MUSCLE (3.8) multiple sequence alignment

AFR306C            MSSQTTKEAAKARTVVETLCDPDIDADMLHIWSE-------WI-QP----ECILIFLPGN
Ecym_1241          ---------------METYLREDIFADILHIYSQ-------ST-PP----GPLLLFIPGN
CAGL0L08514g       -------------MSVQGYHDSALPTCIIHIKPT-------VT-NNDES-SPLFVWIPGN
SAKL0F02860g       -------------MHIQPYSKNGFFSSLYHLKPL-------NQ-EVNSQ-TPLFVFIPGN
KLTH0F14740g       -------------MKIEASFVGGEPSSILHLKSG-------VS-SLGSD-ACLFVFIPGN
Kwal_55.21219      -------------MKSIQNCVDPLPCSLYHRNAG-------LN-SSGGE-APLFVFIPGN
NDAI0B05830        -------------MLVKSYSESKYPTSIIHIEAE-------KLIENDPSLNPLFIWIPGN
NCAS0F03530        -------------MSVEAYDDDEFPTCVVHILP---------I-KTAEI-NPVFVWIPGN
Suva_16.476        -------------MSIQEYTKSKLPCSILNIKPT-------VT-TDNED-APLLVWIPGN
Skud_16.442        -------------MPVQEYTKSTLPCSILNIKPS-------VA-TENED-APLLVWIPGN
Smik_16.400        -------------MPIQEYTKSKFPCSILNIKPT-------IT-RSDED-AALLVWIPGN
YPR147C            -------------MTVKEYTKSKLPCSILNIKPT-------VT-KSGED-APLLVWIPGN
ZYRO0D10076g       -------------MSIRYLAGARLPTSVLHIKPK----------SPSPS-SPLFVWIPGN
TDEL0D05560        -------------MAAREYIKCAYPTSIVHFKSI-------SI-RGKSE-CPLFVWIPGN
TPHA0D04220        -------------MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGN
TBLA0C04450        -------------MTIQIYPDSRYPTSIVHFPPA-------KDYKITED-TPLFIWIPGN
Kpol_480.17        ------------MSLVKVFEDSIYPTSIVHLDPL-------TKELSPED-SPLFVWIPGN
                                              :                        :::::***

AFR306C            PGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLK-------RVYTLVEQVEHK
Ecym_1241          PGLINFYEEFLKCIHERNPTWEVVGIGHTGMSSLRENNSLSG------RVHTLDEQIEDK
CAGL0L08514g       PGLLEYYQEFLAKVHDKNPTWEILGISHAGTVIESSQLKKFRKNPL--PIYDLKQQTQHK
SAKL0F02860g       PGLIEFYKSFLDQIQKKHGNWEILGISHAGMITKCKGLKKPT------KVYSLKDQVQHK
KLTH0F14740g       PGLIEYYVPFLQQVHEKNPDWEILGISHAGMNSCNDIAC---------PVYTLQEQINHK
Kwal_55.21219      PGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSEEVS---------PVYSLEQQIDHK
NDAI0B05830        PGILQYYQQFLCSLHKKHPHWEILAIPHAGMDTSLPVYRHPND-----RIYHLNEQIEHK
NCAS0F03530        PGILEYYQEMLINLHEKHPTWEILAISHIGMNTKTTSLFKGSHQDNS-RVFTLKEQIQHK
Suva_16.476        PGLLHYYQEMIHHLHLKHPDWEILGISHAGMSSNARSNT---------PIFSLQDQVDHQ
Skud_16.442        PGLLYYYQEMLQHLHSKHPDWEILGVSHAGMTLNAHSNT---------PIFSLQDQVDHQ
Smik_16.400        PGLLYYYQEMLQYLHSKHPDWEILGISHAGMTLNAHSNT---------PVYSLQDQVDHQ
YPR147C            PGLLYYYQEMLHHLHLKHPDWEILGISHAGMTLNAHSNT---------PIFSLQDQVDHQ
ZYRO0D10076g       PGIVQYYEEFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKA-----TIYTLDDQIQHK
TDEL0D05560        PGLIEYYEEFLMLIHRQHPEWEVLGISHAGMSTASVSKSEKSERN---DVYSLKQQIDHK
