MUSCLE (3.8) multiple sequence alignment

AFR746C            ----MDELQRTVLALQTRSDELVLQLRSSVVEC---ERVGR-----------AEICGCAV
Ecym_1007          ----MLVSEYEIHRLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTC
TBLA0A07580        ----MALQEEVSIRLLTKAQEAVLQLDLWIKDQ---QG--------------FQNRD--G
KLTH0F00462g       ----MEQLQEIAQESLALSQSALARLDSCLERQ---RRLYE-----------SGFPD---
Kwal_33.13003      ----MEQLAKIAQCALERSEEALVRLEKCVGKQ---RRLYE-----------SERSD---
KAFR0D00120        ----MASL--VSDTLLQRSEEAVSQLESWLKQQ---EQ----------------------
KLLA0C00462g       ----MEDMRYVAERLVIRCNEAVMQLELSIQRK---M---------------CEFDP---
CAGL0B00308g       ----MASLEEITERLLERSNEAIEQLDEWILLQ---NKN-------------RHISE---
SAKL0C00440g       ----MEGLHEISQKLLVRSQEAILQLDLYIQRQ---QRLYE-----------YETLD---
KNAG0C00190        ----MDCLEDVTDRLLIRSQDAILQLELWVQQQ---EKL-------------LLTDH---
NDAI0A00130        ---MSTTLQDITERLLIRSQEAILQLDLWIQRE---KKQQE-----------LSTLN---
NCAS0B09120        ----MSLLQDISERLLVRSQEAILQLDVWIQRQ---RRLQELMEGEEEQEQGGDTNT---
TPHA0E04020        MHSLNSNLEELSEKLLIRSQEAILQLDLWILRQ---QQQHNDHRFGTATDTGNKTKD---
Kpol_2002.7        --MPYSNIDDLSERLLVRSQEAILQLDLWIQRQ---QQWAE-----------SDDNH---
Suva_3.151         --MATQALEDITERLLTRSEEAILQLDLWIQRQ---QRSSV-----------CEPSD---
Skud_3.2           --MATQALEDITERLLIRSQEAILQLDLWIQRQ---QRSSV-----------CQTSD---
Smik_3.13          --MTTQALEDITERLLIRSQEAILQLDLWIQRQ---QRSSV-----------CQTTD---
YCL063W            --MATQALEDITERLLIRSQEAILQLDLWIQRQ---QRSSI-----------CQTTD---
ZYRO0F18502g       ----MPSLDDISERLFIRSQEAVLQLELWIRRQ---QHL-------------SEIEH---
TDEL0C06980        -----MELEDLSERLLTRSQEAILQLELWIQRQ---QHL-------------RELED---
                                     .:. :  *   :                              

AFR746C            RAALAEGICDGAMCEARRWEFYALLMQLTSLRVRVEHISGTVRGMLRRG-----------
Ecym_1007          RSAVQQSCGDQRTEQMRR--YQSSMAHLMSLSIRAQFLIDKFHKGGSGY-----------
TBLA0A07580        LRASTSESLEQAERD-----YNRYMFQLNSLYLRAQYIRDKIEKQNAYNLADSDVAGND-
KLTH0F00462g       -QCLSDKSSTNMAQ------YYEYIGQLYSLYTKAQKLSDTVILSDSKSLS---------
Kwal_33.13003      -QCLSEESSSTIVQ------YYSYLGQLNCLYIKAQSLKDMMGNRCGHLP----------
KAFR0D00120        --------LHQTTAE-----YK----QLNSLCAKSKYISNLLKDDSSSIPHDLME-----
KLLA0C00462g       -N---NSHCFIQVQE-----YYSFLARLSSLKLRAEHVQESLRHQRKDPNDV--------
CAGL0B00308g       -NKSGLDSIERLDDK-----YTEFLEKLNSLYIRSQYIKDKIRTEKNAKATKRKS-----
SAKL0C00440g       -Q--PDNGLLTKLQE-----YQTCLAQLNSLHIRSEHLRDRIASTDHRA-----------
KNAG0C00190        -ASVDRKKFEAIAQQ-----RNLHLSQLNSLCLRSRYIKEKLASERNICSIR--------
NDAI0A00130        -NSNNITYDHVDNQQ-----YNVYLAQLNSLIVRVQYIRDKFLHNINQLDST--------
NCAS0B09120        -NMDIRGTLPQFLEQ-----YNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNS
TPHA0E04020        -S---NEALNALRST-----YDLYMSQLNSLYVRSEFIRDKLNSEKNNVNKF--------
Kpol_2002.7        -D---ENDLEKVTDT-----YNLYMSQLNSLYIRSQNVRDKLNTKKKSRTNTIKYVSPSK
Suva_3.151         -----RDSLDKLSQQ-----YNQYMSQLNSLYVRSESVRDKLSKEQWRRLNTE-------
Skud_3.2           -----QESLDKLSQQ-----YNQYMSQLNSLYVRSESVRDKLSKEQQRRLITE-------
Smik_3.13          -----QELLDKVSKQ-----YNQYMSQLNSLYVRSESVRDKLSKEQQRRLITE-------
YCL063W            -----QESLDKLSQQ-----YNQYMSQLNSLYVRSESVRDKLSKEQQRRLITE-------
ZYRO0F18502g       -----EHARDKIADQ-----YNLYMAQLNSLCVRSEYVRDKLNAGYQNRKPPI-------
TDEL0C06980        ------SSIDKLGNQ-----YNVYIAQLNSLCVRSEYVRDKLNKERERRMSI--------
                                             .* .*  .   :   .                  

