLGSSFDIKKELER
AQRKKEEALARQHQQRI------------------LSSATAASA-----TNDAYESRALP
KNAAAVDT---LNDE---------RNPEPRKISEIKVPQFTRRSRHFTASNKRLSVLSMY
STKSSFTNLADHLK-GGADLQEVSGSAP-STTKITQEPEFLFESVHE----EDSEETPDT
TADSRLYE---------VPDGSESSKTSTKAAMRLNFADRFN------------------
-----------------TRAGDNPADVKLPPLPPL----EKN---GSKKPNGLGIYQSPE
RPRADPNPTSMVH--------------EPKVFSMIPDDIAGPAKSTKPAESENVPTSATK
-----------------KSEP---KNALHSADAPEASQ--PPLNGMMRKNN--D------
-------RKPLEDITPA-----------AEKK-RNRS-----FFRKFSRSSEEK------
--------------------------KSDNFDAKLNTSVEAVQMFNALGKLLGGWKDYGL
KEVRVQGPTKTITGKLSSDNILSLRSTMFEILVRDDSSKG-SVVWFVKKSGSTKTFKRLV
KEVEKVLERENVLTSTS-
>KLTH0F01672g
MSTHSRQNSVVKSTLTTLKGDKIGPWKLGSTLGAGSTGKVVMAQHESTGQQAAVKIVSKS
IFG----NQSNSSTIVGSN---------DPDVLPYGIEREIIIMKLLNHPNVLRLYDVWE
TNSSLYMVLEYVEKGELFNLLVDRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPEN
LLLDHKFNIKIADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGIIL
FALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPDTNEISGEAQDLIAKILTVDPAARIKSR
GILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVD---G--T-IDDTIIGNLVVLWHG
RDRNEITNKLKEPGANLEKTFYALLFRFKHDSQQEQLKQQRRSQAMQ-------------
------VSPKKTGLRKSNSRRSINS------TTPKKKTRAPVISASSS---HKRPVSFSR
LSYSNGSNTD-------------------HNTPNSSGKRSSVNLSSNKRISA--LI----
--NPNSSPTP-ASKRASLREL-D----PSAPPIPVDMLKDYNKAA---------------
---------------------------------------------------P-----KAN
RKS-SRISKRLSFLPGNKRGSITTKLIATYAKISEDNDWEYIEKETKRTSADFATLCDEI
FEHEKYEQIRREKEELERRVREAKEQEERERRQREEEERRQREEELARQ-----------
-----------REFEEERYHRQREVQENIDREMALLKE---------GYETSSGVDPNKN
-----------RSVSAPVESVLKVD--KRSSMDALDGDIMDLLNRR-TFSLETRPKSRLD
PGIYTLEEVPNSDIKDGG-----------RDLKTEKTILETIRRSKFLGSSFDINKELAR
ERRLKEERAAALKQR--------------------KKEDRVVSNATGNYSENGYEPQTLP
KNAAATKI---SND----------AGSDPRKISEVQVPQFTRRSRHFTASNKRLSVLSMY
STKASFTNLADHLR-GKTDLQSINGSPP-STSRMEPETEFMFESV-D----GEGKETADT
SADSRLYE---------VAEGND-PKGAARSAVRLNFADRFNKP----------TSPP--
-----------------PQSVEDPNGIKLPSLPPL----DKA---KSDGVNGLGLYQ---
-PASDSSETEIHH--------------QPK--SMIPVDAEQKEAAEA-------------
-----------------KPEE---QKQVPPKDVESAP---APLNKVMKKNTEAE------
-------KNQPNQPAPN-----------AVKK-NNKS-----FFRRFSGKSDD-----EK
--------------------------RPGEYDFKFDTVIEGTQMFNALSKLLAAWKDYGL
KDVVASPSQKKIKGKMSSDNMLSLRSTLFEISIV-SKGEG-SIVGFTKKSGSTKTFKKLV
KEIEKILESKKALVFNN-
>Kwal_33.13225
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------MRRLR---
----------------------------SCP-----------VLPYHGFESDVWSCGIIL
FALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQDLIAKILTVDPAARIKSR
EILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVN---G--S-IDESIINNLVVLWHG
RDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQASH-------------
------ISPKRSNMRNSVSRRSITN------VTPKKKNKAPVISASSS---HKRPVSFNR
LSFNNGSNTA-------------------HTPPTSASKRASVNLSSNKRISA--LI----
--NPNNSPTP-VHKRSSMRDL-D----ASAPPIPMDMLKDYNKSA---------------
---------------------------------------------------P-----KVS