TPHA0D04220        PGLLEYYEEFLKLLHVKNPEWDILGISHAGMSSGNSNLKENEC-----SVYTLDEQIHHK
TBLA0C04450        PGLLEYYTKMLRSLHDKYPTWEILGVSHAGMSNGNQIKNVLST-----KVYTLDEQVSHK
Kpol_480.17        PGLLEYYVDFLALVHKKNPTWEVLGISHAGMSYDGNEKKKKTSSNDKFKVFDLEEQVQHK
                   **:: :*  ::  :: .   ::::.: * *                   :. * :*   :

AFR306C            VKAINDFVENRGN-------LAVKLVGHSIGAYMAQKVVVHPALRVNV-------EMVGL
Ecym_1241          VKVINEFVDAGGD-------RCIKLIGHSIGAYMVQKIALHKGLRGKI-------DMVML
CAGL0L08514g       IDIINKINNDPN--------RELVIMGHSVGAYIAQHVVSSPDLVGRV-------SKLGL
SAKL0F02860g       IYVINDFCSS-N--------RPLIIAGHSIGAYIVQKIALDVSLMGTV-------KKIML
KLTH0F14740g       VDVINSYAQG-N--------KKITIMGHSVGAFIAQKVVTSGLLNDEV-------ARVGL
Kwal_55.21219      IEIINRYCLD-G--------KPIIIMGHSVGAFMVQKITTSRRLKSKV-------IRVGL
NDAI0B05830        IEVITTFLTKANSSDGIMKKRPLVIMGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGF
NCAS0F03530        IKIINNFVKDSN--------VPIYISGHSVGAYMVQKIVASDELIGQV-------LKMGL
Suva_16.476        VKVINNFSHD-N--------RKIIIMGHSVGAYIVQKVCLSNELVGSV-------TKVGL
Skud_16.442        VEVINNFSHE-N--------RKIIIMGHSVGAYILQKVCLSDKLVGSV-------RKIGL
Smik_16.400        VEVINNFSHE-N--------RKIIIMGHSVGAYILQKVCLSHNLVGTV-------QKVGL
YPR147C            VEVINNFSCK-N--------RKIIIMGHSVGAYIVQKVCLSNKLVGSV-------QKVGL
ZYRO0D10076g       VEIINQFSAK-D--------RPLIVMGHSVGAYMAQHVVLAEKLLGRV-------VKLGL
TDEL0D05560        LEIIKDFSST-N--------RPLIIMGHSVGAYMVQHIVLSDKLVGKV-------AKMGL
TPHA0D04220        IEIINKFAAY-G--------RELIVMGHSVGAFMAQKVVMSNKLEGKV-------KKIGL
TBLA0C04450        VEVINNFSSP-K--------RNIIIMGHSVGAYMAQRVIMDSNLIGNV-------IKLGL
Kpol_480.17        VDIINKFSSK-N--------RPLIIMGHSVGAYLTQRVIMTNKLNGKL-------IKVGY
                   :  *.                 : : ***:*::: *.:     :   :         :  

AFR306C            LTPTIIDIHRSPKGVQLTRISEW-FPRFYEYVSIVDRVLLEWLLPAT--WISWLARKIIG
Ecym_1241          LTPTIIDIHRSSKGVQLTRISDW-FPKFYEYAYVVDRVLFKWILPTS--WIEWIARKLIG
CAGL0L08514g       ITPTIRDIHKSSHGLIFTRVFNY-ISNVNEYLSFISSNIFNKLIPAY--WTKLLISFAMG
SAKL0F02860g       LTPTVIDIHLSEKGRKLNWINEW-CPNFHSYVATASWLVFEKMLPQT--ITEKILSLFVG
KLTH0F14740g       LTPTVIDIHKSEKGLKLTAITER-FPRFHQLVSALDWIAFEKLFPDF--LTSWIISHFAD
Kwal_55.21219      LTPTVIDIHKSEKGVKLTSITRW-CPSFHNVVSTLNWALFEKLLPTK--ITKSIISLLVD
NDAI0B05830        ITPTIIDINLSSKGILISHGLQLTHGYLPYILSYLSYFVFSLILKYFDNIRRRLIAYIMG
NCAS0F03530        ITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYIVFGWLVPGI--LRSYIIGYVMG
Suva_16.476        ITPTVMDIHASEMGVKMTTAFHY-VPALAHVLSFISYVFFYWVLSEG--LSKLIIDKFMG
Skud_16.442        ITPTVMDIHTSEMGVKMTAVLHY-IPPLAHVVSLLSYVFFYWILSEG--LSRFVIDKFMG