AFR746C            --EWNLQAV-RKQFEMLDALSDELDGLV--MGSTPCSGLEPQGHQ-------------LE
Ecym_1007          --QIDLDTV-KKLGSEFEDISHNLCFLE----PNKVFDKNHTRFRSSEY---------PA
TBLA0A07580        --TNSHAYV-QQLVTEFYSLSIKMNELS---AIQENVTNGSSPLSNKSSHSNDSLSKITD
KLTH0F00462g       --SVQQRAI-ENLIQEFQEIAKNDENFI-----SYSMRESPNSMSVQS----------IC
Kwal_33.13003      --NSTQEAI-ERLEHDYKALCNHANELG---IREKNLEDSPSCLSPAS----------VS
KAFR0D00120        --QKERSFIVESLIHEFNEISTKLNEIV--------THTSPQST--------------ID
KLLA0C00462g       --CIEYETL-EKLIYEFQDITMSLNEVA-------RAYQSPTKSARSGSSKE------SS
CAGL0B00308g       --ELNTSRI-QELMLEFKEITLSLNEIAQQDDETNSKQLSPASTSTKSS---------LE
SAKL0C00440g       --SQDGDSI-GHLVTEFQKITTKLNELA---ATQDRAYQSPGSQSTKS----------VS
KNAG0C00190        --KGRRSYI-ENLVYEFQDIAMSLNELS----ETNRKNGSPVSQATTNS---------SD
NDAI0A00130        --QDEQKYI-ENLVYEFKQITLKLNDLSKKNKTTSSSENSSKTASSKSS---------ME
NCAS0B09120        --VDEQKYI-QDLVHEFQDITQKLSELS---TVRNPSTASSRSTSTKSS---------IE
TPHA0E04020        --NLDHRNI-EELVFEFQNIREKLNQLA---ASSKLDKHSPPKTSTRSSS--------ME
Kpol_2002.7        VNMNGQSDI-EDLIFEFQDITRKLNVLA----SSRRRCSSSKSSSSRSSS--------IG
Suva_3.151         --ENEHKRI-EDLVHEFQDITVRLNDLA--TVPNKASNDSPQSQSTRSS---------LD
Skud_3.2           --DNEHQRI-EDLVHEFQDITSRLNELA--TVPHGVSNDSPQSQSTRSS---------SG
Smik_3.13          --DNEHQRI-EDLVREFQDITLRLNELA--TAPNEVANDSPQSQSTRSS---------LE
YCL063W            --DNEHQRI-EDLVREFQDITLRLNELA--TVPNEAPNDSPQSQSTRSS---------LG
ZYRO0F18502g       --VNEQNYI-EDLVYEFQDITVKLNELA----QNQKEQVTPSSKHSNGS---------VN
TDEL0C06980        --INDRKYI-EDLVFEFQDITVKLNELA----QSQSIDSTPSSKSTRSS---------LG
                           :          :      .                                 

AFR746C            YLELKQLELLRLSAFS-----------SRSELVSNRGDHQAVLRGETDRARGTRIREIAG
Ecym_1007          PFQLRPLKLLQRIRNP-------------SENESKDNLRIYEGSAPQRDNPSFDLNSSLS
TBLA0A07580        GFQPRPLKILQRQKHN-----------NNQNTHPQPDLESPLKLKHRSSYNKL-----LS
KLTH0F00462g       SFQPKPLKILQRRQAQ--------------LESPTKRSFRPSMSLLDNRGDETNLATASD
Kwal_33.13003      SFQPKPLKIIERRLAQ-------------TNTSPTKVCTATVMAKSFCRSGTDKNSDYIP
KAFR0D00120        SFEPKPLNLLRKNKIL-----------ESPTRSSPVTRGRLERKISINLFPM------HT
KLLA0C00462g       VIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQEDDLDILHHLHS
CAGL0B00308g       SFTPKPLKILNRASMI-----------RSPINSPPKK-----RNISFCPIHEN-----LS
SAKL0C00440g       SFEPKPLKILERTKLQ------HPTSPTKRVATPPKKIAPLRKNPPFDKKVMF-----SG
KNAG0C00190        SFEPKPLRILERQRTC-------------NAKSPTKRNSNHIKIPRETEKSDFTENVADC
NDAI0A00130        SFEPKPLKIIKRTKND-----------QKVSNTINNDHDLIMQDENLQRPNSL-----PS
NCAS0B09120        SFKPKPLRIISRSNTH----------------SHLHQQTSLDKKVSFNEDESN-----SS
TPHA0E04020        SMNLKPLKVVAKHEKR-----------MSKELELKNKE----KSVTFGKETRISL---TT
Kpol_2002.7        SFQPKPLKISLKRNKS--------------LKEQNK------KTVTFDVEEVTD----LN
Suva_3.151         SFQPRPLKIIERQRLC-----------VVTPSKPPK------KSVVFNPINDV-----EC
Skud_3.2           SFQPRPLKIIERQRVC-----------MVTPSKPPK------KSVGFNPINDV-----DC
Smik_3.13          SFQPRPLKIIERQRLC-----------MVTPSKPPK------KSVGFNPINDV-----DC
YCL063W            SFQPRPLKIIERQRLC-----------MVTPSKPPK------KSVGFNPINEV-----DC
ZYRO0F18502g       SFQPRPLKITERYRTD-----------IGATRQSPTRINGKLKNVNFVEESLPEL---FC
TDEL0C06980        SFQPRPLKLTERHGPN-----------VKALRESPLKNKSVIKSVKFSGLHDSKE---EA
                    :  . * :                                                   

AFR746C            DGRKLQN------SRAPELVP----------GRVIPSNTSYDSS----------------
Ecym_1007          SLHGLVV------GADFSVIR-----------QGLMNWNSFEMHIPN-----VDALMPQN
TBLA0A07580        SNKKESK------PYKNFNSKKSKNNELLSDISPVKIQSFEEPTFSV------ANTRNKN
KLTH0F00462g       RSQERLL------GSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLN-------RRSNPHE
Kwal_33.13003      DEIGKTN---------SCNTNSPCTNEAKKEPKFIRVVKSCGTGLN-------KHSNPHE
KAFR0D00120        TTKCNSV------PTSPKCKS--T---STLNQRTLRNIKSYHYGLNG-------------
KLLA0C00462g       VKRANSL------PGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNG------RAKKNAD
CAGL0B00308g       VTEYESL------PSSPNRSNLLEE-----QEQVLHPARSFQTGLRT-----EKARKPDK
SAKL0C00440g       HSKSTSL------PGSPSMAA--SSPVSIQQERFPRHAKSCDAGLNK----QQRRRQDSD
KNAG0C00190        --LHSSL------PSSPLRGS--NG-----SQQTIRLTKSYHESLNG--------QKPTS
