MUSCLE (3.8) multiple sequence alignment

CAGL0L08492g       ----------------------------MF-KFNLESITQSISEGTQS-------LVQQ-
KNAG0A07930        ----------------------------MFSNFSLDKLTSTITNAAQS-------AQDTI
KAFR0G03680        ----------------------------MFSNFNFDKITNSISTAAQS-------AQQKI
AFR309C            -------------------------MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHL
Ecym_1238          -------------------------MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQL
TBLA0D02980        MLHATRYTLHTTHYTLYSPTSPPPQMSGYFSNFSLDKLADSLQSAAQK-------TQDTL
Kpol_1017.7        ----------------------------MFSGFSIDKLTDSISNVALK-------TQENL
TPHA0D03270        ----------------------------MFSNFSLDKLTDSISNVALK-------TQENF
KLLA0E04621g       ----------------------------MFSKLSLNNITDSISNAAQR-------TQEQF
ZYRO0D10010g       -------------------------MSEYFSSFSFKNLGDSIANAAHR-------TQDKL
NCAS0F03540        ----------------------------MFSNFSLDKITNSLATAAQK-------TSDTL
SAKL0F02794g       -------------------------MSGYFSSFSLDKLTNSISSAAHK-------TQDKL
KLTH0F14806g       -------------------------MSNYFGGFSLNKLTNSITNVAHK-------TQDTL
Kwal_55.21227      -------------------------MSSYFGGFSFNKLTDTLTNAAHK-------TQDTL
NDAI0B05850        ----------------------------MFSSFSLDKITNSIGNAAQK-------ATNTL
TDEL0D05590        -------------------------MSGYLSNFSLNKITDTLANAAHK-------TQDTL
Suva_16.477        -------------------------MSGYW-----NKITDSIATAAHK-------TQDTL
Skud_16.443        -------------------------MSGYFSGFSLNKITDSIATAAHK-------TQDTL
Smik_16.401        -------------------------MSGYFSSFSLNKITDSIATAAHK-------THDTL
YPR148C            -------------------------MSGYFSGFSLNKITDSIATAAHK-------TQDTL
                                                      ..: .::   :           :  

CAGL0L08492g       --------------FNDPKTKLSIKAKTRFLQEAIGNE-RD-ISKLPPQYVVLEKKCDSI
KNAG0A07930        HNTIL---------SPDAQTKLQFLKTTRYFQEKVGTISEDEIAKLPEGYQRLQEKSEAM
KAFR0G03680        NDTIL---------TPDVQTKLHFKKTARFWQEKVGQIPDKEISKLPEGYLNLENKVDAL
AFR309C            THAIQ--NIK----IDDPKTILSLKTRKRQLQETLGSA-KD-ISQLPPQYGFLERKCDAI
Ecym_1238          THAIH--SIN----LDDPQTMLSLRTRKHQLQETLGTI-KD-ISKLPPRYQFLERKCDAF
TBLA0D02980        SNAIQNVNID----WNDPQTRLTLLSKQHYLQESIGQI-NE-ISKLPSQYNALERKTDAL
Kpol_1017.7        TNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLGTI-NDQPSKLPPTYTDLELKTDAI
TPHA0D03270        TNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLGTL-DDEISKLPQQYVELEIKTDSV
KLLA0E04621g       SSAIE--KIH----LDDPETRLSILKRRHQLQETLGTV-HD-ISQLPIQYKFLEQKSDAL
ZYRO0D10010g       SNAVA--NVN----LNDPQTRLSIKTRTRYLKETLGAV-DE-ISKLPPQYVLLERKSDAL
NCAS0F03540        SNAIT----T----ATDPATKLSLRSQKRLFQESIGTV-HD-ISTLPEQYTTLEARTDAL
SAKL0F02794g       STAIA--NIQ----LDDPQAKLSLKVRKHYLQETLGAI-DD-ISKLPPQYQFLEKKCDSL
KLTH0F14806g       STAIA--NIQ----LDDPQAKLSLKARKHYLQETLGTI-ED-ISKLPPQYQFLEKKCDSL
Kwal_55.21227      STAIA--NIQ----LDDPQAILSLKARKHYLQETLGTI-ED-ISKLPPQYQLLEKKCDSL
NDAI0B05850        NNAIN----T----ATDPQTKLSIKSQTRLFQEQLGTI-HD-ISKLPDQYKSLELKTDSL
TDEL0D05590        NSAIA----N----VSDPQAKLSLKARTRYLQETLGTI-DD-KSKLPPQYQSLEKKSDAL
Suva_16.477        NSALANANVN----LNDPQTRLSIKSRTRFVQESLGTV-SD-ISKLPPQYQFLEKKSDSL
Skud_16.443        NNALASANVN----LNDPETRLSIKSRTRFVQESLGTV-SD-ISKLPPQYQFLEKKSDSL
Smik_16.401        NNALANANVN----LNDPQTRLSIKSRTRFVQESLGTI-SD-ISKLPPQYQFLEKKSDSL
YPR148C            NNALANANVN----LNDPQTRLSIKSRTRFVQESLGTV-SD-ISKLPPQYQFLEKKSDSL
                                   *  : * :    .  :* :*    .  : **  *  *: . ::.

