MUSCLE (3.8) multiple sequence alignment

KLLA0C00374g            ---MSRIPIHSLLNPS--ESCKSISNVPS-----------NYRDLSTFNKERAKVITTFQ
KLTH0F00396g            ---MSHISVSSLLNLP--------------------------------------------
Kwal_YGOB_HMalpha2      ---MGRQLVSEMLFLA--------------------------------------------
TDEL0C07000             --MTTKIPINLLLNPQ--QHDDKKEKKDKSESCSKLRGTRVTQHKREADELFFKLSNGIG
Ecym_1002               ---MNRIPIISLLNPSPGDSHNIRQTLTSSSTFSLKKDTYEADILLKMRNELMKLHSSIC
TBLA0A07600             ---MNKIPIDTLLNPT--NSENIKEQLQN------------------LNKELLSMCSRLP
ZYRO0F18568g            ---MNKIPIERLLNPV--HQEFPHEKLKN------------------INNKLLALCSKLP
Suva_3.147              ---MNKIPIKDLLNPQ--ITDEFKSSILD------------------INKKLFSICCNLP
YCL067C                 ---MNKIPIKDLLNPQ--ITDEFKSSILD------------------INKKLFSICCNLP
CAGL0B00264g            MSKKSRISITHLLNPI--QEENLKEKLQE------------------INNQLISLCSSLP
Kpol_2002.3             ---MNKIPINILLNPS--HQENLKDKLQQ------------------INDKLTSLCSKIP
TPHA0E04070             ---MNKIPINKLLNPS--QHYNLTEKLQQ------------------INITLSNLCTKLP
KNAG0C00160             ---MNRIEIQDLLNNQ--DCSSLDKDFKN------------------INSQLLEICSNFP
NDAI0A00110             ---MNKIAISDLLNPP--TAGPVTSNLDS------------------INNQLVTICSKFP
NCAS0B09140             ---MNKIAIHDLLNPP--NTTKTHEQLES------------------INTQLNTICSVFP
                             .  :  :*                                               

KLLA0C00374g            EMFYSMLENNDDYNKIESLIRNFQPKLTWSHKCESLTFKQKAYLTAIIQKSIKSLLVLLK
KLTH0F00396g            ----------------------------------------------VFQAS---------
Kwal_YGOB_HMalpha2      ------------------------------------------------------------
TDEL0C07000             KP----------EFELRCELKKVLSSLKVVTTNGKLEENGELLLRTTFQLS-KTLSVVLS
Ecym_1002               CT-------NIENGEVNFILNKVLQGLKILSSDQVFSKPDRVVIQNISQLT-AIIVRLVN
TBLA0A07600             SA----------KSMEETQLSEILKFLTKTIKHEPLGKEETELVTTTVQLS-TVLSSLVK
ZYRO0F18568g            SE-------NEQFEKDKAELEKILPSLNILIRECGSSKEDQKMVHRIHQLS-SVFSLLLN
Suva_3.147              KL------PESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLT-TTITVLLK
YCL067C                 KL------PESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLT-TTITVLLK
CAGL0B00264g            KR-----------QSLPGPSSDILRFLSR----NNLDPQEIGLIKTTYRLS-TLLSKL--
Kpol_2002.3             GN------TSGLEQEDHLELQRILLFLTTVVKNEKLDNDEIMLVRTTYQLS-TTLSIMVK
TPHA0E04070             DT------ITDLTEADHRELQDILLYLTTVVKQQELKKEEIMLVKTTYQLC-TTLTLMVK
KNAG0C00160             KE------LLSNHGELQMQLQGILLFLTKLVGKNDLSVTLKNEARMTYQFS-KIIASLLK
NDAI0A00110             TA------KENVDGSYQIQLHNIVSFLSTLTQSTNLTSKDCSNIQLTYELS-SMLGKVLK
NCAS0B09140             TT------ENLDFKTYQEQLRNIAVTLSSLTNQNELSSENKNVLRVTYQIS-SVLLKLLG
                                                                                    