Smik_16.400        VTPTVMDIHTSEMGVKLTTALHY-IPPLAHVVSLFSYIFFYWILSEG--FSRFIIDKFMG
YPR147C            VTPTVMDIHTSEMGIKMTAALRY-IPPLAHVVSLFSYIFFYWILSEG--FSRFIIDKFMG
ZYRO0D10076g       ITPTVVDIHRSQKGTQLTRAFYW-VKYLPDIAAWVSDMLFNKLSSIM--FTDQVISLFMG
TDEL0D05560        LTPTILDIHTSKKGVVLTKVLYW-LKDLPQLAGWFSSLLFGFFLPSF--ILRILLSFFMG
TPHA0D04220        LMPTVIDIHLSEKGTQISTILNW-IPNLPQLAGWVSEKIFGGFLPIT--LVKFIISFFME
TBLA0C04450        VTPTVVDIHRSVKGIKMTRAFNL-FRELPIFLGLLSTLAFSKLFPAI--FTRWLLTIIMG
Kpol_480.17        LTPTVVDIHLSDKGIKMTKVFNW-TSNLPHHVGWISQFIFHKLLPLF--FVKFFISKMIK
                   : **: **: *  *  :.         .           :  .          .      

AFR306C            --GSDECVLQSAEKLVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLL
Ecym_1241          --GSDECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQANKIKVRFL
CAGL0L08514g       CSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAFQENLLTKCKDNGTKLWLL
SAKL0F02860g       --SEQTCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFLQFCKSQEVELQFL
KLTH0F14740g       --DPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCETKGAKIWWL
Kwal_55.21219      --DPQSCLGATTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWL
NDAI0B05830        C-QMTDFAAIGTEILLTNSVLVKQSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLL
NCAS0F03530        C-HHDSQAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDWQFQAELIEYCLKNSIKIQFL
Suva_16.476        CGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKFINHCEEKGIFTWFL
Skud_16.442        CGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEFINYCQENEIFIWFL
Smik_16.400        CGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKFINYCEQNGTLIWFL
YPR147C            CGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRFINYCEENGISIWFL
ZYRO0D10076g       V-DKESVPVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQKKLIDHCNSNEIETKFV
TDEL0D05560        C-HRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQRRLIVHCNERGISTWLL
TPHA0D04220        L-NNENKAAHATYTFLKDSNFVEQSLGLAKYEMQIIRHDWEFQRELVKMCNVNQIELWTL
TBLA0C04450        CKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQKRLIDYCNKENVSTWFL
Kpol_480.17        C-SEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGFHKKLIDYCNETGVKTWFL
                              :  ::     : * **::  *:  :   *  :  ::  *       . :

AFR306C            FSGHDHWVHSDTMKDIVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF---
Ecym_1241          FSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKVVNIYF---
CAGL0L08514g       FSDNDHWVSQHTQAELIKFLKDRY-PELL--LRVDVDKDIKHSFVVKDVDLVTRRYF---
SAKL0F02860g       FAFKDHWVNSQTRFDLAEFYNSNY-YKDF--LTIDEDEKISHSFVLNDTKSVVDRYI---