CAGL0L08492g       EKVLKRILIVTKTYEIEGYDYPPNISESLSSWW---------QTKEWF-NISELTKNVIP
KNAG0A07930        EKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNE----------------------DEN
KAFR0G03680        EKILKRLLIVTKTYEIEGYDYPPNLSESLNDWW-------------WS-DLKKSKKHQEK
AFR309C            EQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTS------TKETRFLKFGKGGTDKQK
Ecym_1238          EKVCSRILVVSKTFEVDGYDYPPNLAESISDWWGSSS-----KKDGVFWGFGKKSKNDKN
TBLA0D02980        EKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPLAFLRDNDNTN-DKNKSNSNPPD
Kpol_1017.7        EKALKRLLTVTKTYETEGYDYPPNLTESLSDWWTN-------DDNVTN-T----DENDEN
TPHA0D03270        EKILKRLLLVTNTFATEGYDYPPNLTESISDWWAE----------------------DET
KLLA0E04621g       EKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSG-------NKDSIF-SF---SKKKAE
ZYRO0D10010g       EKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSG-------SKEGWF-G---STKQDED
NCAS0F03540        EKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSL-------SSK---------KKKEQE
SAKL0F02794g       EKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGA-------NRSGLL-SFMDGKKGEGS
KLTH0F14806g       EKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSS-------NKEGLF-GFVSSSKKEKK
Kwal_55.21227      EKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSS-------NKEGLF-GLMSSSKKDKG
NDAI0B05850        EKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNI-------TKKSSS-H----RKKQIS
TDEL0D05590        EKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSL-------NKDGWF-G----TKKPEK
Suva_16.477        EKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSL-------NKDGWF-G----SKKTEH
Skud_16.443        EKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSV-------NKDGWF-G----SRKSEN
Smik_16.401        EKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSL-------NKDGWF-G----SKKSEI
YPR148C            EKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSL-------NKDGWF-G----SKKSES
                   *:   .:* *:.*:  :******* .**:. **                           