KLLA0C00374g            EKGKMRE-----IEF--------SRKEVRKINKYRQSSKNFESVNIKILTQDLMHSNNN-
KLTH0F00396g            ---------------------------------------HQEKATSPITSQSCLVASGK-
Kwal_YGOB_HMalpha2      -----------------------------------------DAIGKKILSFKFLNSAAR-
TDEL0C07000             EFKKVEE-----------------SNIQFHKSRDWDSERKETNLRCKVPNFEIVPLNTKQ
Ecym_1002               KKEDIIN-------L--------QKGLVDPKEIPEAISKEKCGIIFNVVTQDMMENGRK-
TBLA0A07600             EARQLHR--------------------------LHHSQSTHNPRVFNVLTQHMMSNSNST
ZYRO0F18568g            EVSELKS-KRSQFLR--------SKPKYHLPYAAALGNTGKEGMVFNIVTQDTLNSARR-
Suva_3.147              EMRSIEN--------------------DRSNYQLTQKNKSADGLVFNVVTQDMINKSTK-
YCL067C                 EMRSIEN--------------------DRSNYQLTQKNKSADGLVFNVVTQDMINKSTK-
CAGL0B00264g            ---------------------------------------REHEIVFNVVTKDHLLKKGV-
Kpol_2002.3             SLRMANENYESQTSK--------ENSEEELTSPSSSDSNDRNEFVFNIVTQDMMNKKKM-
TPHA0E04070             SCKQENDKENKENEIIKYESGTSDNSETNSSCNSSDNEDKNSILVFNVITQDMMNNNKK-
KNAG0C00160             SFEDF----------------------FFERKEYNDPATSENEFVFSVVTQDMMNKRKE-
NDAI0A00110             DMVLLNG----------------TEEVEKKKVKEEEELETNSKYVFNVITQDMMIPEKN-
NCAS0B09140             ENAHNKD--------------------QPKTPTSGSESERNPKLVFNILTKKRMSPTSN-
                                                                       : .   :      

KLLA0C00374g            ----------------------------------------------EFKKGKRFPKSHIQ
KLTH0F00396g            --------------------------------------------------QRKFNATAKK
Kwal_YGOB_HMalpha2      ----------------------------------------------GNQKVSKYPHNISM
TDEL0C07000             -----------------------------------------DYSTGKRHRGHRLPSEKVE
Ecym_1002               -------------------------------------------GGSSSYKGHRLPKKHVQ
TBLA0A07600             STSPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHTPSHRGHRLPKHTLI
ZYRO0F18568g            --------------------------------------------SNKTYRGHRLPKHITR
Suva_3.147              -----------------------------------------------PYRGHRFTKENVR
YCL067C                 -----------------------------------------------PYRGHRFTKENVR
CAGL0B00264g            -----------------------------------------PNHYAASYRGHRFTRENVQ
Kpol_2002.3             --------------------------------------------NIKSYRGHRLPKQNVK
TPHA0E04070             --------------------------------------------NNKSYRGHRLPKKNVQ
KNAG0C00160             --------------------------------------------SMRPCRGHRFSSNSTE
NDAI0A00110             ----------------------------------------------KPHRGHRLPKEKVN
NCAS0B09140             ----------------------------------------------EPRRGHRLAKEKVD
                                                                            .       

KLLA0C00374g            LLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVS-SDIRNILN
KLTH0F00396g            RLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESID-SLLEPILN
Kwal_YGOB_HMalpha2      HLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPID-SSLHSLLN
TDEL0C07000             KLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAGIA-DTISDLLF
Ecym_1002               LLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTIS-PELSDLLA
TBLA0A07600             PLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER------YKLN----
ZYRO0F18568g            LLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTIS-FEVSELVK
Suva_3.147              ILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIA-PELADLLS
YCL067C                 ILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIA-PELADLLS
CAGL0B00264g            ILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIYISLFDIHNIES
Kpol_2002.3             LLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKEKSITIS-PEVSRLLQ
TPHA0E04070             YLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITIS-PEVSALLR
KNAG0C00160             TLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKEKSIHVS-PVIQDLLQ
NDAI0A00110             RLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKEKLLSIS-PDIVEIIN
NCAS0B09140             LLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKEKSLSIA-PEIVDILN
                         ** *:  :   **        :   : ::  *:.**::*.***..        :     