KLTH0F14740g       FSDNDHWVSSETRKDLIQFYERHS-SPEL--VSIDVSTAIEHAFVRRHAQVVVQHYF---
Kwal_55.21219      FSEKDHWVSPTTRNDIIDFYRQHS-SPAL--SQIDVSSTIEHAFVRRHADLVIKQYF---
NDAI0B05830        FCETDHWVNNVTRTDLIKFYQSNY-KDISR-LQIEVSSEFPHSFVVNHSDWVVERFF---
NCAS0F03530        FSATDHWVREATRKEIIQFYQERC-KGAKALLKIDVSDQFPHSFVVRRSKYVVEHYF---
Suva_16.476        FSTKDHWVNDETRKHLSHYYHDKV-KQEH--LRIDVTDKMPHSFVVKHAEYAINAFF---
Skud_16.442        FSTKDHWVADKTRTHLSHYYKDKI-KQER--LKIDVTDKIPHSFVVKHAEYAVNTFF---
Smik_16.400        FSSNDHWVSGKTRSHLSHYYKDKV-DQNR--LEIDVTDKIPHSFVVKHAKYAINTFF---
YPR147C            FSSNDHWVSGKTRSHLSDYYKDKV-KQER--LKIDVTDKIPHSFVVKHAEYAINAFF---
ZYRO0D10076g       FSANDPWVSNATREALMVFYRENY-RDRN--LEISVSQDLAHSFIVKHSKYIVDEYF---
TDEL0D05560        FSDSDHWVADTTREDLIKFYRDHY-RADK--IKIH-TCKIPHSFVLNHSKYLISEYFEDS
TPHA0D04220        FAESDHWVSNQTRSELIELYRNSV-NSDY--YSYSITDQVPHAFVIKNSCHVVDNYF---
TBLA0C04450        FSSTDHWVSDDTRNELINFYRTNC-KSDI--LDVSVSNIIPHSFVINFSDFTVNSYF---
Kpol_480.17        FAEDDHWVAHSTRKEVIDFYQYHN-KPEN--IRIDI-DTIPHAFVIKKSKYIVDQYF---
                   *.  * **   *   :                       . *:*: .        ::   

FASTA FORMAT for MUSCLE Version 3.6

>AFR306C
MSSQTTKEAAKARTVVETLCDPDIDADMLHIWSE-------WI-QP----ECILIFLPGN
PGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLK-------RVYTLVEQVEHK
VKAINDFVENRGN-------LAVKLVGHSIGAYMAQKVVVHPALRVNV-------EMVGL
LTPTIIDIHRSPKGVQLTRISEW-FPRFYEYVSIVDRVLLEWLLPAT--WISWLARKIIG
--GSDECVLQSAEKLVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLL
FSGHDHWVHSDTMKDIVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF---
>Ecym_1241
---------------METYLREDIFADILHIYSQ-------ST-PP----GPLLLFIPGN
PGLINFYEEFLKCIHERNPTWEVVGIGHTGMSSLRENNSLSG------RVHTLDEQIEDK
VKVINEFVDAGGD-------RCIKLIGHSIGAYMVQKIALHKGLRGKI-------DMVML
LTPTIIDIHRSSKGVQLTRISDW-FPKFYEYAYVVDRVLFKWILPTS--WIEWIARKLIG
--GSDECVLQSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQANKIKVRFL
FSGHDHWVHPDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKVVNIYF---
>CAGL0L08514g
-------------MSVQGYHDSALPTCIIHIKPT-------VT-NNDES-SPLFVWIPGN
PGLLEYYQEFLAKVHDKNPTWEILGISHAGTVIESSQLKKFRKNPL--PIYDLKQQTQHK
IDIINKINNDPN--------RELVIMGHSVGAYIAQHVVSSPDLVGRV-------SKLGL
ITPTIRDIHKSSHGLIFTRVFNY-ISNVNEYLSFISSNIFNKLIPAY--WTKLLISFAMG
CSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWAFQENLLTKCKDNGTKLWLL
FSDNDHWVSQHTQAELIKFLKDRY-PELL--LRVDVDKDIKHSFVVKDVDLVTRRYF---
>SAKL0F02860g
-------------MHIQPYSKNGFFSSLYHLKPL-------NQ-EVNSQ-TPLFVFIPGN
PGLIEFYKSFLDQIQKKHGNWEILGISHAGMITKCKGLKKPT------KVYSLKDQVQHK
IYVINDFCSS-N--------RPLIIAGHSIGAYIVQKIALDVSLMGTV-------KKIML
LTPTVIDIHLSEKGRKLNWINEW-CPNFHSYVATASWLVFEKMLPQT--ITEKILSLFVG
--SEQTCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQLSFLQFCKSQEVELQFL
FAFKDHWVNSQTRFDLAEFYNSNY-YKDF--LTIDEDEKISHSFVLNDTKSVVDRYI---
>KLTH0F14740g
-------------MKIEASFVGGEPSSILHLKSG-------VS-SLGSD-ACLFVFIPGN
PGLIEYYVPFLQQVHEKNPDWEILGISHAGMNSCNDIAC---------PVYTLQEQINHK
VDVINSYAQG-N--------KKITIMGHSVGAFIAQKVVTSGLLNDEV-------ARVGL
LTPTVIDIHKSEKGLKLTAITER-FPRFHQLVSALDWIAFEKLFPDF--LTSWIISHFAD
--DPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCETKGAKIWWL
FSDNDHWVSSETRKDLIQFYERHS-SPEL--VSIDVSTAIEHAFVRRHAQVVVQHYF---
>Kwal_55.21219
-------------MKSIQNCVDPLPCSLYHRNAG-------LN-SSGGE-APLFVFIPGN
PGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSEEVS---------PVYSLEQQIDHK
IEIINRYCLD-G--------KPIIIMGHSVGAFMVQKITTSRRLKSKV-------IRVGL
LTPTVIDIHKSEKGVKLTSITRW-CPSFHNVVSTLNWALFEKLLPTK--ITKSIISLLVD
--DPQSCLGATTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWL
FSEKDHWVSPTTRNDIIDFYRQHS-SPAL--SQIDVSSTIEHAFVRRHADLVIKQYF---
>NDAI0B05830
-------------MLVKSYSESKYPTSIIHIEAE-------KLIENDPSLNPLFIWIPGN
PGILQYYQQFLCSLHKKHPHWEILAIPHAGMDTSLPVYRHPND-----RIYHLNEQIEHK
IEVITTFLTKANSSDGIMKKRPLVIMGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGF
ITPTIIDINLSSKGILISHGLQLTHGYLPYILSYLSYFVFSLILKYFDNIRRRLIAYIMG
C-QMTDFAAIGTEILLTNSVLVKQSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLL
FCETDHWVNNVTRTDLIKFYQSNY-KDISR-LQIEVSSEFPHSFVVNHSDWVVERFF---
>NCAS0F03530
-------------MSVEAYDDDEFPTCVVHILP---------I-KTAEI-NPVFVWIPGN
PGILEYYQEMLINLHEKHPTWEILAISHIGMNTKTTSLFKGSHQDNS-RVFTLKEQIQHK
IKIINNFVKDSN--------VPIYISGHSVGAYMVQKIVASDELIGQV-------LKMGL
ITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYIVFGWLVPGI--LRSYIIGYVMG
C-HHDSQAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDWQFQAELIEYCLKNSIKIQFL
FSATDHWVREATRKEIIQFYQERC-KGAKALLKIDVSDQFPHSFVVRRSKYVVEHYF---
>Suva_16.476
-------------MSIQEYTKSKLPCSILNIKPT-------VT-TDNED-APLLVWIPGN
PGLLHYYQEMIHHLHLKHPDWEILGISHAGMSSNARSNT---------PIFSLQDQVDHQ
VKVINNFSHD-N--------RKIIIMGHSVGAYIVQKVCLSNELVGSV-------TKVGL
ITPTVMDIHASEMGVKMTTAFHY-VPALAHVLSFISYVFFYWVLSEG--LSKLIIDKFMG
CGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKFINHCEEKGIFTWFL
FSTKDHWVNDETRKHLSHYYHDKV-KQEH--LRIDVTDKMPHSFVVKHAEYAINAFF---
>Skud_16.442
-------------MPVQEYTKSTLPCSILNIKPS-------VA-TENED-APLLVWIPGN
PGLLYYYQEMLQHLHSKHPDWEILGVSHAGMTLNAHSNT---------PIFSLQDQVDHQ
VEVINNFSHE-N--------RKIIIMGHSVGAYILQKVCLSDKLVGSV-------RKIGL
ITPTVMDIHTSEMGVKMTAVLHY-IPPLAHVVSLLSYVFFYWILSEG--LSRFVIDKFMG
CGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEFINYCQENEIFIWFL
FSTKDHWVADKTRTHLSHYYKDKI-KQER--LKIDVTDKIPHSFVVKHAEYAVNTFF---
>Smik_16.400
-------------MPIQEYTKSKFPCSILNIKPT-------IT-RSDED-AALLVWIPGN
PGLLYYYQEMLQYLHSKHPDWEILGISHAGMTLNAHSNT---------PVYSLQDQVDHQ