NDAI0A00130        SPIEKSS---------YVTIS--Q------NEQNLRLMKSQDFSTKKNTSRNTNYNTIRK
NCAS0B09120        ISHSRS----------MESLH--------ENSKSLRNTKSMDV---------LKRSTFKN
TPHA0E04020        NGIGGKLMIKDDSDASPQLID--K------KYKVLRNAISYDTGLNSKSKSNKRSNREYR
Kpol_2002.7        INSVISL------PGSPLRNE--QS--SPPMNHHLRQAKSYDTGLNS-----KRSIKPKK
Suva_3.151         PSKTNSL------PCSPKKQP--G------KAHTLRAAKSHDTGLN-------KSKKPSS
Skud_3.2           PSKTNSL------PCSPKKPP--A------KNRTLRAAKSHDTGLN-------KSKKMSS
Smik_3.13          PSKTNSL------PCSPKKQP--A------KNHTLRAAKSHDTGLN-------KSKKPSS
YCL063W            PSKTNSL------PCSPKKQP--A------RNRTLRAAKSHDTGLN-------KSKKPSS
ZYRO0F18502g       PSKCTSL------PGSPLKMR--SP--DRLPDRPLRVAKSYDTGLNP-----NSRAKLKK
TDEL0C06980        VSKCLSL------PGSPVRVT--G------PTRSIRMAKSYDTGLNS-----KNTKKSKG
                                                                               

AFR746C            ----------SLFRRSLDGHLSELFD--------------------------ISYHSDEE
Ecym_1007          LN----------FQEKSEFSTP-FFDS-------------------------LECNSDDE
TBLA0A07580        SM---DPLHYSLFKTNNRLSIQ-FPDGYDNDDEYDD----------------PTCISDQD
KLTH0F00462g       NR-------LNFFKDRQRLSIS-FIED-------------------------EEDVSDEA
Kwal_33.13003      NR-------LSFFRDRQRLSIS-FIED-------------------------DEYLSDEE
KAFR0D00120        -------DYINPFKENNRLSIS-FFNGDNTF---------------------NDNNSDSE
KLLA0C00462g       WE---------FFKNKNRLSLS-VFDDV------------------------NTDASDEE
CAGL0B00308g       NQ------LDKYFKDKQRLSLT-LFGSADADDGESLN---------------NNDYSDEE
SAKL0C00440g       NR-------LNFFKENQRLSIS-FFDDE------------------------IDYSSDED
KNAG0C00190        HS-----PLMNPFNAKNRLSLY-LFDNIDEKELTPC----------------DDDNSDQE
NDAI0A00130        FE---NDTINQFFKSQQRLSIG-IFDNDDDNIYSTNMGTATRITGEYL----TDNNSDQA
NCAS0B09120        HS-----DFSKLLNSRQRLSIN-IFDDDLIANEDGNEFYN------------QYSDSDQA
TPHA0E04020        KKNDAAYD--SLFKNKQRFSIS-LFEDYVDTTTNTNYNEFNPTVDASINTELIENNSDQE
Kpol_2002.7        SKIDSVYD--STFKNTQRLSIS-LFDIDTNEND-------------------ITNISDQE
Suva_3.151         TD---AYE--SFFKNKQRLSLT-FFDEMDD----------------------EDLDSDQD
Skud_3.2           TD---AYE--SFFKNKQRLSLT-FFDEMDD----------------------EDLDSDQD
Smik_3.13          AD---AYE--SFFKNRQRLSLT-FFDEMDD----------------------EDFDSDQD
YCL063W            SD---TYE--SFFKNRQRLSLT-FFDEMDD----------------------EDFDSDQD
ZYRO0F18502g       QK---EEEMLSVFKENQRLSIT-FCDDIDEG---------------------SDSASDQN
TDEL0C06980        SR---DYDVPSIFRENQRLSIT-VFDDFDED---------------------ADSTSDQD
                               :.         .                                **. 

AFR746C            TVVSIN--QQHLGDLSSV---------------------ISP-KERNTTY-------PK-
Ecym_1007          TVMSISRLDLDTCSFVSA---------------------SSQ-SKRFSISDY-----DR-
TBLA0A07580        TIFVST--PKIASSIKNT---------------------SEP-LRKFNSHESIL-SVEKS
KLTH0F00462g       TVISAG--SLQSAYI------------------------FET-DIKSSPFKSQI-GEKE-
Kwal_33.13003      TITSGS--PLNASFLLND---------------------FAK-VAKGRPNQTLA-SSRH-
KAFR0D00120        SDIDDDDTVLVTSPFLTN---------------------PKQKLKRSNSQDSVFWNENY-
KLLA0C00462g       TVISVS--PPNISYYLSQ----------------NEDQYPSKQVRRCNSHESIL-SRKI-
CAGL0B00308g       TVIFTSSSNIETDAITDD---------------------MKP-IRRCNSHESVLSVHNK-
SAKL0C00440g       TVISVS--PPETTSFKGF-------------------PKAEP-LRRYNSHESVL-SRKE-
KNAG0C00190        TVMYNS--PVV-----------------------SKGAAFEP-LRRYNSHESIL-SVAK-
NDAI0A00130        TVISQG----TIKRNDDD---------------------FTP-LRRYNSHESIL-S-QK-
NCAS0B09120        TVISHG----TPIRGADT-----------------------PLLRRYNSHESIL-SFRK-
TPHA0E04020        TVISSSHLPCITNEPLDDYILSNSIQLDKNNNSGNNEGKKSH-LRRCNSHESIL-S-TK-
Kpol_2002.7        TVISSSSLTMDEPLEIID----------------DQKNNLKP-LRRYNSHESIL-S-TK-
Suva_3.151         TIILPN--ISTPSHMDMA----------------TKGAEFEP-LRRYNSHESIL-S-NK-
Skud_3.2           TIILPN--ISTPPHMNVT----------------AKGAEFEP-LRRYNSHESIL-S-NK-
Smik_3.13          TVILPN--ISTPPHVNVT----------------AKGAEFEP-LRRYNSHESIL-S-NK-
YCL063W            TIILPN--ISTPPHVGVT----------------AKGAEFEP-LRRYNSHESIL-S-NK-
ZYRO0F18502g       TVISTS--PIPPSHPIQY----------------DVQSEKPP-LRRYNSHDSVL-S-TK-
TDEL0C06980        TVISLV--PADDGKGL-------------------------P-LRRFNSHESIL-S-TK-
                   :                                            .              