CAGL0L08492g       KHGNVEKAGTEASK---------------TLTDKEVSHEGPPSFASAIARAGKDSQLIFE
KNAG0A07930        KKKKTQDFGDS------------------SIL--------NRSFAIAIGKAVLDSQYILS
KAFR0G03680        S----------------------------SFM--------NNSFPMAISKAAFDSKSILD
AFR309C            EDKQKQAAGSSD----------------------------PPSFAHALHRAAKGSQGIIQ
Ecym_1238          KAEQKSSAEKKSNE---------------GYI--------PPSFAQAISKAADDSITILK
TBLA0D02980        TKSKSDSDSES------------------SFL--------PRSFPHAISKASSDSSAILT
Kpol_1017.7        IQSNK------------------------SFL--------PRSFAQAISNASFDAASNVN
TPHA0D03270        TENK-------------------------NFL--------PRSFAQALAKAYSDSKLITD
KLLA0E04621g       VSPEVKETAEN------------------GLL--------PRSFAQALSKAATDSALILK
ZYRO0D10010g       GESKIQTDGSSKD----------------PLM--------PRSFAQAIAKASHECGEAYQ
NCAS0F03540        KEDKK------------------------GFL--------PRSFAQAISNSAEDCVEIYQ
SAKL0F02794g       RAKAEEKDENE------------------GFL--------PRSFAQALSKAAKDSGDVLR
KLTH0F14806g       LEPAEDSKE--------------------ALM--------PRSFAQAISKAAKDSGEVMT
Kwal_55.21227      AESAAAAKS--------------------ALM--------PRSFAQAIAKAAKDSGDVLA
NDAI0B05850        VNNKKKNNTDNDHDNATNVEPIENDITSSSFL--------PRSFAQAISKSAMDCTDIYQ
TDEL0D05590        T-KNDSSDGSD------------------AFL--------PRSFSQAISKAANDCNSVFT
Suva_16.477        ASKKKDSNHDD------------------TFL--------PRSFAQAISKAAVDCESEFK
Skud_16.443        ANKKKVSNHDD------------------AFL--------PRSFAQAISKAAVDCECEFQ
Smik_16.401        TNKKKGSNHDD------------------AFL--------PRSFAQAISKAAVDCEFEFQ
YPR148C            STKKKGSNHDD------------------AFL--------PRSFAQAISKAAVDCECEFQ
                                                             **. *: .:   .     

CAGL0L08492g       SI-------------------------------------ETKDEDEKEDIDELVKIFKIW
KNAG0A07930        DLKEQQKTRGTEEKKVKREEEAEAAEEEDEADDGEQEAEDEEEEEEDIDMNNMISAFGLW
KAFR0G03680        DLKEKQQDL----------------------PKEGEEPEEEVEEEDDDEFLNLLEVFNSL
AFR309C            EL------------------------------KEQAEEEQEQEVEIDEDVESLIKMFGTW
Ecym_1238          EL-----------------------------NEEQLVNPSNGAETEDEDVDSLMPILEAW
TBLA0D02980        NLNNNEKL------------------------EFAKTKTEDEEYEDDEDIQLLIKVFDSW
Kpol_1017.7        SVTNTIKL---------------------------NHKDDEEEEEDDEEWSDLHKIFESL
TPHA0D03270        KAERNIKLQTSPKNTGTKDENP---------EAGAEEEVEADDDEEDEDLVTLGKAFKAL
KLLA0E04621g       QLKAEETRTNQEESQEGADQKPAE---ETK-AEPELEAEADEDEDEDEDVDNLIKAFESW
ZYRO0D10010g       NS----------------------------------QKSEKKQIDEDEDDVNLVEMFNTL
NCAS0F03540        HVNDGDDEDKE--------------------ENANNEEENEEEDEEDEDVKNLIKTFDSW
SAKL0F02794g       TL-----------------------------KDEQKEPPQDEDEDEDEDINSLITMFEAW
KLTH0F14806g       AL------------------------------KTEEQKASAEEDEEDEDITSLIKMFEAW
Kwal_55.21227      AL------------------------------KDQEQQASADEEDEDEDITPLIKMFSAW
NDAI0B05850        QLSIQETATKETTIKDENEAQEE--------DDEDAGEEEEEDDDDDEDIQNLIKAFESW
TDEL0D05590        NL-----------------------------------QEHGDEDEEDEDVSNVAKMFDSW
Suva_16.477        NLEQNEKEDLKQKKEAKKTTQET--------AEQEEEEEEEEEEEDDEDLSNLIKVFDSW
Skud_16.443        SLKQDEKAGLKKKSESNET------------AQDAEAQEEDEEDEEDEDLSNLIKVFDSW
Smik_16.401        NLENDEKAELKKKRESTKNAQTT------GAQDEENEEDEDEEEEEDEDLSNLIKVFDSW
YPR148C            NLEHNEKAELKKKKESIKTAQTTE---AQGADHNEEDEEDEEDEEDDEDLSNLIKVFDSW
                                                                 . :   :   :   

CAGL0L08492g       SDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEV-A
KNAG0A07930        SNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRHKL-K
KAFR0G03680        SNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLRHEI-K
AFR309C            ADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKYEQ-H
Ecym_1238          AEAQSNIDEAKQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYEL-E
TBLA0D02980        SLCNKNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRYEIAK
Kpol_1017.7        GNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLRKSVENSRLKFDTMRYEL-K
TPHA0D03270        SNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDV-K