RRS-TRLSKRLSFLPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFATLCDEI
FEHEKYEQIRKEKEELERRVREAKEQEELERRQREEEERLQREMELQHQ-----------
-----------MRLEEESRRRQRETQELIEQEIALLKQ---------SVNPQGPSDSNH-
V----------RSVSAPAESVLKVD--KRGSTGNLDNDIMALLNRR-TFSLETRPKSRLD
PGIYTSEEEDFGSKNHG------------ADLSTEKTILETIRRSKFLGSSFDINKELAR
ERRLKEERAALAKRK-----------DEERV----ASNATTANV-----VGNGYESQTLP
KRKMGSAM-------E--------ASSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSMY
STKTSFTNLADHLK-GKADVQLIQTSPP-SASKMDQEAEFMFESV-----DKEGKETADT
SADSRLYE---------VAETKD--AKNAKPAVKLNFADRFNRP----------TSPP--
-----------------SQDTDSSAAIKLPALPPL----DKN---KPNMVSGLGLYQ---
-ATAEPSHEDAQP--------------VAK--SMVIDDVESEITTEPRNT----------
-----------------VTET---EEAAKNSTVVPT-APVAPLNNVMKKNTDAD------
-------RKPLSDITPA-----------VEKK-ANKS-----FFRKFSSKGSD-----EK
--------------------------KSGDYDFRFKTVIEETQMFNALSKLLAAWKDYGL
KDVIASPSLKQIRGKLSSDNILSLRSTLFIITVV-GRGEG-SYVEFTKKSGSNKTFKKLV
KEIEKILESKKALVFSN-
>TPHA0E03640
-------MLKANISDVTVTGNNIGPWKLGETLGFGSTGKVQLATNEQTNQQAAIKIISKS
VFDHLVNSNNNNNSALAASDVNNGSVQHNQEALPYGIEREIIIMKLLNHTNVLRLYDVWE
TNNNLYMVLEYAEKGELFNLLVEKGPLAENEAVRFFRQIIIGMSYCHALGIVHRDLKPEN
ILLDHKSNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYNGLETDIWSCGVIL
FALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTR
EILKHPLLQKYPNIKDSKTIRDLPREDTYLNPLADNN---GVDTEIDESILQNLTVLWHG
KDKNEIIKKLKEPGANAEKTLYVLLHRFKEDTERENHKNSQLRKRQS-------------
-------------LMKASSSSSSNQGN----VPRRRKNRNSMISVTSS---HKKPVSYNK
IAMVGGSSKDVISLPSS------------SNTTPASSKRISLSLSSSNKRNSR-LYTQSN
--SSSPTPAP-RSRRSSNQNLINKE--SEAPPIPVDVLKDYNKIS---------------
---------------------------------------------------------NQN
KRG-SRLSKRYSFLLNNKRGSVTTKIMSTYAKLAEDDDWEFIEKETKRVSSDFATLIDEI
FEHEKFEKIRKEKEELERKVIEAKQKEERERKEAEAAAKEEARVRREKE-----------
----------LARMNK----EEEQLQNDIDEEARLLKD---------EFNFVNDETQENP
INS--------RSVSEPVKN-----------------GGTDEKGQR-NFSLQTRPISRLD
PGLMFSKLGDVDNNSSVDEN---------LTMNNQKTILETIRRSKFLGSSFDINKELNN
ANEERKRLRQLQLQK------------QKEL----EEKERIAST-----SYVSNENQVLS
KNAIGVVD---LKDFS--------SDVEPRKISEVQVPQFTRKSKYFSESNKRLSVLSFY
SSKQSYTNLVDMIKENPVEDE-----------DVTEDPGFNFEDS-QYDYLEEKNEAPLE
VSDEVPKE---------VDDKVQ-EEEKNSVSMKLNFADRFS------------NVNS--
-----------------NTKQESSFEDKFP---NI---LSKS------GTEGLGLYS---
-KNEKTEPKPVK--------------------SMIP------------------------
-----------------EEDK---VNSSPVVE--------APLNKVVNKTRAEN------
-------KSTSKGPSG------------SQKVSNTSS-----FLRKISGKSSNS----TV
--------------------------AKGAFEVNLYSSVTETQLFNGLQNLLKGWTNYGL
KDVKVDKQKKMIVGKLSNDNILSLRSTIVELCVF-TESKF-SVIGIRKKSGSSKTMRRLA
SEIEKVLSKEGVLQK---
>Kpol_2002.46
-------MISSNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVISKS
VFSSM----GNNSSMVSS----------TPDSLSYGIEREIIIMKLLNHPNVLRLYDVWE
TNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPEN
ILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVIL
FALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSR
EILKHPLLQKYPSIKDSKTIRNLPREDTYLNPLIGND---GGDATIDKTILQNLVVLWHG