AFR746C            ----TQDLS----IGGQNFPP------FRDQYPITTSSAATSNSTAAVTYCSVQ--SSFG
Ecym_1007          ----IACRH----GSTIEVLG------TPPFFNLNHNIQE--LARTAIVGSSYV--CSFS
TBLA0A07580        NMKFIQPLP--------ALKP------PSSLLNLTLKKNLRSVSSVSSNNVSLTYNPMIS
KLTH0F00462g       ----IRIPKAGYLAVGEKSKG------FNNLLSATPS-----APQIGITEVDYK--PNFG
Kwal_33.13003      ----VENNE--RGAQTAAVSP------FVSLVPKKTC-----TAQIGLTSIDIR--PDFG
KAFR0D00120        ----LRKPS-----FQKQLNL------FPSTLTKPTA------------ELSST--QVFL
KLLA0C00462g       ----LSPST------PANLIM------RPTYQSVWQKKAIVTKPTISCSTSNSTASPTIG
CAGL0B00308g       ----FVPKNNNNLQFQNRLEP------FGRYLATSNNRNFT-IPSIQNIQVSGT--STLS
SAKL0C00440g       ----VLPAA---------LPA------RAGWFSLWAGRNNKPKPMAESVSINDK--PVYS
KNAG0C00190        ----KAPIH--------SSAQ------KLQFYPSATNG----TTSAQSVFVSSK--PVYT
NDAI0A00130        ----ISSTP---LIDNNNNLT------FNSKLPLYSSIRR---PSMQSIHVTSN--PIFA
NCAS0B09120        ----PTQSR------------------QPNQILPYSSVR---QPSMQSVAVNSN--PIFS
TPHA0E04020        ----LENTF------YKNVGSNFYDRFIFSSFYRPTV------ASVSTTSTNIE--PFLS
Kpol_2002.7        ----IRPIS---ISKRFQIGP------FRSVSTTTTSTNY--DTTASNTDVKAD--DFYK
Suva_3.151         ----PAPAM------SLSLGS------FP--FFKPSNPTF--GTSVSNVQVNYR--PKMA
Skud_3.2           ----PAPIM------SLSLGG------FPGSFYKPSHPTF--GTSTSNVQVDCH--PTIT
Smik_3.13          ----PAPLM------SHSLGS------FPVSFFKPSNPTF--GTSISNVQANCH--PTIT
YCL063W            ----PAPSK------SLNLGS------FSASFFRPSNPTF--GTSISNVQVNCH--PTVA
ZYRO0F18502g       ----VQPIS---------SAK------CPTFLTIPTAN----RPSMKSVTVSSA--PIIS
TDEL0C06980        ----VQPIS---------SLP------LFSSFLLPSSN----RPSMKSVRVSSA--PVFS
                                                                               

AFR746C            ENSR-------------LDKLSVTHGFLKSLA-----GHAMDDRQKGSARFMNGQ-----
Ecym_1007          TRYK----------MNHFKKAVTSRDLLTKFVEPVTTTKPLPAAKENHLHWW--------
TBLA0A07580        KLNT---TTIIPSEHTRNQMRVNSVDLLNLYV-----QQPTPKKLKTESQSPNPPSTDTL
KLTH0F00462g       FSHQ----------PGVEREASQSKKMLSQLV-----SQGNKTKCKNWFNE---------
Kwal_33.13003      PCFS-----------PKKFETTESKEILSHFV-----IKEPRTKSHSWLK----------
KAFR0D00120        KNTG--------------RLGSSSKALLTSFV-----KDNLQQQQRTHN-----------
KLLA0C00462g       SPHL-------------------SKDMLSQFV-----TAPPSKKYRGWF-----------
CAGL0B00308g       RFSR------EQDREMTQLGSKTSKDLLTSVM-----TATPITT----------------
SAKL0C00440g       TAAL---------LRSHSKTTETSKDLLAQFV-----SAAPKQKKQTTSWFGP-------
KNAG0C00190        KPLS---------------VQSRSKDLLSSIA-----HAEAS------------------
NDAI0A00130        RSSQ----------------GKTSKDLLSSFV-----TSSIPRNNNRNIQTRTKTRTQSR
NCAS0B09120        RMRP----------------NATSKDLLSSFI-----NKPQPNRLHQQK-----------
TPHA0E04020        DGKNESPNKNLQLPLTSSTRGVTSRELLSKFA-----DKPEQLKAPTTS-----------
Kpol_2002.7        PNLS---------------NSTTSKDILSMYS-----IKNDVQNSNRGNIINNKK-----
Suva_3.151         ASMI---------PKRNGSRAPTSKALLSSFI-----AQPDRIVVKQKS-----------
Skud_3.2           VSMA---------SRRNGCYAPSSKALLSSFI-----ARPDRIAAKQDP-----------
Smik_3.13          ATMA---------PRRNGVHAPSSKALLSSFI-----GRSERPMVKQNT-----------
YCL063W            ATMA---------PSRNGPRISSSKALLSSFI-----ARSDTHTVKENN-----------
ZYRO0F18502g       STGG----------------KASSKDLLSSFI-----SNTQDYDKKARN-----------
TDEL0C06980        KTSA----------------PASSRDLLSTFV-----TRPGKASNATGI-----------
                                          :  :*                                

AFR746C            ----------FIPNISHFFRR--WKIFS---HQSMN--VSEPCTTQPFASVDKSDIRSLH
Ecym_1007          ----------PIINLSGILTK--CKIRN---HGNPV--TSESCPHEETSETANQILKHTG
TBLA0A07580        P---------SSNKESSVFSN--WNILNLISTPRLSISSSVTNTQAASTKAPKPIKNKPN
KLTH0F00462g       ----------CDGLGKPISNT--LRLLN---NLVLV--TSETGLRSVNNTTSAKLLMPPR
Kwal_33.13003      ----------GCDKSVPFLQT--FKIFN---NQVLV--TSETGCRNVDRTTSTKLITPSR
KAFR0D00120        ---------------ASSFNN----IFN---SVTSE--------IGKSKLDKSQIIHTER
KLLA0C00462g       ----------SSSNSTPFASSIFQKWFN---SDSLV--TKEIGNPDNSSPSSGRPIVENR
CAGL0B00308g       ----------QRNNKLTFFDK-----FNSMFNFSTI--SEEQKTTVEKNRSAESPRND--
SAKL0C00440g       ----------AEEPKRSIFSG--WKLFN---NSVLV--TSETG-LQDSNSKPSAKRIGAA
KNAG0C00190        ----------KDTKTTSVFNG--WNLFG---KSSTAAITSEVGTCAISQKKHSAIKTNRR
NDAI0A00130        RNNQLRDHTINQTSTSSFFGN--WNFLN---RFNMI--TSETNTTTNRKRNYNIPLVN--