KLLA0E04621g       TKCQLSIDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEI-K
ZYRO0D10010g       SICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEM-R
NCAS0F03540        AKCYKNIDQGKAEMDSMMMKEFNAKLEKLLNEEFKKVHTLRKRVKDSRLKFDTVRYEL-K
SAKL0F02794g       SKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRKKVEESRLKFDTLRYEL-N
KLTH0F14806g       SACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKVEDSRLKFDTMRYEL-K
Kwal_55.21227      SECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEV-K
NDAI0B05850        SNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEI-K
TDEL0D05590        SKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVEESRLKFDTVRYEI-K
Suva_16.477        STCYKNIDEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEG-K
Skud_16.443        STCYKNIDEGKAEMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEV-K
Smik_16.401        STCYKNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEV-K
YPR148C            STCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEV-K
                     .  .:.  * : *  : .:** **   :: .*         *  :** ***:.:.   

CAGL0L08492g       QTSKQTDSK------------------------------ELGNEDETKPS----------
KNAG0A07930        LKELEKEAR----------------------RQVMEEVAEQQAEASGEPVRKRKSRAHGA
KAFR0G03680        LKELAQESI----------------------RQENSQKTDVFKEDSTKEVPPKEESTKEE
AFR309C            ERDAALAKK---------------------------------------------------
Ecym_1238          MRKSGASQT------------------------------KETFTTIESQQ----------
TBLA0D02980        AAEAKVRAE------------------------------ENDKPVEMEKG----------
Kpol_1017.7        IKEWKRTXX------------------------------XMEAEDKSDVS----------
TPHA0D03270        LKEAKAEQE------------------------------EAKEVSTDKEI----------
KLLA0E04621g       LKLQEKEVV------------------------------ASSEEAEKKVA----------
ZYRO0D10010g       LKEKEEKEE------------------------------NENTANADEGP-----SNKNQ
NCAS0F03540        VKEEKAKIAEAAASNAAVTLTTTEEEKPEEEEKPTTDIKKEEDSTIKDESASKEEPIAKT
SAKL0F02794g       LKEKEQQKA------------------------------KAKEEENEKVD------VVEQ
KLTH0F14806g       MAEEQGKTE---------------------------------------------------
Kwal_55.21227      LTEQQSKQA------------------------------MENEKAQFKES----------
NDAI0B05850        IKEEEQDQK-----EKQAQAQAQAQAQEQEQEQEQGEKAKKEQEEEQEQAQLGDNVIEES
TDEL0D05590        LKETENAKK---------------------------------------------------
Suva_16.477        SKEEQLRAQ----------------------------KDETSKEADNNDNSANSTSLEEA
Skud_16.443        SKEAKLKAQ----------------------------KAETSKEVDDKAV-----SANAP
Smik_16.401        AKEAQLDAQ----------------------------KPGVTEEAHTKDV-----SANTA
YPR148C            AKEAELEAK----------------------------KAEATGEAHSKDVSAKDISANTT
                                                                               

CAGL0L08492g       -SMDANKTNTEEKEA-----------ANDKVETKEKTETNATIADETKETKDT-------
KNAG0A07930        QGGRKSTTEEAEKTSASENDSSKKSGKASGKSKKGKETAEEPQTEPKEAPPAAEAKEEPP
KAFR0G03680        QVNEESNKEETEKKKITED-------KPAEDVVEKKTVEEQAEAKETEKPAKEGSSKEEA
AFR309C            --QDEAKQAEGATPS-----------T---------------------------------
Ecym_1238          VNDKDKENEDNLKPT-----------IHN-------------------------------
TBLA0D02980        -EGEDEGEGEGKGKG-----------KGKGETASTSTETASTSTTKDAAATIESQKKD--
Kpol_1017.7        ----KKGTSKKETPK-----------KEASKKETPKKEINK-------------------
TPHA0D03270        ----EKKESETKEPE-----------TKGTEEKEPETKDTEE------------------
KLLA0E04621g       ---TETPETPEKKT----------------------------------------------
ZYRO0D10010g       QEPTNEPAKEEEKPT-----------PAEPAEAQHTTK----------------------
NCAS0F03540        PSKEDTKTKKEGKPA-----------EKSTETATEATEAKEKALPKVPTTETEETGAESA
SAKL0F02794g       NAPEEKAKTEGQETS-----------EGKEHDLKADEKLSEDTASKI-------------
KLTH0F14806g       ---EAAQQTESQKPQ-----------E---------------------------------
Kwal_55.21227      ----DLSSKEEGADA-----------NETSNEVGK-------------------------
NDAI0B05850        KKKEEVIKDEKKKPE-----------IKSGTETTSKQLETEAEPKAEVEAKVNDTSKDQL