KLLA0C00374g            -----------------------------
KLTH0F00396g            S----------------------------
Kwal_YGOB_HMalpha2      LSSIYS-----------------------
TDEL0C07000             TKKNSKTDTKV------------------
Ecym_1002               N----------------------------
TBLA0A07600             -----------------------------
ZYRO0F18568g            ESKQGTEELNE------------------
Suva_3.147              GEPLAKKKE--------------------
YCL067C                 GEPLAKKKE--------------------
CAGL0B00264g            GEYAYIEKVCYIIIIICHLFLVFSLSCLT
Kpol_2002.3             ELKTEKA----------------------
TPHA0E04070             DNKTITS----------------------
KNAG0C00160             E----------------------------
NDAI0A00110             TQSCQ------------------------
NCAS0B09140             KQK--------------------------
                                                     

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0C00374g
---MSRIPIHSLLNPS--ESCKSISNVPS-----------NYRDLSTFNKERAKVITTFQ
EMFYSMLENNDDYNKIESLIRNFQPKLTWSHKCESLTFKQKAYLTAIIQKSIKSLLVLLK
EKGKMRE-----IEF--------SRKEVRKINKYRQSSKNFESVNIKILTQDLMHSNNN-
----------------------------------------------EFKKGKRFPKSHIQ
LLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITEVS-SDIRNILN
-----------------------------
>KLTH0F00396g
---MSHISVSSLLNLP--------------------------------------------
----------------------------------------------VFQAS---------
---------------------------------------HQEKATSPITSQSCLVASGK-
--------------------------------------------------QRKFNATAKK
RLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESID-SLLEPILN
S----------------------------
>Kwal_YGOB_HMalpha2
---MGRQLVSEMLFLA--------------------------------------------
------------------------------------------------------------
-----------------------------------------DAIGKKILSFKFLNSAAR-
----------------------------------------------GNQKVSKYPHNISM
HLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSKKNPID-SSLHSLLN
LSSIYS-----------------------
>TDEL0C07000
--MTTKIPINLLLNPQ--QHDDKKEKKDKSESCSKLRGTRVTQHKREADELFFKLSNGIG
KP----------EFELRCELKKVLSSLKVVTTNGKLEENGELLLRTTFQLS-KTLSVVLS
EFKKVEE-----------------SNIQFHKSRDWDSERKETNLRCKVPNFEIVPLNTKQ
-----------------------------------------DYSTGKRHRGHRLPSEKVE
KLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAGIA-DTISDLLF
TKKNSKTDTKV------------------
>Ecym_1002
---MNRIPIISLLNPSPGDSHNIRQTLTSSSTFSLKKDTYEADILLKMRNELMKLHSSIC
CT-------NIENGEVNFILNKVLQGLKILSSDQVFSKPDRVVIQNISQLT-AIIVRLVN
KKEDIIN-------L--------QKGLVDPKEIPEAISKEKCGIIFNVVTQDMMENGRK-
-------------------------------------------GGSSSYKGHRLPKKHVQ
LLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTIS-PELSDLLA
N----------------------------
>TBLA0A07600
---MNKIPIDTLLNPT--NSENIKEQLQN------------------LNKELLSMCSRLP
SA----------KSMEETQLSEILKFLTKTIKHEPLGKEETELVTTTVQLS-TVLSSLVK
EARQLHR--------------------------LHHSQSTHNPRVFNVLTQHMMSNSNST
STSPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHTPSHRGHRLPKHTLI
PLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER------YKLN----
-----------------------------
>ZYRO0F18568g
---MNKIPIERLLNPV--HQEFPHEKLKN------------------INNKLLALCSKLP