RNEDDIAKKLREPGANAEKTLYALLYRFKVDSEQEALKNSQIKKRQS-------------
------------IISNNNLKSGNINTT----TPQKKKNRNSVISVSSS---HKRPVSLNR
LSTIQNGKDVISVPSS-------------SNTTPGSSKRISMSLSSNKGSK---ILPQSN
--SGSPTPAP-RNKRMSVQNL-ETS--SNPPPIPVDMLKDYGNST---------------
---------------------------------------------------SS---HANA
KRA-SRISKRLSVLPNAKRGSITTKIISTYAKLSEDDDWEFIEKETKRVSSDFATLIDEI
FEHEKYEQIRKEKEELERKVRENKEREERQKRQK---EVELAAIARERE-----------
------------ELQR----RLEEEETQITKELQQDTK---------NFQEDEVVHKNV-
-----------RSISSPVEN------------GNEAKSEEDASGQR-SFSLQTRPVSKLD
PGIKCGSNKPVQMEEIVEDELD-------KTIDSQKVILETIRRSKFLGSSFNIDKELKQ
VKKDAE-VKRMRKSQ------------KEDR----DVSGRIVSE-----TNEQYETQVLP
KNATAFGA---LKDDS--------EEVEPRKISDIQVPQFTRKSKLFTDSNKRLSVLSIY
SSTQSYTNLANVLKEGGVDIGVNEGS---NNVEVSEEPEFQFETV-G--------TEIEN
NKYEEEKE---------IENENN---LSQGANIKLNYADRFD------------------
-------------------TAGNVNEVKLPTLPPL---GDDK------VSDGLGIYS---
-SKSGSEGNESKP---------------------VPSIK---------------------
-----------------ENKS---EETLKEKNVEPK----PPLNDVVPKTRDTK------
-------KTNVVQNNNAKHS--------SDKP-RSTS-----FFRKISKGLTV-----QN
--------------------------DTTGYDVKLFSNVSVTQLYNGLFNLLKGWKDYGL
KEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVF-SEGKH-SVIGFRKKSGSSKTLKRLT
SEVEKVLRKEGVLAK---
>NDAI0A00660
--------MTSVVGETKMKGDTIGPWKLGKTLGLGSTGKVELAYNETTSQQAAIKIISKS
IFSQ---GTVGESSMVSNS---------SPDALPYGIEREIIIMKLLRHPNVLSLYDVWE
TNSKLYMILEYAEKGELFNLLVERGPLPEKEAIRFFRQIIIGISYCHALGIVHRDLKPEN
LLLDHKLNIKIADFGMAALETKDKMLETSCGSPHYAAPEIVSGVPYHGFQSDVWSCGVIL
FALLTGRLPFDEEDGNIRNLLLKVQSGEYEMPDDDEISKEAQDLIGRILTVDPEQRIKTR
DILKHPLLQKYPSIKDSRSIKNLPREDTYLYPLSENN---S--I-IDDSILQNLVALWHG
RDKDDIAGKLRESGADAEKTVYALLYRFKVEAEKMNTC----------------------
-------------------------------SSPRRKNRISMISVSSS---HKRPVSMKK
ISTV-------------------------QNNTPPSNRRLSISLSSTQRKRMSGILQHT-
--NSSPTPS--RTKRISVINI-DDSENKAPPPVPMEMLEDYKNNS---------------
---------------------------------------------------KNVRRTIKK
KKK-KKNNYRLTLV-NNKRVSITTKLLSTYAKLSEDDNWEYIERETKRTSSDFATLIDEL
FEHEKYERIRKEKEELERKVRETRVREQR-------------REEEERA-----------
------------ELQR----EQLKLQQKIDEEISKLKE---------DA----LEKDNF-
-----------RSVSAPIKE-----------NEDEDENENELRNRR-QFSLQTRPVSRLD
PGILYSAPAEIPSYERVVVNESGNK----SSAQQQRKILETIRRSKFLGSSFNIQQELEF
SQRNVLV----------------------------PTKEQVVDV-----DEVK-------
------------------------LEGGLRKISEVKIPQFTRKSRHFSDSNKRLSVLSMY
STKQSYTNLGHILKDGTEESEPAKKT-----------PELLFES----------------
GRDDRLYE---------VSEEPE---I---------------------------------
-----------------QEEKEDIETVTLPQLPPLKQSANTNANANETEINGLAIFR---
-PKENIELEDITK--------------EVK--EVIP------------------------
-----------------SQDH---GKDKP-----------IAINNPKQRLEVKP------
-------ERQLDEIAPNKVGT-------TEKK-RNVS-----FFRKFSNNSA--------
--------------------------TIKGYDHEIYVNIGSRQLYTGLRKLLEGWTQYGL
KDVRSDNTAMKITGKLANDNILSLRSTLFELLVE-PKGSKYSLIGFTKVQGSSKVVRRLF
TEIEKVLNKEGVL-----
>NCAS0B08600
----MTTLAENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKS
IFNTK--PNSNETSMVAN----------TPDSLPYGIEREIIIMKLLRHANVLSLYDVWE
TNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPEN
LLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVIL
FALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTR
EILKHPLLQKYPSIKDSKSIKNLPREDTYLFPLSDNN---S--V-IDPSILQNLVVLWHG
RDKEQIAAKLKESGANAEKTIYALLYRFKIEAENLSAKQEQVKRKQS-------------
-----------------IIKKSTANVS----TPPRKKNRISTMSVSSS---RKRPVSFNR
LPTISNGKTNNIIPNGRNGDS--------NNTTPKSNKRLSINLSSNKRLSNLLVQGHSN
GNSNSPTPS--RSKRISLINLDN----STAPPIPVNVLKDYKNKS---------------
----------------------------------------------------------SS
SKN-KRASKRLTFLGNGKRGSITTKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEI
FEHEKYEQIRKEKEELARKVREAKEGEARERREQ---ESEKQRKQRERE-----------
------------ELER----QQLELQNHIDQEISNLKA---------DLANETKGAEPYE
NP---------RSVSAPLER---------ENPEAIERDINDLFARR-NVSLQTRPKSRLD
PGILYSAPAETVSNPLLSDID--------QEIDREKKILETIRRSRFLGSSYNINKELEF
AKKTAL-----------------------------AETSKKEKR-----SKVTSQNIVAD
KAAIGVIP---LND----------TEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMY
STKQSYTNLGDILKEGGVNLASEANNT--TTSKASTEPEFQFESV-------------NE
GTANKLYE---------LQEEPE-------------YTDVN-------------------
-----------------KEDGKPKKNVKLPTLPPL----HEK----TNQANGLAIYQ---
-SSSDDDKKPTEP--------------QPKSQSMIPERQDSINNSAS-------------
-----------------VKKT---PVVEPESQATKK----INKPKQRQPKKEEE------
-------RKPLNEMPPN-----------VEKK-RNVS-----FFRKFSKSSAVS----TL
--------------------------TKNGFDYEVYVNVSAPQLYKGLLRLLQGWSKYGL
KDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVE-SKGKQ-SVVGFNKISGSSKTVRRLF
VEIEKVLRQEGVLSA---
>ZYRO0F17402g
------MSGMNKRSAPTVRGDKVGPWKLGETLGFGSTGKVQLACNEITQQSAAVKEISKA
IFSAK--TAPGNSSIAAS----------TPDPLPYGIEREIIIMKLLNHPNVLRLYDVWE
TNPSLYMVLEYAEKGELFNLLVENGPLPENEAVCFFRQIIIGVSYCHALGIVHRDLKPEN
LLLDHDLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDIWSCGVIF
FALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPDDDEISPEAQDLLAKILTVDPECRIKPR
EILKHPLLQKYPNVSDNKSIRNLPREDTYLHPLSDSG---S--SEVDQNILQNLVVLWHG
RPAGEIAAKLKDPGANAEKTLYALLARFKNDTEREAARQKQIKKRSS-------------
---------------LNGTGAGVNNNH----VSPKKRNRASTINASSS---HKRPVSLIK
LSGSSNSNSNSNP----------------SSTSTTPPKRMSVNLSSNKRLST--VKTQGN
--GGSPTPAS-RSKRVSIIES-DKN--GGAPPVPIDMLKDYNKTP---------------
----------------------------------------------------------NS
KRL-SRASVRLSFKPTNKRGSVTTKLISTYAKLSEEDDWEYIEKETKRTSSDFATLIDEI
FEHEKFEQIRKEKAELERRVKETKEREERERKER---EEKELNEKLEND-----------
------------ARQK----REMEAQEAQGDDGTDTES---------DVHSNNQAPNGV-
-----------RSVSAPLERK------KRDSMVNVQSDIEEIFGQR-TMSLQTRPVSRLD
PGLFYAEESNEPEAGDTEEE---------KKLRTQKNILETIRRSKFLGSSFDIGKELQN
EELKKKASQ--------------------------PHRDRTVSQ-----TNEPYDTRVLP
TQAVATAP---L------------RDQEPRKISEISVPQFTRKSRFFSDSNKRLSVLSMY
STKHSYNNLSNLLNDSDASDGRLNSAAEYSDVKGKKEPEFQFEAV-REASDEDNGISRLS
NNDERLRNVSGTSGGSGVPHDNL---SSK-HNMKLNFADRFSADEP--------TAGS--
-----------------SNSSSASKNVKLPTLPPL----DGT-----SEANGLGIYQ---