TDEL0D05590        -------STETDEAS-----------K---------------------------------
Suva_16.477        LTAEKKAEKEDDAKV-----------PE---EEPKKVETDVTTANDDIDTNEN-------
Skud_16.443        ISPDENPTTEDESP------------ISKDLEGDSKKETSGSAADDAAVVKEDS------
Smik_16.401        TSLNEIPSTVDEKQK-----------SNVNTEAESKKEANEQVADDAVVMKEDP------
YPR148C            TSFDETPSTEDEKPK-----------SE-GAEEESKKEANEPTVDDVADRKED-------
                                                                               

CAGL0L08492g       ---------KDSEDLKEDSKTSTDGQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIK
KNAG0A07930        AK-------ETAPAKESNEAEEEENKLLERLEDEFVSNITAAVEKMTELTDSSELISLVK
KAFR0G03680        PK-------EDVKHNGSSEEETEEYKLLEKLEDEFVSNTGAAVELMTELTETSEVINLVK
AFR309C            ------------GVTQSSTADLAFYAQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVK
Ecym_1238          ---------NTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVK
TBLA0D02980        ---------SPNPEFEKNDSQNEDEKLLEHLEDEFVSHTSAAVETMEEITESSKILDLIK
Kpol_1017.7        ---------KEDITNEGNTENDNDNKLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVK
TPHA0D03270        ---------KDPVKENEGENEDEDYKLLEQLEDEFVSNTSSAVEKMEELTDSAKILDLVK
KLLA0E04621g       ---------NEEPVDMAKTEEDPDSKLFERLEDQFVSATSETVEFLGELTDSSEIISLVK
ZYRO0D10010g       ---------TENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMK
NCAS0F03540        TKVDEEKASEDKKTDKAIEDDSEEHKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVK
SAKL0F02794g       ---------PESVENEEVDNEDPEHKLLEKLEDEFVSSTTEAVEIMGEITDSSEILSLVK
KLTH0F14806g       ---------DEAEASKDSDSSDEAQKLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVK
Kwal_55.21227      ---------SVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVK
NDAI0B05850        KK-------EDDAEKQDEQDDSEEHKLLEQLEDEFVSSTASAVEMMTEITESSSIIGLIK
TDEL0D05590        ---------DETKTEEEPPKTSEEDKLLEELEDEFVSNTTAAVEIMGEVTESAEILGLAK
Suva_16.477        PK-------QQPTNNQPPVEDSEENKLLEKLEDEFVSNTTAAVETMEEITDSSEILSLVK
Skud_16.443        ---------KANQGDEPTIEDLEENKLLEKLEDEFVSNTTTAVEIMEEITDSSDILGLVK
Smik_16.401        ---------KDDKKDDTPLEESEENKLLEKLEDEFVSNTTAAVETMEEIADSSEILGLIK
YPR148C            LK-------SNKVNDEPPIEESEDNKLLEKLEDEFVSNTTAAVETMEEITDSSEILGLIK
                                              :*  ** ***    :*  : .: :  .:  * *

CAGL0L08492g       LFQTFQLSYHQHCVKSLEQSLKDLNAIDN------
KNAG0A07930        LFQNIQLVHYRQCVQELEASMKSLDELEAESLFE-
KAFR0G03680        LFQNFQLIHYKQCVQEIENNMKFLDQLE-------
AFR309C            LFQNFQLVYHRKCVQELEVSLNSLTSLEESN----
Ecym_1238          LFHNFQLIYHKKCVQELQASLNVINTLTVEEDGEE
TBLA0D02980        LFQNFQLLHYQQCIKEVETNMKLLTDLTHE-----
Kpol_1017.7        LYQNFQLVYYKQCIQEIESNLKILNGLEE------
TPHA0D03270        LFQNFQLVYYRQCVQEIENNLKTISDLEILS----
KLLA0E04621g       LFHNFQLIHYKQCVKSLEEDLEVLNSLDSEDK---
ZYRO0D10010g       LFQNLQLVYYRQCVQEMEASLKGLNDLEN------
NCAS0F03540        LFQNFQLVYYRQCVQEIEANLKTLNELEI------
SAKL0F02794g       LFHKFQLIYHRQCVQELEASTKILDGLDNE-----
KLTH0F14806g       LFHNFQLIYYKQCVQNLETSINSLNELEGDEA---
Kwal_55.21227      LFHNFQLVYHRQCVQDLEASLSTLNELEGEDA---
NDAI0B05850        LFQNFQLVYYRQCVQEIEANLKTLNELDHA-----
TDEL0D05590        LFQNFQLVYFRQCVQEVEASLKILGALESDDN---
Suva_16.477        LFQNFQLVYFRQCAQEVEANLKVLNGMEN------
Skud_16.443        LFQNFQLVYFRQCVQEVEANLKVLNSLEN------
Smik_16.401        LFQNFQLVYFRQCVQEVEANLKVLNGLEN------
YPR148C            LFQNFQLVYFRQCVQEVEANLKVLNGLEI------
                   *::.:** :..:* :.:: . . :  :        

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0L08492g
----------------------------MF-KFNLESITQSISEGTQS-------LVQQ-
--------------FNDPKTKLSIKAKTRFLQEAIGNE-RD-ISKLPPQYVVLEKKCDSI
EKVLKRILIVTKTYEIEGYDYPPNISESLSSWW---------QTKEWF-NISELTKNVIP
KHGNVEKAGTEASK---------------TLTDKEVSHEGPPSFASAIARAGKDSQLIFE
SI-------------------------------------ETKDEDEKEDIDELVKIFKIW
SDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEV-A
QTSKQTDSK------------------------------ELGNEDETKPS----------
-SMDANKTNTEEKEA-----------ANDKVETKEKTETNATIADETKETKDT-------
---------KDSEDLKEDSKTSTDGQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIK
LFQTFQLSYHQHCVKSLEQSLKDLNAIDN------
>KNAG0A07930
----------------------------MFSNFSLDKLTSTITNAAQS-------AQDTI
HNTIL---------SPDAQTKLQFLKTTRYFQEKVGTISEDEIAKLPEGYQRLQEKSEAM
EKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNE----------------------DEN
KKKKTQDFGDS------------------SIL--------NRSFAIAIGKAVLDSQYILS
DLKEQQKTRGTEEKKVKREEEAEAAEEEDEADDGEQEAEDEEEEEEDIDMNNMISAFGLW
SNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRHKL-K
LKELEKEAR----------------------RQVMEEVAEQQAEASGEPVRKRKSRAHGA
QGGRKSTTEEAEKTSASENDSSKKSGKASGKSKKGKETAEEPQTEPKEAPPAAEAKEEPP
AK-------ETAPAKESNEAEEEENKLLERLEDEFVSNITAAVEKMTELTDSSELISLVK
LFQNIQLVHYRQCVQELEASMKSLDELEAESLFE-
>KAFR0G03680
----------------------------MFSNFNFDKITNSISTAAQS-------AQQKI
NDTIL---------TPDVQTKLHFKKTARFWQEKVGQIPDKEISKLPEGYLNLENKVDAL
EKILKRLLIVTKTYEIEGYDYPPNLSESLNDWW-------------WS-DLKKSKKHQEK
S----------------------------SFM--------NNSFPMAISKAAFDSKSILD
DLKEKQQDL----------------------PKEGEEPEEEVEEEDDDEFLNLLEVFNSL
SNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSKLRTKVQDSRLEFDTLRHEI-K
LKELAQESI----------------------RQENSQKTDVFKEDSTKEVPPKEESTKEE
QVNEESNKEETEKKKITED-------KPAEDVVEKKTVEEQAEAKETEKPAKEGSSKEEA
PK-------EDVKHNGSSEEETEEYKLLEKLEDEFVSNTGAAVELMTELTETSEVINLVK
LFQNFQLIHYKQCVQEIENNMKFLDQLE-------
>AFR309C
-------------------------MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHL
THAIQ--NIK----IDDPKTILSLKTRKRQLQETLGSA-KD-ISQLPPQYGFLERKCDAI
EQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTS------TKETRFLKFGKGGTDKQK
EDKQKQAAGSSD----------------------------PPSFAHALHRAAKGSQGIIQ
EL------------------------------KEQAEEEQEQEVEIDEDVESLIKMFGTW
ADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKYEQ-H
ERDAALAKK---------------------------------------------------
--QDEAKQAEGATPS-----------T---------------------------------
------------GVTQSSTADLAFYAQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVK
LFQNFQLVYHRKCVQELEVSLNSLTSLEESN----
>Ecym_1238
-------------------------MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQL
THAIH--SIN----LDDPQTMLSLRTRKHQLQETLGTI-KD-ISKLPPRYQFLERKCDAF
EKVCSRILVVSKTFEVDGYDYPPNLAESISDWWGSSS-----KKDGVFWGFGKKSKNDKN
KAEQKSSAEKKSNE---------------GYI--------PPSFAQAISKAADDSITILK
EL-----------------------------NEEQLVNPSNGAETEDEDVDSLMPILEAW
AEAQSNIDEAKQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYEL-E
MRKSGASQT------------------------------KETFTTIESQQ----------
VNDKDKENEDNLKPT-----------IHN-------------------------------
---------NTGIGSSSDEEDQKFRLLLEKAEDEFVSNTTDAVAYMTQITDSVNLSTLVK
LFHNFQLIYHKKCVQELQASLNVINTLTVEEDGEE
>TBLA0D02980
MLHATRYTLHTTHYTLYSPTSPPPQMSGYFSNFSLDKLADSLQSAAQK-------TQDTL
SNAIQNVNID----WNDPQTRLTLLSKQHYLQESIGQI-NE-ISKLPSQYNALERKTDAL
EKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPLAFLRDNDNTN-DKNKSNSNPPD
TKSKSDSDSES------------------SFL--------PRSFPHAISKASSDSSAILT
NLNNNEKL------------------------EFAKTKTEDEEYEDDEDIQLLIKVFDSW
SLCNKNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRYEIAK
AAEAKVRAE------------------------------ENDKPVEMEKG----------
-EGEDEGEGEGKGKG-----------KGKGETASTSTETASTSTTKDAAATIESQKKD--
---------SPNPEFEKNDSQNEDEKLLEHLEDEFVSHTSAAVETMEEITESSKILDLIK
LFQNFQLLHYQQCIKEVETNMKLLTDLTHE-----
>Kpol_1017.7
----------------------------MFSGFSIDKLTDSISNVALK-------TQENL
TNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLGTI-NDQPSKLPPTYTDLELKTDAI
EKALKRLLTVTKTYETEGYDYPPNLTESLSDWWTN-------DDNVTN-T----DENDEN
IQSNK------------------------SFL--------PRSFAQAISNASFDAASNVN
SVTNTIKL---------------------------NHKDDEEEEEDDEEWSDLHKIFESL
GNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQLRKSVENSRLKFDTMRYEL-K
IKEWKRTXX------------------------------XMEAEDKSDVS----------
----KKGTSKKETPK-----------KEASKKETPKKEINK-------------------
---------KEDITNEGNTENDNDNKLLEKLEDEFVSNTQNAVEKMEELTDNSKIINLVK
LYQNFQLVYYKQCIQEIESNLKILNGLEE------
>TPHA0D03270
----------------------------MFSNFSLDKLTDSISNVALK-------TQENF
TNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLGTL-DDEISKLPQQYVELEIKTDSV