NCAS0B09120        ----------PKPNSNSLFGK--WNFFN---KFNSV--TSEIGTTTTQLYPTN-------
TPHA0E04020        ----------NSNSSKYFFEN--WGLFS---SMSSS--STF---HRKNTSGSNIISSEVG
Kpol_2002.7        ----------ESNSSTSFFNK--WNIFN---FPLIA--SSEVGSKQENNTTAKHFGSQRK
Suva_3.151         ----------TNLKHTSFLDK-----FN---SSLST--------ISESFQNKKGKKSS--
Skud_3.2           ----------TNLKHTSFLDK-----FN---SSLST--------ISESFQNKKGKKNK--
Smik_3.13          ----------PNLKHVSLLDK-----FN---SSLTT--------ISESFQSKKKKNK---
YCL063W            ----------TNLKHASFMDK-----FN---SSLST--------ISESFQSKRGRKNK--
ZYRO0F18502g       ----------DNGNNNRFSSNLIWNLFK---QKSQK--NRNPTPLRVPQQDVTSERKENQ
TDEL0C06980        ----------KQENKLGFFAN--WNFFK---GPSSA--SHD---IRATKQKASASRPE--
                                                                               

AFR746C            NQDMASQDSTR--------KFSTVTEDSFCSEDAYSGPSIKVTMTPVLYEYLKEALETEL
Ecym_1007          KSTLENQAHIRSEV-----SQCSLFLEPNGSKFVHQFGGEQVVCSEISYSSL--------
TBLA0A07580        YGDLLNHSNEF--------HYEPPLHYQSNLQTHNQNTDAAVISRGISVSDLEHALNTNL
KLTH0F00462g       KR-KEKQAAHG--------SCSIFIHGSSRSKF-VTAPQQTKLHFKVSHGALQEALNTDL
Kwal_33.13003      KHFAQRELSDR--------TCSILVHGSSGSRF-VNAPQQQELHFKVSYEALREALNTDL
KAFR0D00120        RVLSDNSIVISTLI-----TSKKSRFNRFSSVDNISPTKKPIINNDVQYSDLNDALNTEF
KLLA0C00462g       QRHSSSNS-----------YSTSIVIGPNGAKF-IRGLNDPLVTCTVSYNELQEALNTEF
CAGL0B00308g       ---------------------------------------------FVSIEELNEALTTNM
SAKL0C00440g       APAKRVPLGRRKTHL----PSSSLIMGPNGSRF-VSPPNEPVLNNKVSYDALHEALCTEF
KNAG0C00190        YITGDTLVISTSNRPR---LSRSSVRQPHGYNR-HTSPITPIVDHQVRQNELSEALETEL
NDAI0A00130        -------------------QSRAHNIDVNDTMD-SISIKEPVYDNTISLDDLEDALNTEL
NCAS0B09120        -------------------SSMSNKFNPNDIPS-SASIREPVFDDSLHLEDLNDALNTEL
TPHA0E04020        KKLCDRSTGIKVTSINTQNAYTFPFIRSNSHDITKQNITNPIIKERVSYNELHDALNTEI
Kpol_2002.7        KQISSLSYNKA--------NYSTMTIGPNGSMFCSPTIYEPTFSNTVSFQELHDALNTEL
Suva_3.151         ----DLNDDRI-----------PPHIMPEHNNN--------LMDMGVSIEELQDALNTEL
Skud_3.2           ----DVNDGRI--------SNLNHIATQEQKKN--------IMDMSVSIEELQDALNTEL
Smik_3.13          ----DLNDERI--------SSLDHIGAHDRNNC--------IMDMSVSIEELQDALNTEL
YCL063W            ----GMNEERI--------SN-HNVAQEQKNN----------MDISVSIEELQDALNTEL
ZYRO0F18502g       LLTTSHPSGVY--------SSCSRLLVKNQNSSIISPTRQRITNGNTMYDELQEALDTEL
TDEL0C06980        ----SNSADCR--------SKTLEKMAPRRFSP-RSPVKAPVFDSLISYEDLREALSTEI
                                                                      *        

AFR746C            RFN---
Ecym_1007          ------
TBLA0A07580        KL----
KLTH0F00462g       DFK---
Kwal_33.13003      NN----
KAFR0D00120        LY----
KLLA0C00462g       NF----
CAGL0B00308g       VM----
SAKL0C00440g       RL----
KNAG0C00190        LL----
NDAI0A00130        LL----
NCAS0B09120        LL----
TPHA0E04020        KLLF--
Kpol_2002.7        DLA---
Suva_3.151         LL----
Skud_3.2           LF----
Smik_3.13          LL----
YCL063W            LF----
ZYRO0F18502g       VL----
TDEL0C06980        ILTSNR
                         

FASTA FORMAT for MUSCLE Version 3.6

>AFR746C
----MDELQRTVLALQTRSDELVLQLRSSVVEC---ERVGR-----------AEICGCAV
RAALAEGICDGAMCEARRWEFYALLMQLTSLRVRVEHISGTVRGMLRRG-----------
--EWNLQAV-RKQFEMLDALSDELDGLV--MGSTPCSGLEPQGHQ-------------LE
YLELKQLELLRLSAFS-----------SRSELVSNRGDHQAVLRGETDRARGTRIREIAG
DGRKLQN------SRAPELVP----------GRVIPSNTSYDSS----------------
----------SLFRRSLDGHLSELFD--------------------------ISYHSDEE
TVVSIN--QQHLGDLSSV---------------------ISP-KERNTTY-------PK-
----TQDLS----IGGQNFPP------FRDQYPITTSSAATSNSTAAVTYCSVQ--SSFG
ENSR-------------LDKLSVTHGFLKSLA-----GHAMDDRQKGSARFMNGQ-----
----------FIPNISHFFRR--WKIFS---HQSMN--VSEPCTTQPFASVDKSDIRSLH
NQDMASQDSTR--------KFSTVTEDSFCSEDAYSGPSIKVTMTPVLYEYLKEALETEL
RFN---
>Ecym_1007
----MLVSEYEIHRLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTC
RSAVQQSCGDQRTEQMRR--YQSSMAHLMSLSIRAQFLIDKFHKGGSGY-----------
--QIDLDTV-KKLGSEFEDISHNLCFLE----PNKVFDKNHTRFRSSEY---------PA
PFQLRPLKLLQRIRNP-------------SENESKDNLRIYEGSAPQRDNPSFDLNSSLS
SLHGLVV------GADFSVIR-----------QGLMNWNSFEMHIPN-----VDALMPQN
LN----------FQEKSEFSTP-FFDS-------------------------LECNSDDE
TVMSISRLDLDTCSFVSA---------------------SSQ-SKRFSISDY-----DR-
----IACRH----GSTIEVLG------TPPFFNLNHNIQE--LARTAIVGSSYV--CSFS