-SSSESFRDIVEP--------------TPK--SKLQDNSSNPEQEVEEEVAGREGSVKHS
AIDTASKERSKRTDRIDAKKPSSFQENLASAGASKG----PPLNDSMPKRRNEDPRNGST
AAKGENGRAPLKDITTN-----------SDKK-RNVS-----FFRKFSKSNEK-------
--------------------------DTTGFDGEINTTVSAKQLFLGLQNLLHGWTQYGL
KDVRSHPEKMTLTGKLTSENILSLRSTLFEMVVW-SRGKV-SVVGFRKKSGSSKAMRRLV
SEVEKVLLKEGVISK---
>TDEL0C06490
------MAAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKA
IFNVK--GSVKDSSVAAS----------TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWE
TNSNLYMVLEYAQKGELFNLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPEN
LLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVIL
FALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKAR
DILKHPLLQKYPSINDSKSIRNLPREDTYLHPLSEGE---S--AEIDENILQNLVVLWHG
REQLEIINKLREPGANAEKTLYALLDRFKSDTENDSVKHPQSKKRVS-Q-----------
------INPVRQPTTKKAPSKPQTN------ASPKRRNRTSMISVSSS---HKRPVSFNK
LSNVVSPGSVP------------------SSNSNTPSKRVSVNLSSNKRLSA--VYTN--
--SGSPTPAS-RHKRVSIVDL-ERERENDTPPVPIEMLKDYSSTA---------------
----------------------------------------------------------KQ
KRL-SRNNMRLSFKPSNKRGSITTKLISTYAKLSEDDDWEYIEKETKRTSSDFATLCDQI
FEHEKFEQIRREKEELERKVRETKEREERERREK---EIEEKRKIQEKQ-----------
------------DLER----RQLEIQRQMDEEVANLGK---------ELQGGMNADQDAD
EGDEHGAVNG-RSVSEPLQKK------SADPMADLQANIDDLLRQR-TFSLQTRPVSRLD
PGVFSSDSSEKDQYTGSEDR---------AKLNNDKIILETIRRSKFLGSSFDINKELKR
AADNEAKKQRQSK----------------------ATSDRIIST-----TNDEYETQILP
KNATASAP---LKDHN--------HQAEPRKISDIKVPQFTRKSRQFGDSNKRLSVLSMY
SSKQSYTNLADLLNEEASNAKGNRDS---PNDQSGHEPEFLFENV-Q----EDGEVTGDS
SHDGRLYE---------VPEDSN---MTK-EKLKLNFADRFK------------TSNG--
-----------------EDRTAEDKNVRLPTLPPL----DGK------EAKGLGIYQ---
-SSSESLPEPAQH--------------NVK--SMIQNDENQPSETAE-------------
-----------------VLSI---KEDNAQVERQQE----APLNASIPKHRTDG------
-------AQKSERMPSKEG---------SEKK-RNTS-----FFRKFSKSSN------EK
--------------------------TNGEFDAELYASVAAKQLFNGLQNLLQGWKKYGL
KGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVW-SRGKG-SIVGFRKKSGSTKTLKRLV
SEIEKVLLKERVLTKESS
>KNAG0F00290
--------MITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKT
IF-----QDSNVTSMVDNT---------TPDALPYGIEREIVIMKLLNHANVLRLYDVWE
TNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPEN
LLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVIL
YALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITAR
DILKHPLLQKYPSIKDSKSIRNLPREDTYLHPLAETN---S--A-IDENILQNLVVLWHG
RDPAEIRVKLKEHGANAEKTLYAMLNRFKLDVEQENLKNEHLKNRQS-------------
------GGQSTSMAPATNQSTAVNRSSGNKNTTPRKKNRASVISVTSS---HKRPISFQK
LPTLNSTSSLA------------------AITPSTSARRKRLSKISGYPVSN--V-----
--NGSPTPAS-RKKRNSMANI------QAARSSTIKKTNTF-------------------
------------------------------------------------------------
KKN-NRASKRVSILPNNKNGTIASKLISTYAKLSEDDEWEYLEQETKRTSSNFATLIDEI
FEHEKYEQIRKEKEELARKVREAKEREEAERKQK---ELQEREKQRERE-----------
------------RKEN----ETNDRQRIMEEEIENLKK---------ELDMMSHEGKTE-
----------SRSVSEPLNK----------KQGGVEIEVKELLRQR-NAALQTRPKSRLD
PGLFFDSAESDTRNPSLQVFEGEVD----NKLKTEKAILETIRRSKFLGSSFDISKELKS