EKILKRLLLVTNTFATEGYDYPPNLTESISDWWAE----------------------DET
TENK-------------------------NFL--------PRSFAQALAKAYSDSKLITD
KAERNIKLQTSPKNTGTKDENP---------EAGAEEEVEADDDEEDEDLVTLGKAFKAL
SNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDV-K
LKEAKAEQE------------------------------EAKEVSTDKEI----------
----EKKESETKEPE-----------TKGTEEKEPETKDTEE------------------
---------KDPVKENEGENEDEDYKLLEQLEDEFVSNTSSAVEKMEELTDSAKILDLVK
LFQNFQLVYYRQCVQEIENNLKTISDLEILS----
>KLLA0E04621g
----------------------------MFSKLSLNNITDSISNAAQR-------TQEQF
SSAIE--KIH----LDDPETRLSILKRRHQLQETLGTV-HD-ISQLPIQYKFLEQKSDAL
EKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSG-------NKDSIF-SF---SKKKAE
VSPEVKETAEN------------------GLL--------PRSFAQALSKAATDSALILK
QLKAEETRTNQEESQEGADQKPAE---ETK-AEPELEAEADEDEDEDEDVDNLIKAFESW
TKCQLSIDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEI-K
LKLQEKEVV------------------------------ASSEEAEKKVA----------
---TETPETPEKKT----------------------------------------------
---------NEEPVDMAKTEEDPDSKLFERLEDQFVSATSETVEFLGELTDSSEIISLVK
LFHNFQLIHYKQCVKSLEEDLEVLNSLDSEDK---
>ZYRO0D10010g
-------------------------MSEYFSSFSFKNLGDSIANAAHR-------TQDKL
SNAVA--NVN----LNDPQTRLSIKTRTRYLKETLGAV-DE-ISKLPPQYVLLERKSDAL
EKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSG-------SKEGWF-G---STKQDED
GESKIQTDGSSKD----------------PLM--------PRSFAQAIAKASHECGEAYQ
NS----------------------------------QKSEKKQIDEDEDDVNLVEMFNTL
SICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEM-R
LKEKEEKEE------------------------------NENTANADEGP-----SNKNQ
QEPTNEPAKEEEKPT-----------PAEPAEAQHTTK----------------------
---------TENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMK
LFQNLQLVYYRQCVQEMEASLKGLNDLEN------
>NCAS0F03540
----------------------------MFSNFSLDKITNSLATAAQK-------TSDTL
SNAIT----T----ATDPATKLSLRSQKRLFQESIGTV-HD-ISTLPEQYTTLEARTDAL
EKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSL-------SSK---------KKKEQE
KEDKK------------------------GFL--------PRSFAQAISNSAEDCVEIYQ
HVNDGDDEDKE--------------------ENANNEEENEEEDEEDEDVKNLIKTFDSW
AKCYKNIDQGKAEMDSMMMKEFNAKLEKLLNEEFKKVHTLRKRVKDSRLKFDTVRYEL-K
VKEEKAKIAEAAASNAAVTLTTTEEEKPEEEEKPTTDIKKEEDSTIKDESASKEEPIAKT
PSKEDTKTKKEGKPA-----------EKSTETATEATEAKEKALPKVPTTETEETGAESA
TKVDEEKASEDKKTDKAIEDDSEEHKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVK
LFQNFQLVYYRQCVQEIEANLKTLNELEI------
>SAKL0F02794g
-------------------------MSGYFSSFSLDKLTNSISSAAHK-------TQDKL
STAIA--NIQ----LDDPQAKLSLKVRKHYLQETLGAI-DD-ISKLPPQYQFLEKKCDSL
EKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGA-------NRSGLL-SFMDGKKGEGS
RAKAEEKDENE------------------GFL--------PRSFAQALSKAAKDSGDVLR
TL-----------------------------KDEQKEPPQDEDEDEDEDINSLITMFEAW
SKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRKKVEESRLKFDTLRYEL-N
LKEKEQQKA------------------------------KAKEEENEKVD------VVEQ
NAPEEKAKTEGQETS-----------EGKEHDLKADEKLSEDTASKI-------------
---------PESVENEEVDNEDPEHKLLEKLEDEFVSSTTEAVEIMGEITDSSEILSLVK
LFHKFQLIYHRQCVQELEASTKILDGLDNE-----
>KLTH0F14806g
-------------------------MSNYFGGFSLNKLTNSITNVAHK-------TQDTL
STAIA--NIQ----LDDPQAKLSLKARKHYLQETLGTI-ED-ISKLPPQYQFLEKKCDSL
EKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSS-------NKEGLF-GFVSSSKKEKK
LEPAEDSKE--------------------ALM--------PRSFAQAISKAAKDSGEVMT
AL------------------------------KTEEQKASAEEDEEDEDITSLIKMFEAW
SACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKVEDSRLKFDTMRYEL-K
MAEEQGKTE---------------------------------------------------
---EAAQQTESQKPQ-----------E---------------------------------
---------DEAEASKDSDSSDEAQKLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVK
LFHNFQLIYYKQCVQNLETSINSLNELEGDEA---
>Kwal_55.21227
-------------------------MSSYFGGFSFNKLTDTLTNAAHK-------TQDTL
STAIA--NIQ----LDDPQAILSLKARKHYLQETLGTI-ED-ISKLPPQYQLLEKKCDSL
EKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSS-------NKEGLF-GLMSSSKKDKG
AESAAAAKS--------------------ALM--------PRSFAQAIAKAAKDSGDVLA
AL------------------------------KDQEQQASADEEDEDEDITPLIKMFSAW
SECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEV-K