VEVINNFSHE-N--------RKIIIMGHSVGAYILQKVCLSHNLVGTV-------QKVGL
VTPTVMDIHTSEMGVKLTTALHY-IPPLAHVVSLFSYIFFYWILSEG--FSRFIIDKFMG
CGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKFINYCEQNGTLIWFL
FSSNDHWVSGKTRSHLSHYYKDKV-DQNR--LEIDVTDKIPHSFVVKHAKYAINTFF---
>YPR147C
-------------MTVKEYTKSKLPCSILNIKPT-------VT-KSGED-APLLVWIPGN
PGLLYYYQEMLHHLHLKHPDWEILGISHAGMTLNAHSNT---------PIFSLQDQVDHQ
VEVINNFSCK-N--------RKIIIMGHSVGAYIVQKVCLSNKLVGSV-------QKVGL
VTPTVMDIHTSEMGIKMTAALRY-IPPLAHVVSLFSYIFFYWILSEG--FSRFIIDKFMG
CGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRFINYCEENGISIWFL
FSSNDHWVSGKTRSHLSDYYKDKV-KQER--LKIDVTDKIPHSFVVKHAEYAINAFF---
>ZYRO0D10076g
-------------MSIRYLAGARLPTSVLHIKPK----------SPSPS-SPLFVWIPGN
PGIVQYYEEFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKA-----TIYTLDDQIQHK
VEIINQFSAK-D--------RPLIVMGHSVGAYMAQHVVLAEKLLGRV-------VKLGL
ITPTVVDIHRSQKGTQLTRAFYW-VKYLPDIAAWVSDMLFNKLSSIM--FTDQVISLFMG
V-DKESVPVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQKKLIDHCNSNEIETKFV
FSANDPWVSNATREALMVFYRENY-RDRN--LEISVSQDLAHSFIVKHSKYIVDEYF---
>TDEL0D05560
-------------MAAREYIKCAYPTSIVHFKSI-------SI-RGKSE-CPLFVWIPGN
PGLIEYYEEFLMLIHRQHPEWEVLGISHAGMSTASVSKSEKSERN---DVYSLKQQIDHK
LEIIKDFSST-N--------RPLIIMGHSVGAYMVQHIVLSDKLVGKV-------AKMGL
LTPTILDIHTSKKGVVLTKVLYW-LKDLPQLAGWFSSLLFGFFLPSF--ILRILLSFFMG
C-HRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQRRLIVHCNERGISTWLL
FSDSDHWVADTTREDLIKFYRDHY-RADK--IKIH-TCKIPHSFVLNHSKYLISEYFEDS
>TPHA0D04220
-------------MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGN
PGLLEYYEEFLKLLHVKNPEWDILGISHAGMSSGNSNLKENEC-----SVYTLDEQIHHK
IEIINKFAAY-G--------RELIVMGHSVGAFMAQKVVMSNKLEGKV-------KKIGL
LMPTVIDIHLSEKGTQISTILNW-IPNLPQLAGWVSEKIFGGFLPIT--LVKFIISFFME
L-NNENKAAHATYTFLKDSNFVEQSLGLAKYEMQIIRHDWEFQRELVKMCNVNQIELWTL
FAESDHWVSNQTRSELIELYRNSV-NSDY--YSYSITDQVPHAFVIKNSCHVVDNYF---
>TBLA0C04450
-------------MTIQIYPDSRYPTSIVHFPPA-------KDYKITED-TPLFIWIPGN
PGLLEYYTKMLRSLHDKYPTWEILGVSHAGMSNGNQIKNVLST-----KVYTLDEQVSHK
VEVINNFSSP-K--------RNIIIMGHSVGAYMAQRVIMDSNLIGNV-------IKLGL
VTPTVVDIHRSVKGIKMTRAFNL-FRELPIFLGLLSTLAFSKLFPAI--FTRWLLTIIMG
CKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQKRLIDYCNKENVSTWFL
FSSTDHWVSDDTRNELINFYRTNC-KSDI--LDVSVSNIIPHSFVINFSDFTVNSYF---
>Kpol_480.17
------------MSLVKVFEDSIYPTSIVHLDPL-------TKELSPED-SPLFVWIPGN
PGLLEYYVDFLALVHKKNPTWEVLGISHAGMSYDGNEKKKKTSSNDKFKVFDLEEQVQHK
VDIINKFSSK-N--------RPLIIMGHSVGAYLTQRVIMTNKLNGKL-------IKVGY
LTPTVVDIHLSDKGIKMTKVFNW-TSNLPHHVGWISQFIFHKLLPLF--FVKFFISKMIK
C-SEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGFHKKLIDYCNETGVKTWFL
FAEDDHWVAHSTRKEVIDFYQYHN-KPEN--IRIDI-DTIPHAFVIKKSKYIVDQYF---