ASARSDYS---------------------------RAPGRVITA-----PSNLERSDVLP
KNAIATAP---LRIHS--------DQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMY
STRQSFKNLSDMMNFESENTDAAENRGQIATPNSAGQSEFLFESV-N----EEAENTNNT
STDGKLYE---------VSESPE---SSSKKGLRVNLSDRYN------------------
-----------------KANSEADMENKLPILPPL----DPE-------IAGLGIYQD--
-QPEEVNAKPQEK--------------KSK--SKSAETGDIS------------------
-----------------EGEP---EVSDLKAENIRK----APQPPITEKKKLDA------
-------KKQRNDERTKA----------SKENTFSNN-----FLRKLSGQSNTTTQSVKK
--------------------------TKLGAEDGIHTTVSATQMYQGLYNLLRGWGSYGL
KSIKGNSENMTITGKLASENILSLRSTIFEIIII-REGKG-SKVDIKKKSGSTKAVNRLA
GEVKNVLVKEGVMITIK-
>KAFR0D04100
--------MTASNNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKS
VFNN---NSAQSSSLT------------TPDALPYGIEREIIIMKLLNHPNVLRLYDVWE
TNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPEN
LLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVIL
FALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRAR
DILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLSDNN---S--T-IDKTILQNLVVLWHG
RDVNEIISKLKEPGANAEKTLYALLDRFKIDSEKENFKNEQIRKRQS-------------
-------------ITSSVSRSPAKKAS----TPQRRKNRISMISVSSS---HKKPASFNR
LSSVVHNNL--------------------SASSSTTTTPASKKFSMNKKLSM--IADKSN
SNNSSPTPAH-RNKRTSMINT------DRQSILSKN------------------------
------------------------------------------------------------
KRA-SRSSKRLSVMANMKRGSITTKLIATYAKLSEDDDWEYIEKETKRTSSDFATLIDEI
FEHEKYEQIRKEKEELARKVRLAKEREEEERRRR---EEEELHKLNEEK-----------
------------KFEA----QQLQLQRQMDEEIENLRA---------DLKGDVEPNQEKN
EDNY-------RSVSVPLSK---------------ETVNDNLLRQR-NFSLQTRPISRLD
PGLFFSEQSPTEEKPISPDEPVP-N----KKLDTEKMILETIRRSKFLGSSFDINRELKA
AEKRV------------------------------MQPPTVQKL-----TTENKSSDELP
KHAVGTAA---LNS----------STAEVSKISDIRVPQFTRKSRHFTTSNRRLSVLSMY
STRQSFSNLVDILKNTEAGTELGQRT---PTPHSAGDSEFIFETV-N----EEAEYTGNS
SNDDKLYE---------VADLDA---AEKPSGMKLNFADRFN---K--------KEED--
-----------------STEPSRDIQNKLPVLPPL----DGK--------AGLGIYQ---
-TSSPIEPQLLER--------------PVKGDKFMETISSDNEKP---------------
-----------------EKEI---KSMIPEAVIEEPKNVSPIEVQKTRKDQEHD------
-------KRPVMEKKPEVVAPKQRESD-QEKK-RSVS-----FFRKFSGSSISS----NK
--------------------------SKAETEKVLVTNIAARQVFDGLRRLLNGWSKYGL
KNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVT-SNGES-SSVLIRKKSGSSKAVLRLT
TEIENIFSKEGVLLP---
>Suva_2.687
-------MAVNGNSIQAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA
VFNS---GNVSGTSIVGSN---------TPDALPYGIEREIIIMKLLNHPNVLRLYDVWE
TNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPEN
LLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVIL
FALLTGRLPFDEEDGNIRALLLKVQKGEFELPSDDEISREAQDLISKILTVDPERRIKAR
DILKHPLLQKYPSIRDSKSIRDLPREDTYLTPLSESN---S--S-IDATILQNLVILWHG
RDPDGIRAKLQEPGANAEKTLYALLYRFKCDTQKELIKQQQIRKRQS-------------
-------------IGSVSISPPKRTST----TPQRRRNRESIISVSSS---RKKPISFNK
FTASSASSS--------------------NLTTPGSSKRLSKNFSSKKKLST--IVN---
--QSSPTPSS-RNKRTSIANV-D----KNQKRASIFSTTKKN------------------