LTEQQSKQA------------------------------MENEKAQFKES----------
----DLSSKEEGADA-----------NETSNEVGK-------------------------
---------SVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVK
LFHNFQLVYHRQCVQDLEASLSTLNELEGEDA---
>NDAI0B05850
----------------------------MFSSFSLDKITNSIGNAAQK-------ATNTL
NNAIN----T----ATDPQTKLSIKSQTRLFQEQLGTI-HD-ISKLPDQYKSLELKTDSL
EKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNI-------TKKSSS-H----RKKQIS
VNNKKKNNTDNDHDNATNVEPIENDITSSSFL--------PRSFAQAISKSAMDCTDIYQ
QLSIQETATKETTIKDENEAQEE--------DDEDAGEEEEEDDDDDEDIQNLIKAFESW
SNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEI-K
IKEEEQDQK-----EKQAQAQAQAQAQEQEQEQEQGEKAKKEQEEEQEQAQLGDNVIEES
KKKEEVIKDEKKKPE-----------IKSGTETTSKQLETEAEPKAEVEAKVNDTSKDQL
KK-------EDDAEKQDEQDDSEEHKLLEQLEDEFVSSTASAVEMMTEITESSSIIGLIK
LFQNFQLVYYRQCVQEIEANLKTLNELDHA-----
>TDEL0D05590
-------------------------MSGYLSNFSLNKITDTLANAAHK-------TQDTL
NSAIA----N----VSDPQAKLSLKARTRYLQETLGTI-DD-KSKLPPQYQSLEKKSDAL
EKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSL-------NKDGWF-G----TKKPEK
T-KNDSSDGSD------------------AFL--------PRSFSQAISKAANDCNSVFT
NL-----------------------------------QEHGDEDEEDEDVSNVAKMFDSW
SKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVEESRLKFDTVRYEI-K
LKETENAKK---------------------------------------------------
-------STETDEAS-----------K---------------------------------
---------DETKTEEEPPKTSEEDKLLEELEDEFVSNTTAAVEIMGEVTESAEILGLAK
LFQNFQLVYFRQCVQEVEASLKILGALESDDN---
>Suva_16.477
-------------------------MSGYW-----NKITDSIATAAHK-------TQDTL
NSALANANVN----LNDPQTRLSIKSRTRFVQESLGTV-SD-ISKLPPQYQFLEKKSDSL
EKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSL-------NKDGWF-G----SKKTEH
ASKKKDSNHDD------------------TFL--------PRSFAQAISKAAVDCESEFK
NLEQNEKEDLKQKKEAKKTTQET--------AEQEEEEEEEEEEEDDEDLSNLIKVFDSW
STCYKNIDEGKAEMDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEG-K
SKEEQLRAQ----------------------------KDETSKEADNNDNSANSTSLEEA
LTAEKKAEKEDDAKV-----------PE---EEPKKVETDVTTANDDIDTNEN-------
PK-------QQPTNNQPPVEDSEENKLLEKLEDEFVSNTTAAVETMEEITDSSEILSLVK
LFQNFQLVYFRQCAQEVEANLKVLNGMEN------
>Skud_16.443
-------------------------MSGYFSGFSLNKITDSIATAAHK-------TQDTL
NNALASANVN----LNDPETRLSIKSRTRFVQESLGTV-SD-ISKLPPQYQFLEKKSDSL
EKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSV-------NKDGWF-G----SRKSEN
ANKKKVSNHDD------------------AFL--------PRSFAQAISKAAVDCECEFQ
SLKQDEKAGLKKKSESNET------------AQDAEAQEEDEEDEEDEDLSNLIKVFDSW
STCYKNIDEGKAEMDSTMIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEV-K
SKEAKLKAQ----------------------------KAETSKEVDDKAV-----SANAP
ISPDENPTTEDESP------------ISKDLEGDSKKETSGSAADDAAVVKEDS------
---------KANQGDEPTIEDLEENKLLEKLEDEFVSNTTTAVEIMEEITDSSDILGLVK
LFQNFQLVYFRQCVQEVEANLKVLNSLEN------
>Smik_16.401
-------------------------MSGYFSSFSLNKITDSIATAAHK-------THDTL
NNALANANVN----LNDPQTRLSIKSRTRFVQESLGTI-SD-ISKLPPQYQFLEKKSDSL
EKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSL-------NKDGWF-G----SKKSEI
TNKKKGSNHDD------------------AFL--------PRSFAQAISKAAVDCEFEFQ
NLENDEKAELKKKRESTKNAQTT------GAQDEENEEDEDEEEEEDEDLSNLIKVFDSW
STCYKNIDEGKTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEV-K
AKEAQLDAQ----------------------------KPGVTEEAHTKDV-----SANTA
TSLNEIPSTVDEKQK-----------SNVNTEAESKKEANEQVADDAVVMKEDP------
---------KDDKKDDTPLEESEENKLLEKLEDEFVSNTTAAVETMEEIADSSEILGLIK
LFQNFQLVYFRQCVQEVEANLKVLNGLEN------
>YPR148C
-------------------------MSGYFSGFSLNKITDSIATAAHK-------TQDTL
NNALANANVN----LNDPQTRLSIKSRTRFVQESLGTV-SD-ISKLPPQYQFLEKKSDSL
EKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSL-------NKDGWF-G----SKKSES
STKKKGSNHDD------------------AFL--------PRSFAQAISKAAVDCECEFQ
NLEHNEKAELKKKKESIKTAQTTE---AQGADHNEEDEEDEEDEEDDEDLSNLIKVFDSW
STCYKNIDEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEV-K
AKEAELEAK----------------------------KAEATGEAHSKDVSAKDISANTT
TSFDETPSTEDEKPK-----------SE-GAEEESKKEANEPTVDDVADRKED-------
LK-------SNKVNDEPPIEESEDNKLLEKLEDEFVSNTTAAVETMEEITDSSEILGLIK
LFQNFQLVYFRQCVQEVEANLKVLNGLEI------