SE-------NEQFEKDKAELEKILPSLNILIRECGSSKEDQKMVHRIHQLS-SVFSLLLN
EVSELKS-KRSQFLR--------SKPKYHLPYAAALGNTGKEGMVFNIVTQDTLNSARR-
--------------------------------------------SNKTYRGHRLPKHITR
LLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKEKSLTIS-FEVSELVK
ESKQGTEELNE------------------
>Suva_3.147
---MNKIPIKDLLNPQ--ITDEFKSSILD------------------INKKLFSICCNLP
KL------PESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLT-TTITVLLK
EMRSIEN--------------------DRSNYQLTQKNKSADGLVFNVVTQDMINKSTK-
-----------------------------------------------PYRGHRFTKENVR
ILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIA-PELADLLS
GEPLAKKKE--------------------
>YCL067C
---MNKIPIKDLLNPQ--ITDEFKSSILD------------------INKKLFSICCNLP
KL------PESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLT-TTITVLLK
EMRSIEN--------------------DRSNYQLTQKNKSADGLVFNVVTQDMINKSTK-
-----------------------------------------------PYRGHRFTKENVR
ILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIA-PELADLLS
GEPLAKKKE--------------------
>CAGL0B00264g
MSKKSRISITHLLNPI--QEENLKEKLQE------------------INNQLISLCSSLP
KR-----------QSLPGPSSDILRFLSR----NNLDPQEIGLIKTTYRLS-TLLSKL--
---------------------------------------REHEIVFNVVTKDHLLKKGV-
-----------------------------------------PNHYAASYRGHRFTRENVQ
ILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIYISLFDIHNIES
GEYAYIEKVCYIIIIICHLFLVFSLSCLT
>Kpol_2002.3
---MNKIPINILLNPS--HQENLKDKLQQ------------------INDKLTSLCSKIP
GN------TSGLEQEDHLELQRILLFLTTVVKNEKLDNDEIMLVRTTYQLS-TTLSIMVK
SLRMANENYESQTSK--------ENSEEELTSPSSSDSNDRNEFVFNIVTQDMMNKKKM-
--------------------------------------------NIKSYRGHRLPKQNVK
LLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKEKSITIS-PEVSRLLQ
ELKTEKA----------------------
>TPHA0E04070
---MNKIPINKLLNPS--QHYNLTEKLQQ------------------INITLSNLCTKLP
DT------ITDLTEADHRELQDILLYLTTVVKQQELKKEEIMLVKTTYQLC-TTLTLMVK
SCKQENDKENKENEIIKYESGTSDNSETNSSCNSSDNEDKNSILVFNVITQDMMNNNKK-
--------------------------------------------NNKSYRGHRLPKKNVQ
YLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITIS-PEVSALLR
DNKTITS----------------------
>KNAG0C00160
---MNRIEIQDLLNNQ--DCSSLDKDFKN------------------INSQLLEICSNFP
KE------LLSNHGELQMQLQGILLFLTKLVGKNDLSVTLKNEARMTYQFS-KIIASLLK
SFEDF----------------------FFERKEYNDPATSENEFVFSVVTQDMMNKRKE-
--------------------------------------------SMRPCRGHRFSSNSTE
TLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKEKSIHVS-PVIQDLLQ
E----------------------------
>NDAI0A00110
---MNKIAISDLLNPP--TAGPVTSNLDS------------------INNQLVTICSKFP
TA------KENVDGSYQIQLHNIVSFLSTLTQSTNLTSKDCSNIQLTYELS-SMLGKVLK
DMVLLNG----------------TEEVEKKKVKEEEELETNSKYVFNVITQDMMIPEKN-
----------------------------------------------KPHRGHRLPKEKVN
RLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKEKLLSIS-PDIVEIIN
TQSCQ------------------------
>NCAS0B09140
---MNKIAIHDLLNPP--NTTKTHEQLES------------------INTQLNTICSVFP
TT------ENLDFKTYQEQLRNIAVTLSSLTNQNELSSENKNVLRVTYQIS-SVLLKLLG
ENAHNKD--------------------QPKTPTSGSESERNPKLVFNILTKKRMSPTSN-
----------------------------------------------EPRRGHRLAKEKVD
LLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKEKSLSIA-PEIVDILN
KQK--------------------------