TRYK----------MNHFKKAVTSRDLLTKFVEPVTTTKPLPAAKENHLHWW--------
----------PIINLSGILTK--CKIRN---HGNPV--TSESCPHEETSETANQILKHTG
KSTLENQAHIRSEV-----SQCSLFLEPNGSKFVHQFGGEQVVCSEISYSSL--------
------
>TBLA0A07580
----MALQEEVSIRLLTKAQEAVLQLDLWIKDQ---QG--------------FQNRD--G
LRASTSESLEQAERD-----YNRYMFQLNSLYLRAQYIRDKIEKQNAYNLADSDVAGND-
--TNSHAYV-QQLVTEFYSLSIKMNELS---AIQENVTNGSSPLSNKSSHSNDSLSKITD
GFQPRPLKILQRQKHN-----------NNQNTHPQPDLESPLKLKHRSSYNKL-----LS
SNKKESK------PYKNFNSKKSKNNELLSDISPVKIQSFEEPTFSV------ANTRNKN
SM---DPLHYSLFKTNNRLSIQ-FPDGYDNDDEYDD----------------PTCISDQD
TIFVST--PKIASSIKNT---------------------SEP-LRKFNSHESIL-SVEKS
NMKFIQPLP--------ALKP------PSSLLNLTLKKNLRSVSSVSSNNVSLTYNPMIS
KLNT---TTIIPSEHTRNQMRVNSVDLLNLYV-----QQPTPKKLKTESQSPNPPSTDTL
P---------SSNKESSVFSN--WNILNLISTPRLSISSSVTNTQAASTKAPKPIKNKPN
YGDLLNHSNEF--------HYEPPLHYQSNLQTHNQNTDAAVISRGISVSDLEHALNTNL
KL----
>KLTH0F00462g
----MEQLQEIAQESLALSQSALARLDSCLERQ---RRLYE-----------SGFPD---
-QCLSDKSSTNMAQ------YYEYIGQLYSLYTKAQKLSDTVILSDSKSLS---------
--SVQQRAI-ENLIQEFQEIAKNDENFI-----SYSMRESPNSMSVQS----------IC
SFQPKPLKILQRRQAQ--------------LESPTKRSFRPSMSLLDNRGDETNLATASD
RSQERLL------GSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLN-------RRSNPHE
NR-------LNFFKDRQRLSIS-FIED-------------------------EEDVSDEA
TVISAG--SLQSAYI------------------------FET-DIKSSPFKSQI-GEKE-
----IRIPKAGYLAVGEKSKG------FNNLLSATPS-----APQIGITEVDYK--PNFG
FSHQ----------PGVEREASQSKKMLSQLV-----SQGNKTKCKNWFNE---------
----------CDGLGKPISNT--LRLLN---NLVLV--TSETGLRSVNNTTSAKLLMPPR
KR-KEKQAAHG--------SCSIFIHGSSRSKF-VTAPQQTKLHFKVSHGALQEALNTDL
DFK---
>Kwal_33.13003
----MEQLAKIAQCALERSEEALVRLEKCVGKQ---RRLYE-----------SERSD---
-QCLSEESSSTIVQ------YYSYLGQLNCLYIKAQSLKDMMGNRCGHLP----------
--NSTQEAI-ERLEHDYKALCNHANELG---IREKNLEDSPSCLSPAS----------VS
SFQPKPLKIIERRLAQ-------------TNTSPTKVCTATVMAKSFCRSGTDKNSDYIP
DEIGKTN---------SCNTNSPCTNEAKKEPKFIRVVKSCGTGLN-------KHSNPHE
NR-------LSFFRDRQRLSIS-FIED-------------------------DEYLSDEE
TITSGS--PLNASFLLND---------------------FAK-VAKGRPNQTLA-SSRH-
----VENNE--RGAQTAAVSP------FVSLVPKKTC-----TAQIGLTSIDIR--PDFG
PCFS-----------PKKFETTESKEILSHFV-----IKEPRTKSHSWLK----------
----------GCDKSVPFLQT--FKIFN---NQVLV--TSETGCRNVDRTTSTKLITPSR
KHFAQRELSDR--------TCSILVHGSSGSRF-VNAPQQQELHFKVSYEALREALNTDL
NN----
>KAFR0D00120
----MASL--VSDTLLQRSEEAVSQLESWLKQQ---EQ----------------------
--------LHQTTAE-----YK----QLNSLCAKSKYISNLLKDDSSSIPHDLME-----
--QKERSFIVESLIHEFNEISTKLNEIV--------THTSPQST--------------ID
SFEPKPLNLLRKNKIL-----------ESPTRSSPVTRGRLERKISINLFPM------HT
TTKCNSV------PTSPKCKS--T---STLNQRTLRNIKSYHYGLNG-------------
-------DYINPFKENNRLSIS-FFNGDNTF---------------------NDNNSDSE
SDIDDDDTVLVTSPFLTN---------------------PKQKLKRSNSQDSVFWNENY-
----LRKPS-----FQKQLNL------FPSTLTKPTA------------ELSST--QVFL
KNTG--------------RLGSSSKALLTSFV-----KDNLQQQQRTHN-----------
---------------ASSFNN----IFN---SVTSE--------IGKSKLDKSQIIHTER
RVLSDNSIVISTLI-----TSKKSRFNRFSSVDNISPTKKPIINNDVQYSDLNDALNTEF
LY----
>KLLA0C00462g
----MEDMRYVAERLVIRCNEAVMQLELSIQRK---M---------------CEFDP---
-N---NSHCFIQVQE-----YYSFLARLSSLKLRAEHVQESLRHQRKDPNDV--------
--CIEYETL-EKLIYEFQDITMSLNEVA-------RAYQSPTKSARSGSSKE------SS
VIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQEDDLDILHHLHS
VKRANSL------PGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNG------RAKKNAD
WE---------FFKNKNRLSLS-VFDDV------------------------NTDASDEE
TVISVS--PPNISYYLSQ----------------NEDQYPSKQVRRCNSHESIL-SRKI-
----LSPST------PANLIM------RPTYQSVWQKKAIVTKPTISCSTSNSTASPTIG
SPHL-------------------SKDMLSQFV-----TAPPSKKYRGWF-----------
----------SSSNSTPFASSIFQKWFN---SDSLV--TKEIGNPDNSSPSSGRPIVENR
QRHSSSNS-----------YSTSIVIGPNGAKF-IRGLNDPLVTCTVSYNELQEALNTEF
NF----
>CAGL0B00308g
----MASLEEITERLLERSNEAIEQLDEWILLQ---NKN-------------RHISE---
-NKSGLDSIERLDDK-----YTEFLEKLNSLYIRSQYIKDKIRTEKNAKATKRKS-----
--ELNTSRI-QELMLEFKEITLSLNEIAQQDDETNSKQLSPASTSTKSS---------LE
SFTPKPLKILNRASMI-----------RSPINSPPKK-----RNISFCPIHEN-----LS
VTEYESL------PSSPNRSNLLEE-----QEQVLHPARSFQTGLRT-----EKARKPDK
NQ------LDKYFKDKQRLSLT-LFGSADADDGESLN---------------NNDYSDEE
TVIFTSSSNIETDAITDD---------------------MKP-IRRCNSHESVLSVHNK-
----FVPKNNNNLQFQNRLEP------FGRYLATSNNRNFT-IPSIQNIQVSGT--STLS