------------------------------------------------------------
KRA-SKSTRRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEI
FEYEKYDQIRKEKEELERKVKEAKALEELERRKRKQEEKERARKLLEKE-----------
------------ELKR----KQEELKKQIDIDISDLEH---------ELINHREEKFEGN
I----------RSISAPMEN-------EENNINHLEADIDNILRRR-NFSLQTRPVSRLD
PGIIFSSPIETEDPVEPKKAEN-------ERLTTEKKILETIRRSKFLGSSFNIDKELKL
SQMEYPGMAAPQR----------------------LSEERIVSD-----SNGKYESLVLP
KDAKGVAH---LKDNTAPTTTELLSNGELRKISDIRVPQFTRKSRHFSESNKRLSVLSMY
STKESFTNLVDILKNGNLDINPQQNQRV-PTPRSADDSEFLFETV-N----EEAEYTGNS
SNDERLYD---------VGDSCI---KDK-NTLKLNFADRFN---------------G--
-----------------STNEKETKNLHLPTLPPL----NGK--------DEAGKQG---
-EEQEKEDLHEQP--------------KVK--SMIPESDSLSHAEK--------------
-----------------EQKE---REDQQRGGKDLE----PPLNKSVQKTREKN------
-------NDTQAKNQSTD----------PKPN-KNVS-GNGSFFRKFSKS----------
--------------------------STSEKSTELYAKVSAKQLFNGLEKLLRGWNQYGL
KNVKSNPNNLTLTGKLSSENMFSLRSTLFEVSIY-QKGKV-SVVEFKKISGSFKTVKKLV
KEVENVLNKEGVLQK---
>Skud_4.783
-------MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKA
VFNA---GNMSGTSIVGSI---------TPDALPYGIEREIIIMKLLNHPNVLRLYDVWE
TNTDLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPEN
LLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVIL
FALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKAR
DILKHPLLQKYPSIRDSKSIRGLPREDTYLTPLSESN---S--S-IDATILQNLVILWHG
RDPDGIKEKLKEPGANAEKTLYALLYRFKCDTQKELIRQQQIKKRQS-------------
-------------ISSVSTSSPNKIST----TPQRRKNRESIISVTSS---RKKPISFNK
FTASSASSS--------------------NLTTPGSSKRLSKNFSSKKRLST--IVN---
--QASPTPAS-RNKRTSIINV-D----KNQRRASVFSTAKRN------------------
------------------------------------------------------------
KKT-SRSTKKLSLIPSMKRESVTTKLMSTYAKLAADDDWEYIEKETKRTSSNFATLIDEI
FEYEKYEKIRKEKKELELKVREAKAREELERRKRKQEEKEHSRKVLEKE-----------
------------ELKR----KQQELKKQIEIDISDLEH---------ELSKHKEEKPDGN
I----------RSISAPMES-------EEKNINHLEVDIDNILRRR-NFSLQTRPVSRLD
PGIMFSSPVEKESAVEPKRTEN-------ERLTTEKKILETIRRSKFLGSSFNIEKELKL
SKMEYPSMVPPQR----------------------LSEERIVSD-----PSDDYGSLVLP
KDARGYSQ---LEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFSESNKRLSVLSMY
SSKESFTNLVDILKNGNIDVHKQQSQRI-PTPKSADDSEFLFETV-N----EEAEYTGNS
SNDERLYD---------VGDSTI---KDK-SALKLNFADRFN---------------A--
-----------------STNEKETENLHLPTLPPL----NGG--------DEVN------
-KQKDEDVLGIQP--------------KVK--SMIPQSDSSSHTGKEEEKEEKGEE----
-----------------GRED---QEKDAKGAKDIE----PPLNKSVQKTRAND------
-------SGPQVKSHPRE----------PKKD-RNIS-GNGSFFRKFSKS----------
--------------------------STSDKSVELYAKVSAKQLFNGLEKLLRGWTQYGL
KNIKSHPNNLTLTGKLSSENIFSLRSTLFEISIY-PRGKM-SVVQFKKVSGAFKAVKKLV
NEVENVLSKEGVLEK---
>Smik_4.789
-------MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKT
VFNT---GNVSGTSIVGST---------TPDALPYGIEREIIIMKLLNHPNVLRLYDVWE
TNADLYLVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPEN
LLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVIL
FALLTGRLPFDEEDGNIRTLLLKVQKGEFELPSDDEISREAQDLISRILTVDPERRIKTR