RFSR------EQDREMTQLGSKTSKDLLTSVM-----TATPITT----------------
----------QRNNKLTFFDK-----FNSMFNFSTI--SEEQKTTVEKNRSAESPRND--
---------------------------------------------FVSIEELNEALTTNM
VM----
>SAKL0C00440g
----MEGLHEISQKLLVRSQEAILQLDLYIQRQ---QRLYE-----------YETLD---
-Q--PDNGLLTKLQE-----YQTCLAQLNSLHIRSEHLRDRIASTDHRA-----------
--SQDGDSI-GHLVTEFQKITTKLNELA---ATQDRAYQSPGSQSTKS----------VS
SFEPKPLKILERTKLQ------HPTSPTKRVATPPKKIAPLRKNPPFDKKVMF-----SG
HSKSTSL------PGSPSMAA--SSPVSIQQERFPRHAKSCDAGLNK----QQRRRQDSD
NR-------LNFFKENQRLSIS-FFDDE------------------------IDYSSDED
TVISVS--PPETTSFKGF-------------------PKAEP-LRRYNSHESVL-SRKE-
----VLPAA---------LPA------RAGWFSLWAGRNNKPKPMAESVSINDK--PVYS
TAAL---------LRSHSKTTETSKDLLAQFV-----SAAPKQKKQTTSWFGP-------
----------AEEPKRSIFSG--WKLFN---NSVLV--TSETG-LQDSNSKPSAKRIGAA
APAKRVPLGRRKTHL----PSSSLIMGPNGSRF-VSPPNEPVLNNKVSYDALHEALCTEF
RL----
>KNAG0C00190
----MDCLEDVTDRLLIRSQDAILQLELWVQQQ---EKL-------------LLTDH---
-ASVDRKKFEAIAQQ-----RNLHLSQLNSLCLRSRYIKEKLASERNICSIR--------
--KGRRSYI-ENLVYEFQDIAMSLNELS----ETNRKNGSPVSQATTNS---------SD
SFEPKPLRILERQRTC-------------NAKSPTKRNSNHIKIPRETEKSDFTENVADC
--LHSSL------PSSPLRGS--NG-----SQQTIRLTKSYHESLNG--------QKPTS
HS-----PLMNPFNAKNRLSLY-LFDNIDEKELTPC----------------DDDNSDQE
TVMYNS--PVV-----------------------SKGAAFEP-LRRYNSHESIL-SVAK-
----KAPIH--------SSAQ------KLQFYPSATNG----TTSAQSVFVSSK--PVYT
KPLS---------------VQSRSKDLLSSIA-----HAEAS------------------
----------KDTKTTSVFNG--WNLFG---KSSTAAITSEVGTCAISQKKHSAIKTNRR
YITGDTLVISTSNRPR---LSRSSVRQPHGYNR-HTSPITPIVDHQVRQNELSEALETEL
LL----
>NDAI0A00130
---MSTTLQDITERLLIRSQEAILQLDLWIQRE---KKQQE-----------LSTLN---
-NSNNITYDHVDNQQ-----YNVYLAQLNSLIVRVQYIRDKFLHNINQLDST--------
--QDEQKYI-ENLVYEFKQITLKLNDLSKKNKTTSSSENSSKTASSKSS---------ME
SFEPKPLKIIKRTKND-----------QKVSNTINNDHDLIMQDENLQRPNSL-----PS
SPIEKSS---------YVTIS--Q------NEQNLRLMKSQDFSTKKNTSRNTNYNTIRK
FE---NDTINQFFKSQQRLSIG-IFDNDDDNIYSTNMGTATRITGEYL----TDNNSDQA
TVISQG----TIKRNDDD---------------------FTP-LRRYNSHESIL-S-QK-
----ISSTP---LIDNNNNLT------FNSKLPLYSSIRR---PSMQSIHVTSN--PIFA
RSSQ----------------GKTSKDLLSSFV-----TSSIPRNNNRNIQTRTKTRTQSR
RNNQLRDHTINQTSTSSFFGN--WNFLN---RFNMI--TSETNTTTNRKRNYNIPLVN--
-------------------QSRAHNIDVNDTMD-SISIKEPVYDNTISLDDLEDALNTEL
LL----
>NCAS0B09120
----MSLLQDISERLLVRSQEAILQLDVWIQRQ---RRLQELMEGEEEQEQGGDTNT---
-NMDIRGTLPQFLEQ-----YNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNS
--VDEQKYI-QDLVHEFQDITQKLSELS---TVRNPSTASSRSTSTKSS---------IE
SFKPKPLRIISRSNTH----------------SHLHQQTSLDKKVSFNEDESN-----SS
ISHSRS----------MESLH--------ENSKSLRNTKSMDV---------LKRSTFKN
HS-----DFSKLLNSRQRLSIN-IFDDDLIANEDGNEFYN------------QYSDSDQA
TVISHG----TPIRGADT-----------------------PLLRRYNSHESIL-SFRK-
----PTQSR------------------QPNQILPYSSVR---QPSMQSVAVNSN--PIFS
RMRP----------------NATSKDLLSSFI-----NKPQPNRLHQQK-----------
----------PKPNSNSLFGK--WNFFN---KFNSV--TSEIGTTTTQLYPTN-------
-------------------SSMSNKFNPNDIPS-SASIREPVFDDSLHLEDLNDALNTEL
LL----
>TPHA0E04020
MHSLNSNLEELSEKLLIRSQEAILQLDLWILRQ---QQQHNDHRFGTATDTGNKTKD---
-S---NEALNALRST-----YDLYMSQLNSLYVRSEFIRDKLNSEKNNVNKF--------
--NLDHRNI-EELVFEFQNIREKLNQLA---ASSKLDKHSPPKTSTRSSS--------ME
SMNLKPLKVVAKHEKR-----------MSKELELKNKE----KSVTFGKETRISL---TT
NGIGGKLMIKDDSDASPQLID--K------KYKVLRNAISYDTGLNSKSKSNKRSNREYR
KKNDAAYD--SLFKNKQRFSIS-LFEDYVDTTTNTNYNEFNPTVDASINTELIENNSDQE
TVISSSHLPCITNEPLDDYILSNSIQLDKNNNSGNNEGKKSH-LRRCNSHESIL-S-TK-
----LENTF------YKNVGSNFYDRFIFSSFYRPTV------ASVSTTSTNIE--PFLS
DGKNESPNKNLQLPLTSSTRGVTSRELLSKFA-----DKPEQLKAPTTS-----------
----------NSNSSKYFFEN--WGLFS---SMSSS--STF---HRKNTSGSNIISSEVG
KKLCDRSTGIKVTSINTQNAYTFPFIRSNSHDITKQNITNPIIKERVSYNELHDALNTEI
KLLF--
>Kpol_2002.7
--MPYSNIDDLSERLLVRSQEAILQLDLWIQRQ---QQWAE-----------SDDNH---
-D---ENDLEKVTDT-----YNLYMSQLNSLYIRSQNVRDKLNTKKKSRTNTIKYVSPSK
VNMNGQSDI-EDLIFEFQDITRKLNVLA----SSRRRCSSSKSSSSRSSS--------IG
SFQPKPLKISLKRNKS--------------LKEQNK------KTVTFDVEEVTD----LN
INSVISL------PGSPLRNE--QS--SPPMNHHLRQAKSYDTGLNS-----KRSIKPKK
SKIDSVYD--STFKNTQRLSIS-LFDIDTNEND-------------------ITNISDQE
TVISSSSLTMDEPLEIID----------------DQKNNLKP-LRRYNSHESIL-S-TK-
----IRPIS---ISKRFQIGP------FRSVSTTTTSTNY--DTTASNTDVKAD--DFYK
PNLS---------------NSTTSKDILSMYS-----IKNDVQNSNRGNIINNKK-----
----------ESNSSTSFFNK--WNIFN---FPLIA--SSEVGSKQENNTTAKHFGSQRK
KQISSLSYNKA--------NYSTMTIGPNGSMFCSPTIYEPTFSNTVSFQELHDALNTEL
DLA---
>Suva_3.151
--MATQALEDITERLLTRSEEAILQLDLWIQRQ---QRSSV-----------CEPSD---
-----RDSLDKLSQQ-----YNQYMSQLNSLYVRSESVRDKLSKEQWRRLNTE-------
--ENEHKRI-EDLVHEFQDITVRLNDLA--TVPNKASNDSPQSQSTRSS---------LD
SFQPRPLKIIERQRLC-----------VVTPSKPPK------KSVVFNPINDV-----EC
PSKTNSL------PCSPKKQP--G------KAHTLRAAKSHDTGLN-------KSKKPSS
TD---AYE--SFFKNKQRLSLT-FFDEMDD----------------------EDLDSDQD
TIILPN--ISTPSHMDMA----------------TKGAEFEP-LRRYNSHESIL-S-NK-
----PAPAM------SLSLGS------FP--FFKPSNPTF--GTSVSNVQVNYR--PKMA
ASMI---------PKRNGSRAPTSKALLSSFI-----AQPDRIVVKQKS-----------
----------TNLKHTSFLDK-----FN---SSLST--------ISESFQNKKGKKSS--
----DLNDDRI-----------PPHIMPEHNNN--------LMDMGVSIEELQDALNTEL
LL----
>Skud_3.2
--MATQALEDITERLLIRSQEAILQLDLWIQRQ---QRSSV-----------CQTSD---
-----QESLDKLSQQ-----YNQYMSQLNSLYVRSESVRDKLSKEQQRRLITE-------
--DNEHQRI-EDLVHEFQDITSRLNELA--TVPHGVSNDSPQSQSTRSS---------SG
SFQPRPLKIIERQRVC-----------MVTPSKPPK------KSVGFNPINDV-----DC
PSKTNSL------PCSPKKPP--A------KNRTLRAAKSHDTGLN-------KSKKMSS
TD---AYE--SFFKNKQRLSLT-FFDEMDD----------------------EDLDSDQD
TIILPN--ISTPPHMNVT----------------AKGAEFEP-LRRYNSHESIL-S-NK-
----PAPIM------SLSLGG------FPGSFYKPSHPTF--GTSTSNVQVDCH--PTIT
VSMA---------SRRNGCYAPSSKALLSSFI-----ARPDRIAAKQDP-----------
----------TNLKHTSFLDK-----FN---SSLST--------ISESFQNKKGKKNK--
----DVNDGRI--------SNLNHIATQEQKKN--------IMDMSVSIEELQDALNTEL
LF----
>Smik_3.13
--MTTQALEDITERLLIRSQEAILQLDLWIQRQ---QRSSV-----------CQTTD---
-----QELLDKVSKQ-----YNQYMSQLNSLYVRSESVRDKLSKEQQRRLITE-------
--DNEHQRI-EDLVREFQDITLRLNELA--TAPNEVANDSPQSQSTRSS---------LE
SFQPRPLKIIERQRLC-----------MVTPSKPPK------KSVGFNPINDV-----DC
PSKTNSL------PCSPKKQP--A------KNHTLRAAKSHDTGLN-------KSKKPSS
AD---AYE--SFFKNRQRLSLT-FFDEMDD----------------------EDFDSDQD
TVILPN--ISTPPHVNVT----------------AKGAEFEP-LRRYNSHESIL-S-NK-
----PAPLM------SHSLGS------FPVSFFKPSNPTF--GTSISNVQANCH--PTIT
ATMA---------PRRNGVHAPSSKALLSSFI-----GRSERPMVKQNT-----------
----------PNLKHVSLLDK-----FN---SSLTT--------ISESFQSKKKKNK---
----DLNDERI--------SSLDHIGAHDRNNC--------IMDMSVSIEELQDALNTEL
LL----
>YCL063W
--MATQALEDITERLLIRSQEAILQLDLWIQRQ---QRSSI-----------CQTTD---
-----QESLDKLSQQ-----YNQYMSQLNSLYVRSESVRDKLSKEQQRRLITE-------
--DNEHQRI-EDLVREFQDITLRLNELA--TVPNEAPNDSPQSQSTRSS---------LG
SFQPRPLKIIERQRLC-----------MVTPSKPPK------KSVGFNPINEV-----DC
PSKTNSL------PCSPKKQP--A------RNRTLRAAKSHDTGLN-------KSKKPSS
SD---TYE--SFFKNRQRLSLT-FFDEMDD----------------------EDFDSDQD
TIILPN--ISTPPHVGVT----------------AKGAEFEP-LRRYNSHESIL-S-NK-
----PAPSK------SLNLGS------FSASFFRPSNPTF--GTSISNVQVNCH--PTVA
ATMA---------PSRNGPRISSSKALLSSFI-----ARSDTHTVKENN-----------
----------TNLKHASFMDK-----FN---SSLST--------ISESFQSKRGRKNK--
----GMNEERI--------SN-HNVAQEQKNN----------MDISVSIEELQDALNTEL
LF----
>ZYRO0F18502g
----MPSLDDISERLFIRSQEAVLQLELWIRRQ---QHL-------------SEIEH---
-----EHARDKIADQ-----YNLYMAQLNSLCVRSEYVRDKLNAGYQNRKPPI-------
--VNEQNYI-EDLVYEFQDITVKLNELA----QNQKEQVTPSSKHSNGS---------VN
SFQPRPLKITERYRTD-----------IGATRQSPTRINGKLKNVNFVEESLPEL---FC
PSKCTSL------PGSPLKMR--SP--DRLPDRPLRVAKSYDTGLNP-----NSRAKLKK
QK---EEEMLSVFKENQRLSIT-FCDDIDEG---------------------SDSASDQN
TVISTS--PIPPSHPIQY----------------DVQSEKPP-LRRYNSHDSVL-S-TK-
----VQPIS---------SAK------CPTFLTIPTAN----RPSMKSVTVSSA--PIIS
STGG----------------KASSKDLLSSFI-----SNTQDYDKKARN-----------
----------DNGNNNRFSSNLIWNLFK---QKSQK--NRNPTPLRVPQQDVTSERKENQ
LLTTSHPSGVY--------SSCSRLLVKNQNSSIISPTRQRITNGNTMYDELQEALDTEL
VL----
>TDEL0C06980
-----MELEDLSERLLTRSQEAILQLELWIQRQ---QHL-------------RELED---
------SSIDKLGNQ-----YNVYIAQLNSLCVRSEYVRDKLNKERERRMSI--------
--INDRKYI-EDLVFEFQDITVKLNELA----QSQSIDSTPSSKSTRSS---------LG
SFQPRPLKLTERHGPN-----------VKALRESPLKNKSVIKSVKFSGLHDSKE---EA
VSKCLSL------PGSPVRVT--G------PTRSIRMAKSYDTGLNS-----KNTKKSKG
SR---DYDVPSIFRENQRLSIT-VFDDFDED---------------------ADSTSDQD
TVISLV--PADDGKGL-------------------------P-LRRFNSHESIL-S-TK-
----VQPIS---------SLP------LFSSFLLPSSN----RPSMKSVRVSSA--PVFS
KTSA----------------PASSRDLLSTFV-----TRPGKASNATGI-----------
----------KQENKLGFFAN--WNFFK---GPSSA--SHD---IRATKQKASASRPE--
----SNSADCR--------SKTLEKMAPRRFSP-RSPVKAPVFDSLISYEDLREALSTEI
ILTSNR