DILKHPLLQKYPSIKDSKSIRGLPREDTYLTPLSESN---S--S-IDATILQNLVILWHG
RDPDGIKEKLRETGANAEKTLYALLYRFKCDTQKELVKQQQIKKRQS-------------
-------------ISSLSISPSKKLST----TPQRRKNRESMISVSSS---RKKPISFNK
FTASSASSS--------------------NLTTPGSSKRLSKNFSSKKKLST--IVN---
--QSSPTPAS-RNKRASVINI-E----KNQKRASVFSTAKKN------------------
------------------------------------------------------------
KRT-SKSIKRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEI
FEYEKYEQIRKEKEELERKVREAKAREELERRRRRQEEKERTRKLLEKE-----------
------------ELKM----KQEELKKQIEMDISDLEQ---------ELSRHKEEKPDGN
I----------RSISAPMEN-------EEKNIDHLGTDIDNILRRR-NFSLQTRPVSRLD
PGIVFSNPIETVYPVEPKRSEN-------ERLTTEKKILETIRRSKFLGSSFNIEKELKL
SKMEYPSVLAPEK----------------------LSGERVVSD-----LNGKYESLILP
KDAKGVSQ---LKDDITSTTTEHLSDGKLRKISEVRVPQFTRKSRHFSESNKRLSLLSMY
STKESFTNLVDILKNSNLDVNNQQSQRI-PTPRSADDSEFLFETV-N----EEAEYTGNS
SNDERLYD---------VGDSTI---KDK-TALKLNFADRFN---------------E--
-----------------STEYKETDNLHLPSLPPL----SGD--------DEMR------
-KQNSEEDSLVQP--------------KVK--SMIPQSDSSSHTEKVEEKEGE-------
-----------------SQEV---QEESEKEAKDIE----PPLNKSVQKLREKN------
-------PGPQEKDHQRDHLKE------HKQD-RNTT-GNSSFFRKFSKS----------
--------------------------SASDKLVELYAKVSARQLFNGLEKLLRGWTQFGL
KNIKSHPNNLTLTGKLSSENIFSLRSTLFEINIY-PKGRM-SVVQFKKISGSFKAVKKLV
NEVENVLNKEGVLQK---
>YDR507C
-------MAINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKA
VFNT---GNVSGTSIVGST---------TPDALPYGIEREIIIMKLLNHPNVLRLYDVWE
TNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPEN
LLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVIL
FALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTR
DILKHPLLQKYPSIRDSKSIRGLPREDTYLTPLSESN---S--S-IDATILQNLVILWHG
RDPEGIKEKLREPGANAEKTLYALLYRFKCDTQKELIKQQQVKKRQS-------------
-------------ISSVSVSPSKKVST----TPQRRRNRESLISVTSS---RKKPISFNK
FTASSASSS--------------------NLTTPGSSKRLSKNFSSKKKLST--IVN---
--QSSPTPAS-RNKRASVINV-E----KNQKRASIFSTTKKN------------------
------------------------------------------------------------
KRS-SRSIKRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEI
FEYEKYEQIRKEKEELERKVREAKAREELERRRRKQEEKERARKLLEKE-----------
------------DLKR----KQEELKKQIEIDISDLEQ---------ELSKHKEEKLDGN
I----------RSISAPMEN-------EEKNINHLEVDIDNILRRR-NFSLQTRPVSRLD
PGIMFSSPTEEVSPVEPKRTEN-------ERLTTEKKILETIRRSKFLGSSFNIDKELKL
SKMEYPSIIAPQR----------------------LSEERVVSD-----SNDGYESLILP
KDGNGVSQ---LKDSTATTAPV--SDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLSMY
STKESFTNLVDILKNGNLDVNNQQSQRI-PTPRSADDSEFLFETV-N----EEAEYTGNS
SNDERLYD---------VGDSTI---KDK-SALKLNFADRFN---------------G--
-----------------SNEAKQTDNLHLPILPPL---------------NGDNELR---
-KQNSQEGDQAHP--------------KIK--SMIPESGSSSHTEKEEENEEKEEKKPEQ
HK---------------QEED---QEKREKVVDDME----PPLNKSVQKIREKN------
-------AGSQAKDHSKDHLKE------HKQDK-NTAIGNGSFFRKFSKSS---------
-----------------------------DKTMELYAKISAKQLFNGLEKLLRGWTQYGL
KNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVNIY-PRGKM-SVVQFKKVSGSFKAVKKLV
NEVENVLNKEGVLQK---